diff --git a/Godeps/Godeps.json b/Godeps/Godeps.json index 7e4d98ae..e8158d51 100644 --- a/Godeps/Godeps.json +++ b/Godeps/Godeps.json @@ -6,46 +6,14 @@ "./..." ], "Deps": [ - { - "ImportPath": "github.com/PuerkitoBio/purell", - "Rev": "8a290539e2e8629dbc4e6bad948158f790ec31f4" - }, - { - "ImportPath": "github.com/PuerkitoBio/urlesc", - "Rev": "5bd2802263f21d8788851d5305584c82a5c75d7e" - }, { "ImportPath": "github.com/davecgh/go-spew/spew", "Rev": "782f4967f2dc4564575ca782fe2d04090b5faca8" }, - { - "ImportPath": "github.com/emicklei/go-restful", - "Rev": "ff4f55a206334ef123e4f79bbf348980da81ca46" - }, - { - "ImportPath": "github.com/emicklei/go-restful/log", - "Rev": "ff4f55a206334ef123e4f79bbf348980da81ca46" - }, { "ImportPath": "github.com/ghodss/yaml", "Rev": "73d445a93680fa1a78ae23a5839bad48f32ba1ee" }, - { - "ImportPath": "github.com/go-openapi/jsonpointer", - "Rev": "46af16f9f7b149af66e5d1bd010e3574dc06de98" - }, - { - "ImportPath": "github.com/go-openapi/jsonreference", - "Rev": "13c6e3589ad90f49bd3e3bbe2c2cb3d7a4142272" - }, - { - "ImportPath": "github.com/go-openapi/spec", - "Rev": "7abd5745472fff5eb3685386d5fb8bf38683154d" - }, - { - "ImportPath": "github.com/go-openapi/swag", - "Rev": "f3f9494671f93fcff853e3c6e9e948b3eb71e590" - }, { "ImportPath": "github.com/gogo/protobuf/proto", "Rev": "c0656edd0d9eab7c66d1eb0c568f9039345796f7" @@ -122,18 +90,6 @@ "ImportPath": "github.com/juju/ratelimit", "Rev": "5b9ff866471762aa2ab2dced63c9fb6f53921342" }, - { - "ImportPath": "github.com/mailru/easyjson/buffer", - "Rev": "2f5df55504ebc322e4d52d34df6a1f5b503bf26d" - }, - { - "ImportPath": "github.com/mailru/easyjson/jlexer", - "Rev": "2f5df55504ebc322e4d52d34df6a1f5b503bf26d" - }, - { - "ImportPath": "github.com/mailru/easyjson/jwriter", - "Rev": "2f5df55504ebc322e4d52d34df6a1f5b503bf26d" - }, { "ImportPath": "github.com/spf13/pflag", "Rev": "9ff6c6923cfffbcd502984b8e0c80539a94968b7" @@ -170,34 +126,10 @@ "ImportPath": "golang.org/x/sys/windows", "Rev": "95c6576299259db960f6c5b9b69ea52422860fce" }, - { - "ImportPath": "golang.org/x/text/cases", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, - { - "ImportPath": "golang.org/x/text/internal", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, - { - "ImportPath": "golang.org/x/text/internal/tag", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, - { - "ImportPath": "golang.org/x/text/language", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, - { - "ImportPath": "golang.org/x/text/runes", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, { "ImportPath": "golang.org/x/text/secure/bidirule", "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, - { - "ImportPath": "golang.org/x/text/secure/precis", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, { "ImportPath": "golang.org/x/text/transform", "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" @@ -210,10 +142,6 @@ "ImportPath": "golang.org/x/text/unicode/norm", "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" }, - { - "ImportPath": "golang.org/x/text/width", - "Rev": "b19bf474d317b857955b12035d2c5acb57ce8b01" - }, { "ImportPath": "gopkg.in/inf.v0", "Rev": "3887ee99ecf07df5b447e9b00d9c0b2adaa9f3e4" @@ -224,755 +152,751 @@ }, { "ImportPath": "k8s.io/api/admissionregistration/v1alpha1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/admissionregistration/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/apps/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/apps/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/apps/v1beta2", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/authentication/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/authentication/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/authorization/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/authorization/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/autoscaling/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/autoscaling/v2beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/batch/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/batch/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/batch/v2alpha1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/certificates/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/core/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/events/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/extensions/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/networking/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/policy/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/rbac/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/rbac/v1alpha1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/rbac/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/scheduling/v1alpha1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/settings/v1alpha1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/storage/v1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/storage/v1alpha1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/api/storage/v1beta1", - "Rev": "b9bce47306043e17d4bab456a30f766872e2c6c0" + "Rev": "17e8c4ddcf485c837950b38d9509bfcadfd0c8e1" }, { "ImportPath": "k8s.io/apimachinery/pkg/api/errors", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/api/meta", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/api/resource", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/apis/meta/internalversion", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/apis/meta/v1", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/apis/meta/v1/unstructured", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/apis/meta/v1alpha1", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/conversion", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/conversion/queryparams", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/fields", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/labels", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/schema", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/serializer", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/serializer/json", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/serializer/protobuf", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/serializer/recognizer", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/serializer/streaming", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/runtime/serializer/versioning", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/selection", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/types", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/cache", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/clock", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/diff", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/errors", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/framer", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/intstr", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/json", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/mergepatch", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/net", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/runtime", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/sets", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/strategicpatch", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/validation", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/validation/field", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/wait", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/util/yaml", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/version", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/pkg/watch", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/third_party/forked/golang/json", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/apimachinery/third_party/forked/golang/reflect", - "Rev": "d86399872a1f1082d33982f7f9b37a2ce7c2e307" + "Rev": "c33db96a31b68b53ce6903caf3ba93571acb0e51" }, { "ImportPath": "k8s.io/client-go/discovery", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/discovery/fake", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/admissionregistration", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/admissionregistration/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/admissionregistration/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/apps", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/apps/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/apps/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/apps/v1beta2", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/autoscaling", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/autoscaling/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/autoscaling/v2beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/batch", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/batch/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/batch/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/batch/v2alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/certificates", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/certificates/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/core", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/core/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/events", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/events/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/extensions", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/extensions/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/internalinterfaces", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/networking", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/networking/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/policy", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/policy/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/rbac", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/rbac/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/rbac/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/rbac/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/scheduling", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/scheduling/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/settings", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/settings/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/storage", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/storage/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/storage/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/informers/storage/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/scheme", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/admissionregistration/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/admissionregistration/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/apps/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/apps/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/apps/v1beta2", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/authentication/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/authentication/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/authorization/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/authorization/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/autoscaling/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/autoscaling/v2beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/batch/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/batch/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/batch/v2alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/certificates/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/core/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/events/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/extensions/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/networking/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/policy/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/rbac/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/rbac/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/rbac/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/scheduling/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/settings/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/storage/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/storage/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/kubernetes/typed/storage/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/admissionregistration/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/admissionregistration/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/apps/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/apps/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/apps/v1beta2", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/autoscaling/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/autoscaling/v2beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/batch/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/batch/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/batch/v2alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/certificates/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/core/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/events/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/extensions/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/networking/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/policy/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/rbac/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/rbac/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/rbac/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/scheduling/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/settings/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/storage/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/storage/v1alpha1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/listers/storage/v1beta1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/pkg/version", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/rest", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/rest/watch", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/testing", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/auth", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/cache", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/clientcmd", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/clientcmd/api", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/clientcmd/api/latest", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/clientcmd/api/v1", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/metrics", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/pager", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/record", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/tools/reference", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/transport", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/util/buffer", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/util/cert", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/util/flowcontrol", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/util/homedir", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/util/integer", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/client-go/util/workqueue", - "Rev": "dde6ef6eafb8d5315baebf739933ad7550665943" - }, - { - "ImportPath": "k8s.io/kube-openapi/pkg/common", - "Rev": "39a7bf85c140f972372c2a0d1ee40adbf0c8bfe1" + "Rev": "b1fb949a8b508e11971a4f708035f167ffb8a3a7" }, { "ImportPath": "k8s.io/kube-openapi/pkg/util/proto", - "Rev": "39a7bf85c140f972372c2a0d1ee40adbf0c8bfe1" + "Rev": "a07b7bbb58e7fdc5144f8d7046331d29fc9ad3b3" } ] } diff --git a/vendor/github.com/PuerkitoBio/purell/.gitignore b/vendor/github.com/PuerkitoBio/purell/.gitignore deleted file mode 100644 index 748e4c80..00000000 --- a/vendor/github.com/PuerkitoBio/purell/.gitignore +++ /dev/null @@ -1,5 +0,0 @@ -*.sublime-* -.DS_Store -*.swp -*.swo -tags diff --git a/vendor/github.com/PuerkitoBio/purell/.travis.yml b/vendor/github.com/PuerkitoBio/purell/.travis.yml deleted file mode 100644 index facfc91c..00000000 --- a/vendor/github.com/PuerkitoBio/purell/.travis.yml +++ /dev/null @@ -1,7 +0,0 @@ -language: go - -go: - - 1.4 - - 1.5 - - 1.6 - - tip diff --git a/vendor/github.com/PuerkitoBio/purell/LICENSE b/vendor/github.com/PuerkitoBio/purell/LICENSE deleted file mode 100644 index 4b9986de..00000000 --- a/vendor/github.com/PuerkitoBio/purell/LICENSE +++ /dev/null @@ -1,12 +0,0 @@ -Copyright (c) 2012, Martin Angers -All rights reserved. - -Redistribution and use in source and binary forms, with or without modification, are permitted provided that the following conditions are met: - -* Redistributions of source code must retain the above copyright notice, this list of conditions and the following disclaimer. - -* Redistributions in binary form must reproduce the above copyright notice, this list of conditions and the following disclaimer in the documentation and/or other materials provided with the distribution. - -* Neither the name of the author nor the names of its contributors may be used to endorse or promote products derived from this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/PuerkitoBio/purell/README.md b/vendor/github.com/PuerkitoBio/purell/README.md deleted file mode 100644 index a78a3df6..00000000 --- a/vendor/github.com/PuerkitoBio/purell/README.md +++ /dev/null @@ -1,185 +0,0 @@ -# Purell - -Purell is a tiny Go library to normalize URLs. It returns a pure URL. Pure-ell. Sanitizer and all. Yeah, I know... - -Based on the [wikipedia paper][wiki] and the [RFC 3986 document][rfc]. - -[![build status](https://secure.travis-ci.org/PuerkitoBio/purell.png)](http://travis-ci.org/PuerkitoBio/purell) - -## Install - -`go get github.com/PuerkitoBio/purell` - -## Changelog - -* **2016-07-27 (v1.0.0)** : Normalize IDN to ASCII (thanks to @zenovich). -* **2015-02-08** : Add fix for relative paths issue ([PR #5][pr5]) and add fix for unnecessary encoding of reserved characters ([see issue #7][iss7]). -* **v0.2.0** : Add benchmarks, Attempt IDN support. -* **v0.1.0** : Initial release. - -## Examples - -From `example_test.go` (note that in your code, you would import "github.com/PuerkitoBio/purell", and would prefix references to its methods and constants with "purell."): - -```go -package purell - -import ( - "fmt" - "net/url" -) - -func ExampleNormalizeURLString() { - if normalized, err := NormalizeURLString("hTTp://someWEBsite.com:80/Amazing%3f/url/", - FlagLowercaseScheme|FlagLowercaseHost|FlagUppercaseEscapes); err != nil { - panic(err) - } else { - fmt.Print(normalized) - } - // Output: http://somewebsite.com:80/Amazing%3F/url/ -} - -func ExampleMustNormalizeURLString() { - normalized := MustNormalizeURLString("hTTpS://someWEBsite.com:443/Amazing%fa/url/", - FlagsUnsafeGreedy) - fmt.Print(normalized) - - // Output: http://somewebsite.com/Amazing%FA/url -} - -func ExampleNormalizeURL() { - if u, err := url.Parse("Http://SomeUrl.com:8080/a/b/.././c///g?c=3&a=1&b=9&c=0#target"); err != nil { - panic(err) - } else { - normalized := NormalizeURL(u, FlagsUsuallySafeGreedy|FlagRemoveDuplicateSlashes|FlagRemoveFragment) - fmt.Print(normalized) - } - - // Output: http://someurl.com:8080/a/c/g?c=3&a=1&b=9&c=0 -} -``` - -## API - -As seen in the examples above, purell offers three methods, `NormalizeURLString(string, NormalizationFlags) (string, error)`, `MustNormalizeURLString(string, NormalizationFlags) (string)` and `NormalizeURL(*url.URL, NormalizationFlags) (string)`. They all normalize the provided URL based on the specified flags. Here are the available flags: - -```go -const ( - // Safe normalizations - FlagLowercaseScheme NormalizationFlags = 1 << iota // HTTP://host -> http://host, applied by default in Go1.1 - FlagLowercaseHost // http://HOST -> http://host - FlagUppercaseEscapes // http://host/t%ef -> http://host/t%EF - FlagDecodeUnnecessaryEscapes // http://host/t%41 -> http://host/tA - FlagEncodeNecessaryEscapes // http://host/!"#$ -> http://host/%21%22#$ - FlagRemoveDefaultPort // http://host:80 -> http://host - FlagRemoveEmptyQuerySeparator // http://host/path? -> http://host/path - - // Usually safe normalizations - FlagRemoveTrailingSlash // http://host/path/ -> http://host/path - FlagAddTrailingSlash // http://host/path -> http://host/path/ (should choose only one of these add/remove trailing slash flags) - FlagRemoveDotSegments // http://host/path/./a/b/../c -> http://host/path/a/c - - // Unsafe normalizations - FlagRemoveDirectoryIndex // http://host/path/index.html -> http://host/path/ - FlagRemoveFragment // http://host/path#fragment -> http://host/path - FlagForceHTTP // https://host -> http://host - FlagRemoveDuplicateSlashes // http://host/path//a///b -> http://host/path/a/b - FlagRemoveWWW // http://www.host/ -> http://host/ - FlagAddWWW // http://host/ -> http://www.host/ (should choose only one of these add/remove WWW flags) - FlagSortQuery // http://host/path?c=3&b=2&a=1&b=1 -> http://host/path?a=1&b=1&b=2&c=3 - - // Normalizations not in the wikipedia article, required to cover tests cases - // submitted by jehiah - FlagDecodeDWORDHost // http://1113982867 -> http://66.102.7.147 - FlagDecodeOctalHost // http://0102.0146.07.0223 -> http://66.102.7.147 - FlagDecodeHexHost // http://0x42660793 -> http://66.102.7.147 - FlagRemoveUnnecessaryHostDots // http://.host../path -> http://host/path - FlagRemoveEmptyPortSeparator // http://host:/path -> http://host/path - - // Convenience set of safe normalizations - FlagsSafe NormalizationFlags = FlagLowercaseHost | FlagLowercaseScheme | FlagUppercaseEscapes | FlagDecodeUnnecessaryEscapes | FlagEncodeNecessaryEscapes | FlagRemoveDefaultPort | FlagRemoveEmptyQuerySeparator - - // For convenience sets, "greedy" uses the "remove trailing slash" and "remove www. prefix" flags, - // while "non-greedy" uses the "add (or keep) the trailing slash" and "add www. prefix". - - // Convenience set of usually safe normalizations (includes FlagsSafe) - FlagsUsuallySafeGreedy NormalizationFlags = FlagsSafe | FlagRemoveTrailingSlash | FlagRemoveDotSegments - FlagsUsuallySafeNonGreedy NormalizationFlags = FlagsSafe | FlagAddTrailingSlash | FlagRemoveDotSegments - - // Convenience set of unsafe normalizations (includes FlagsUsuallySafe) - FlagsUnsafeGreedy NormalizationFlags = FlagsUsuallySafeGreedy | FlagRemoveDirectoryIndex | FlagRemoveFragment | FlagForceHTTP | FlagRemoveDuplicateSlashes | FlagRemoveWWW | FlagSortQuery - FlagsUnsafeNonGreedy NormalizationFlags = FlagsUsuallySafeNonGreedy | FlagRemoveDirectoryIndex | FlagRemoveFragment | FlagForceHTTP | FlagRemoveDuplicateSlashes | FlagAddWWW | FlagSortQuery - - // Convenience set of all available flags - FlagsAllGreedy = FlagsUnsafeGreedy | FlagDecodeDWORDHost | FlagDecodeOctalHost | FlagDecodeHexHost | FlagRemoveUnnecessaryHostDots | FlagRemoveEmptyPortSeparator - FlagsAllNonGreedy = FlagsUnsafeNonGreedy | FlagDecodeDWORDHost | FlagDecodeOctalHost | FlagDecodeHexHost | FlagRemoveUnnecessaryHostDots | FlagRemoveEmptyPortSeparator -) -``` - -For convenience, the set of flags `FlagsSafe`, `FlagsUsuallySafe[Greedy|NonGreedy]`, `FlagsUnsafe[Greedy|NonGreedy]` and `FlagsAll[Greedy|NonGreedy]` are provided for the similarly grouped normalizations on [wikipedia's URL normalization page][wiki]. You can add (using the bitwise OR `|` operator) or remove (using the bitwise AND NOT `&^` operator) individual flags from the sets if required, to build your own custom set. - -The [full godoc reference is available on gopkgdoc][godoc]. - -Some things to note: - -* `FlagDecodeUnnecessaryEscapes`, `FlagEncodeNecessaryEscapes`, `FlagUppercaseEscapes` and `FlagRemoveEmptyQuerySeparator` are always implicitly set, because internally, the URL string is parsed as an URL object, which automatically decodes unnecessary escapes, uppercases and encodes necessary ones, and removes empty query separators (an unnecessary `?` at the end of the url). So this operation cannot **not** be done. For this reason, `FlagRemoveEmptyQuerySeparator` (as well as the other three) has been included in the `FlagsSafe` convenience set, instead of `FlagsUnsafe`, where Wikipedia puts it. - -* The `FlagDecodeUnnecessaryEscapes` decodes the following escapes (*from -> to*): - - %24 -> $ - - %26 -> & - - %2B-%3B -> +,-./0123456789:; - - %3D -> = - - %40-%5A -> @ABCDEFGHIJKLMNOPQRSTUVWXYZ - - %5F -> _ - - %61-%7A -> abcdefghijklmnopqrstuvwxyz - - %7E -> ~ - - -* When the `NormalizeURL` function is used (passing an URL object), this source URL object is modified (that is, after the call, the URL object will be modified to reflect the normalization). - -* The *replace IP with domain name* normalization (`http://208.77.188.166/ → http://www.example.com/`) is obviously not possible for a library without making some network requests. This is not implemented in purell. - -* The *remove unused query string parameters* and *remove default query parameters* are also not implemented, since this is a very case-specific normalization, and it is quite trivial to do with an URL object. - -### Safe vs Usually Safe vs Unsafe - -Purell allows you to control the level of risk you take while normalizing an URL. You can aggressively normalize, play it totally safe, or anything in between. - -Consider the following URL: - -`HTTPS://www.RooT.com/toto/t%45%1f///a/./b/../c/?z=3&w=2&a=4&w=1#invalid` - -Normalizing with the `FlagsSafe` gives: - -`https://www.root.com/toto/tE%1F///a/./b/../c/?z=3&w=2&a=4&w=1#invalid` - -With the `FlagsUsuallySafeGreedy`: - -`https://www.root.com/toto/tE%1F///a/c?z=3&w=2&a=4&w=1#invalid` - -And with `FlagsUnsafeGreedy`: - -`http://root.com/toto/tE%1F/a/c?a=4&w=1&w=2&z=3` - -## TODOs - -* Add a class/default instance to allow specifying custom directory index names? At the moment, removing directory index removes `(^|/)((?:default|index)\.\w{1,4})$`. - -## Thanks / Contributions - -@rogpeppe -@jehiah -@opennota -@pchristopher1275 -@zenovich - -## License - -The [BSD 3-Clause license][bsd]. - -[bsd]: http://opensource.org/licenses/BSD-3-Clause -[wiki]: http://en.wikipedia.org/wiki/URL_normalization -[rfc]: http://tools.ietf.org/html/rfc3986#section-6 -[godoc]: http://go.pkgdoc.org/github.com/PuerkitoBio/purell -[pr5]: https://github.com/PuerkitoBio/purell/pull/5 -[iss7]: https://github.com/PuerkitoBio/purell/issues/7 diff --git a/vendor/github.com/PuerkitoBio/purell/purell.go b/vendor/github.com/PuerkitoBio/purell/purell.go deleted file mode 100644 index b79da64b..00000000 --- a/vendor/github.com/PuerkitoBio/purell/purell.go +++ /dev/null @@ -1,375 +0,0 @@ -/* -Package purell offers URL normalization as described on the wikipedia page: -http://en.wikipedia.org/wiki/URL_normalization -*/ -package purell - -import ( - "bytes" - "fmt" - "net/url" - "regexp" - "sort" - "strconv" - "strings" - - "github.com/PuerkitoBio/urlesc" - "golang.org/x/net/idna" - "golang.org/x/text/secure/precis" - "golang.org/x/text/unicode/norm" -) - -// A set of normalization flags determines how a URL will -// be normalized. -type NormalizationFlags uint - -const ( - // Safe normalizations - FlagLowercaseScheme NormalizationFlags = 1 << iota // HTTP://host -> http://host, applied by default in Go1.1 - FlagLowercaseHost // http://HOST -> http://host - FlagUppercaseEscapes // http://host/t%ef -> http://host/t%EF - FlagDecodeUnnecessaryEscapes // http://host/t%41 -> http://host/tA - FlagEncodeNecessaryEscapes // http://host/!"#$ -> http://host/%21%22#$ - FlagRemoveDefaultPort // http://host:80 -> http://host - FlagRemoveEmptyQuerySeparator // http://host/path? -> http://host/path - - // Usually safe normalizations - FlagRemoveTrailingSlash // http://host/path/ -> http://host/path - FlagAddTrailingSlash // http://host/path -> http://host/path/ (should choose only one of these add/remove trailing slash flags) - FlagRemoveDotSegments // http://host/path/./a/b/../c -> http://host/path/a/c - - // Unsafe normalizations - FlagRemoveDirectoryIndex // http://host/path/index.html -> http://host/path/ - FlagRemoveFragment // http://host/path#fragment -> http://host/path - FlagForceHTTP // https://host -> http://host - FlagRemoveDuplicateSlashes // http://host/path//a///b -> http://host/path/a/b - FlagRemoveWWW // http://www.host/ -> http://host/ - FlagAddWWW // http://host/ -> http://www.host/ (should choose only one of these add/remove WWW flags) - FlagSortQuery // http://host/path?c=3&b=2&a=1&b=1 -> http://host/path?a=1&b=1&b=2&c=3 - - // Normalizations not in the wikipedia article, required to cover tests cases - // submitted by jehiah - FlagDecodeDWORDHost // http://1113982867 -> http://66.102.7.147 - FlagDecodeOctalHost // http://0102.0146.07.0223 -> http://66.102.7.147 - FlagDecodeHexHost // http://0x42660793 -> http://66.102.7.147 - FlagRemoveUnnecessaryHostDots // http://.host../path -> http://host/path - FlagRemoveEmptyPortSeparator // http://host:/path -> http://host/path - - // Convenience set of safe normalizations - FlagsSafe NormalizationFlags = FlagLowercaseHost | FlagLowercaseScheme | FlagUppercaseEscapes | FlagDecodeUnnecessaryEscapes | FlagEncodeNecessaryEscapes | FlagRemoveDefaultPort | FlagRemoveEmptyQuerySeparator - - // For convenience sets, "greedy" uses the "remove trailing slash" and "remove www. prefix" flags, - // while "non-greedy" uses the "add (or keep) the trailing slash" and "add www. prefix". - - // Convenience set of usually safe normalizations (includes FlagsSafe) - FlagsUsuallySafeGreedy NormalizationFlags = FlagsSafe | FlagRemoveTrailingSlash | FlagRemoveDotSegments - FlagsUsuallySafeNonGreedy NormalizationFlags = FlagsSafe | FlagAddTrailingSlash | FlagRemoveDotSegments - - // Convenience set of unsafe normalizations (includes FlagsUsuallySafe) - FlagsUnsafeGreedy NormalizationFlags = FlagsUsuallySafeGreedy | FlagRemoveDirectoryIndex | FlagRemoveFragment | FlagForceHTTP | FlagRemoveDuplicateSlashes | FlagRemoveWWW | FlagSortQuery - FlagsUnsafeNonGreedy NormalizationFlags = FlagsUsuallySafeNonGreedy | FlagRemoveDirectoryIndex | FlagRemoveFragment | FlagForceHTTP | FlagRemoveDuplicateSlashes | FlagAddWWW | FlagSortQuery - - // Convenience set of all available flags - FlagsAllGreedy = FlagsUnsafeGreedy | FlagDecodeDWORDHost | FlagDecodeOctalHost | FlagDecodeHexHost | FlagRemoveUnnecessaryHostDots | FlagRemoveEmptyPortSeparator - FlagsAllNonGreedy = FlagsUnsafeNonGreedy | FlagDecodeDWORDHost | FlagDecodeOctalHost | FlagDecodeHexHost | FlagRemoveUnnecessaryHostDots | FlagRemoveEmptyPortSeparator -) - -const ( - defaultHttpPort = ":80" - defaultHttpsPort = ":443" -) - -// Regular expressions used by the normalizations -var rxPort = regexp.MustCompile(`(:\d+)/?$`) -var rxDirIndex = regexp.MustCompile(`(^|/)((?:default|index)\.\w{1,4})$`) -var rxDupSlashes = regexp.MustCompile(`/{2,}`) -var rxDWORDHost = regexp.MustCompile(`^(\d+)((?:\.+)?(?:\:\d*)?)$`) -var rxOctalHost = regexp.MustCompile(`^(0\d*)\.(0\d*)\.(0\d*)\.(0\d*)((?:\.+)?(?:\:\d*)?)$`) -var rxHexHost = regexp.MustCompile(`^0x([0-9A-Fa-f]+)((?:\.+)?(?:\:\d*)?)$`) -var rxHostDots = regexp.MustCompile(`^(.+?)(:\d+)?$`) -var rxEmptyPort = regexp.MustCompile(`:+$`) - -// Map of flags to implementation function. -// FlagDecodeUnnecessaryEscapes has no action, since it is done automatically -// by parsing the string as an URL. Same for FlagUppercaseEscapes and FlagRemoveEmptyQuerySeparator. - -// Since maps have undefined traversing order, make a slice of ordered keys -var flagsOrder = []NormalizationFlags{ - FlagLowercaseScheme, - FlagLowercaseHost, - FlagRemoveDefaultPort, - FlagRemoveDirectoryIndex, - FlagRemoveDotSegments, - FlagRemoveFragment, - FlagForceHTTP, // Must be after remove default port (because https=443/http=80) - FlagRemoveDuplicateSlashes, - FlagRemoveWWW, - FlagAddWWW, - FlagSortQuery, - FlagDecodeDWORDHost, - FlagDecodeOctalHost, - FlagDecodeHexHost, - FlagRemoveUnnecessaryHostDots, - FlagRemoveEmptyPortSeparator, - FlagRemoveTrailingSlash, // These two (add/remove trailing slash) must be last - FlagAddTrailingSlash, -} - -// ... and then the map, where order is unimportant -var flags = map[NormalizationFlags]func(*url.URL){ - FlagLowercaseScheme: lowercaseScheme, - FlagLowercaseHost: lowercaseHost, - FlagRemoveDefaultPort: removeDefaultPort, - FlagRemoveDirectoryIndex: removeDirectoryIndex, - FlagRemoveDotSegments: removeDotSegments, - FlagRemoveFragment: removeFragment, - FlagForceHTTP: forceHTTP, - FlagRemoveDuplicateSlashes: removeDuplicateSlashes, - FlagRemoveWWW: removeWWW, - FlagAddWWW: addWWW, - FlagSortQuery: sortQuery, - FlagDecodeDWORDHost: decodeDWORDHost, - FlagDecodeOctalHost: decodeOctalHost, - FlagDecodeHexHost: decodeHexHost, - FlagRemoveUnnecessaryHostDots: removeUnncessaryHostDots, - FlagRemoveEmptyPortSeparator: removeEmptyPortSeparator, - FlagRemoveTrailingSlash: removeTrailingSlash, - FlagAddTrailingSlash: addTrailingSlash, -} - -// MustNormalizeURLString returns the normalized string, and panics if an error occurs. -// It takes an URL string as input, as well as the normalization flags. -func MustNormalizeURLString(u string, f NormalizationFlags) string { - result, e := NormalizeURLString(u, f) - if e != nil { - panic(e) - } - return result -} - -// NormalizeURLString returns the normalized string, or an error if it can't be parsed into an URL object. -// It takes an URL string as input, as well as the normalization flags. -func NormalizeURLString(u string, f NormalizationFlags) (string, error) { - if parsed, e := url.Parse(u); e != nil { - return "", e - } else { - options := make([]precis.Option, 1, 3) - options[0] = precis.IgnoreCase - if f&FlagLowercaseHost == FlagLowercaseHost { - options = append(options, precis.FoldCase()) - } - options = append(options, precis.Norm(norm.NFC)) - profile := precis.NewFreeform(options...) - if parsed.Host, e = idna.ToASCII(profile.NewTransformer().String(parsed.Host)); e != nil { - return "", e - } - return NormalizeURL(parsed, f), nil - } - panic("Unreachable code.") -} - -// NormalizeURL returns the normalized string. -// It takes a parsed URL object as input, as well as the normalization flags. -func NormalizeURL(u *url.URL, f NormalizationFlags) string { - for _, k := range flagsOrder { - if f&k == k { - flags[k](u) - } - } - return urlesc.Escape(u) -} - -func lowercaseScheme(u *url.URL) { - if len(u.Scheme) > 0 { - u.Scheme = strings.ToLower(u.Scheme) - } -} - -func lowercaseHost(u *url.URL) { - if len(u.Host) > 0 { - u.Host = strings.ToLower(u.Host) - } -} - -func removeDefaultPort(u *url.URL) { - if len(u.Host) > 0 { - scheme := strings.ToLower(u.Scheme) - u.Host = rxPort.ReplaceAllStringFunc(u.Host, func(val string) string { - if (scheme == "http" && val == defaultHttpPort) || (scheme == "https" && val == defaultHttpsPort) { - return "" - } - return val - }) - } -} - -func removeTrailingSlash(u *url.URL) { - if l := len(u.Path); l > 0 { - if strings.HasSuffix(u.Path, "/") { - u.Path = u.Path[:l-1] - } - } else if l = len(u.Host); l > 0 { - if strings.HasSuffix(u.Host, "/") { - u.Host = u.Host[:l-1] - } - } -} - -func addTrailingSlash(u *url.URL) { - if l := len(u.Path); l > 0 { - if !strings.HasSuffix(u.Path, "/") { - u.Path += "/" - } - } else if l = len(u.Host); l > 0 { - if !strings.HasSuffix(u.Host, "/") { - u.Host += "/" - } - } -} - -func removeDotSegments(u *url.URL) { - if len(u.Path) > 0 { - var dotFree []string - var lastIsDot bool - - sections := strings.Split(u.Path, "/") - for _, s := range sections { - if s == ".." { - if len(dotFree) > 0 { - dotFree = dotFree[:len(dotFree)-1] - } - } else if s != "." { - dotFree = append(dotFree, s) - } - lastIsDot = (s == "." || s == "..") - } - // Special case if host does not end with / and new path does not begin with / - u.Path = strings.Join(dotFree, "/") - if u.Host != "" && !strings.HasSuffix(u.Host, "/") && !strings.HasPrefix(u.Path, "/") { - u.Path = "/" + u.Path - } - // Special case if the last segment was a dot, make sure the path ends with a slash - if lastIsDot && !strings.HasSuffix(u.Path, "/") { - u.Path += "/" - } - } -} - -func removeDirectoryIndex(u *url.URL) { - if len(u.Path) > 0 { - u.Path = rxDirIndex.ReplaceAllString(u.Path, "$1") - } -} - -func removeFragment(u *url.URL) { - u.Fragment = "" -} - -func forceHTTP(u *url.URL) { - if strings.ToLower(u.Scheme) == "https" { - u.Scheme = "http" - } -} - -func removeDuplicateSlashes(u *url.URL) { - if len(u.Path) > 0 { - u.Path = rxDupSlashes.ReplaceAllString(u.Path, "/") - } -} - -func removeWWW(u *url.URL) { - if len(u.Host) > 0 && strings.HasPrefix(strings.ToLower(u.Host), "www.") { - u.Host = u.Host[4:] - } -} - -func addWWW(u *url.URL) { - if len(u.Host) > 0 && !strings.HasPrefix(strings.ToLower(u.Host), "www.") { - u.Host = "www." + u.Host - } -} - -func sortQuery(u *url.URL) { - q := u.Query() - - if len(q) > 0 { - arKeys := make([]string, len(q)) - i := 0 - for k, _ := range q { - arKeys[i] = k - i++ - } - sort.Strings(arKeys) - buf := new(bytes.Buffer) - for _, k := range arKeys { - sort.Strings(q[k]) - for _, v := range q[k] { - if buf.Len() > 0 { - buf.WriteRune('&') - } - buf.WriteString(fmt.Sprintf("%s=%s", k, urlesc.QueryEscape(v))) - } - } - - // Rebuild the raw query string - u.RawQuery = buf.String() - } -} - -func decodeDWORDHost(u *url.URL) { - if len(u.Host) > 0 { - if matches := rxDWORDHost.FindStringSubmatch(u.Host); len(matches) > 2 { - var parts [4]int64 - - dword, _ := strconv.ParseInt(matches[1], 10, 0) - for i, shift := range []uint{24, 16, 8, 0} { - parts[i] = dword >> shift & 0xFF - } - u.Host = fmt.Sprintf("%d.%d.%d.%d%s", parts[0], parts[1], parts[2], parts[3], matches[2]) - } - } -} - -func decodeOctalHost(u *url.URL) { - if len(u.Host) > 0 { - if matches := rxOctalHost.FindStringSubmatch(u.Host); len(matches) > 5 { - var parts [4]int64 - - for i := 1; i <= 4; i++ { - parts[i-1], _ = strconv.ParseInt(matches[i], 8, 0) - } - u.Host = fmt.Sprintf("%d.%d.%d.%d%s", parts[0], parts[1], parts[2], parts[3], matches[5]) - } - } -} - -func decodeHexHost(u *url.URL) { - if len(u.Host) > 0 { - if matches := rxHexHost.FindStringSubmatch(u.Host); len(matches) > 2 { - // Conversion is safe because of regex validation - parsed, _ := strconv.ParseInt(matches[1], 16, 0) - // Set host as DWORD (base 10) encoded host - u.Host = fmt.Sprintf("%d%s", parsed, matches[2]) - // The rest is the same as decoding a DWORD host - decodeDWORDHost(u) - } - } -} - -func removeUnncessaryHostDots(u *url.URL) { - if len(u.Host) > 0 { - if matches := rxHostDots.FindStringSubmatch(u.Host); len(matches) > 1 { - // Trim the leading and trailing dots - u.Host = strings.Trim(matches[1], ".") - if len(matches) > 2 { - u.Host += matches[2] - } - } - } -} - -func removeEmptyPortSeparator(u *url.URL) { - if len(u.Host) > 0 { - u.Host = rxEmptyPort.ReplaceAllString(u.Host, "") - } -} diff --git a/vendor/github.com/PuerkitoBio/urlesc/.travis.yml b/vendor/github.com/PuerkitoBio/urlesc/.travis.yml deleted file mode 100644 index 478630e5..00000000 --- a/vendor/github.com/PuerkitoBio/urlesc/.travis.yml +++ /dev/null @@ -1,11 +0,0 @@ -language: go - -go: - - 1.4 - - tip - -install: - - go build . - -script: - - go test -v diff --git a/vendor/github.com/PuerkitoBio/urlesc/LICENSE b/vendor/github.com/PuerkitoBio/urlesc/LICENSE deleted file mode 100644 index 74487567..00000000 --- a/vendor/github.com/PuerkitoBio/urlesc/LICENSE +++ /dev/null @@ -1,27 +0,0 @@ -Copyright (c) 2012 The Go Authors. All rights reserved. - -Redistribution and use in source and binary forms, with or without -modification, are permitted provided that the following conditions are -met: - - * Redistributions of source code must retain the above copyright -notice, this list of conditions and the following disclaimer. - * Redistributions in binary form must reproduce the above -copyright notice, this list of conditions and the following disclaimer -in the documentation and/or other materials provided with the -distribution. - * Neither the name of Google Inc. nor the names of its -contributors may be used to endorse or promote products derived from -this software without specific prior written permission. - -THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS -"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT -LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR -A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT -OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, -SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT -LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, -DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY -THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT -(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE -OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/PuerkitoBio/urlesc/README.md b/vendor/github.com/PuerkitoBio/urlesc/README.md deleted file mode 100644 index bebe305e..00000000 --- a/vendor/github.com/PuerkitoBio/urlesc/README.md +++ /dev/null @@ -1,16 +0,0 @@ -urlesc [![Build Status](https://travis-ci.org/PuerkitoBio/urlesc.png?branch=master)](https://travis-ci.org/PuerkitoBio/urlesc) [![GoDoc](http://godoc.org/github.com/PuerkitoBio/urlesc?status.svg)](http://godoc.org/github.com/PuerkitoBio/urlesc) -====== - -Package urlesc implements query escaping as per RFC 3986. - -It contains some parts of the net/url package, modified so as to allow -some reserved characters incorrectly escaped by net/url (see [issue 5684](https://github.com/golang/go/issues/5684)). - -## Install - - go get github.com/PuerkitoBio/urlesc - -## License - -Go license (BSD-3-Clause) - diff --git a/vendor/github.com/PuerkitoBio/urlesc/urlesc.go b/vendor/github.com/PuerkitoBio/urlesc/urlesc.go deleted file mode 100644 index 1b846245..00000000 --- a/vendor/github.com/PuerkitoBio/urlesc/urlesc.go +++ /dev/null @@ -1,180 +0,0 @@ -// Copyright 2009 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package urlesc implements query escaping as per RFC 3986. -// It contains some parts of the net/url package, modified so as to allow -// some reserved characters incorrectly escaped by net/url. -// See https://github.com/golang/go/issues/5684 -package urlesc - -import ( - "bytes" - "net/url" - "strings" -) - -type encoding int - -const ( - encodePath encoding = 1 + iota - encodeUserPassword - encodeQueryComponent - encodeFragment -) - -// Return true if the specified character should be escaped when -// appearing in a URL string, according to RFC 3986. -func shouldEscape(c byte, mode encoding) bool { - // §2.3 Unreserved characters (alphanum) - if 'A' <= c && c <= 'Z' || 'a' <= c && c <= 'z' || '0' <= c && c <= '9' { - return false - } - - switch c { - case '-', '.', '_', '~': // §2.3 Unreserved characters (mark) - return false - - // §2.2 Reserved characters (reserved) - case ':', '/', '?', '#', '[', ']', '@', // gen-delims - '!', '$', '&', '\'', '(', ')', '*', '+', ',', ';', '=': // sub-delims - // Different sections of the URL allow a few of - // the reserved characters to appear unescaped. - switch mode { - case encodePath: // §3.3 - // The RFC allows sub-delims and : @. - // '/', '[' and ']' can be used to assign meaning to individual path - // segments. This package only manipulates the path as a whole, - // so we allow those as well. That leaves only ? and # to escape. - return c == '?' || c == '#' - - case encodeUserPassword: // §3.2.1 - // The RFC allows : and sub-delims in - // userinfo. The parsing of userinfo treats ':' as special so we must escape - // all the gen-delims. - return c == ':' || c == '/' || c == '?' || c == '#' || c == '[' || c == ']' || c == '@' - - case encodeQueryComponent: // §3.4 - // The RFC allows / and ?. - return c != '/' && c != '?' - - case encodeFragment: // §4.1 - // The RFC text is silent but the grammar allows - // everything, so escape nothing but # - return c == '#' - } - } - - // Everything else must be escaped. - return true -} - -// QueryEscape escapes the string so it can be safely placed -// inside a URL query. -func QueryEscape(s string) string { - return escape(s, encodeQueryComponent) -} - -func escape(s string, mode encoding) string { - spaceCount, hexCount := 0, 0 - for i := 0; i < len(s); i++ { - c := s[i] - if shouldEscape(c, mode) { - if c == ' ' && mode == encodeQueryComponent { - spaceCount++ - } else { - hexCount++ - } - } - } - - if spaceCount == 0 && hexCount == 0 { - return s - } - - t := make([]byte, len(s)+2*hexCount) - j := 0 - for i := 0; i < len(s); i++ { - switch c := s[i]; { - case c == ' ' && mode == encodeQueryComponent: - t[j] = '+' - j++ - case shouldEscape(c, mode): - t[j] = '%' - t[j+1] = "0123456789ABCDEF"[c>>4] - t[j+2] = "0123456789ABCDEF"[c&15] - j += 3 - default: - t[j] = s[i] - j++ - } - } - return string(t) -} - -var uiReplacer = strings.NewReplacer( - "%21", "!", - "%27", "'", - "%28", "(", - "%29", ")", - "%2A", "*", -) - -// unescapeUserinfo unescapes some characters that need not to be escaped as per RFC3986. -func unescapeUserinfo(s string) string { - return uiReplacer.Replace(s) -} - -// Escape reassembles the URL into a valid URL string. -// The general form of the result is one of: -// -// scheme:opaque -// scheme://userinfo@host/path?query#fragment -// -// If u.Opaque is non-empty, String uses the first form; -// otherwise it uses the second form. -// -// In the second form, the following rules apply: -// - if u.Scheme is empty, scheme: is omitted. -// - if u.User is nil, userinfo@ is omitted. -// - if u.Host is empty, host/ is omitted. -// - if u.Scheme and u.Host are empty and u.User is nil, -// the entire scheme://userinfo@host/ is omitted. -// - if u.Host is non-empty and u.Path begins with a /, -// the form host/path does not add its own /. -// - if u.RawQuery is empty, ?query is omitted. -// - if u.Fragment is empty, #fragment is omitted. -func Escape(u *url.URL) string { - var buf bytes.Buffer - if u.Scheme != "" { - buf.WriteString(u.Scheme) - buf.WriteByte(':') - } - if u.Opaque != "" { - buf.WriteString(u.Opaque) - } else { - if u.Scheme != "" || u.Host != "" || u.User != nil { - buf.WriteString("//") - if ui := u.User; ui != nil { - buf.WriteString(unescapeUserinfo(ui.String())) - buf.WriteByte('@') - } - if h := u.Host; h != "" { - buf.WriteString(h) - } - } - if u.Path != "" && u.Path[0] != '/' && u.Host != "" { - buf.WriteByte('/') - } - buf.WriteString(escape(u.Path, encodePath)) - } - if u.RawQuery != "" { - buf.WriteByte('?') - buf.WriteString(u.RawQuery) - } - if u.Fragment != "" { - buf.WriteByte('#') - buf.WriteString(escape(u.Fragment, encodeFragment)) - } - return buf.String() -} diff --git a/vendor/github.com/emicklei/go-restful/.gitignore b/vendor/github.com/emicklei/go-restful/.gitignore deleted file mode 100644 index cece7be6..00000000 --- a/vendor/github.com/emicklei/go-restful/.gitignore +++ /dev/null @@ -1,70 +0,0 @@ -# Compiled Object files, Static and Dynamic libs (Shared Objects) -*.o -*.a -*.so - -# Folders -_obj -_test - -# Architecture specific extensions/prefixes -*.[568vq] -[568vq].out - -*.cgo1.go -*.cgo2.c -_cgo_defun.c -_cgo_gotypes.go -_cgo_export.* - -_testmain.go - -*.exe - -restful.html - -*.out - -tmp.prof - -go-restful.test - -examples/restful-basic-authentication - -examples/restful-encoding-filter - -examples/restful-filters - -examples/restful-hello-world - -examples/restful-resource-functions - -examples/restful-serve-static - -examples/restful-user-service - -*.DS_Store -examples/restful-user-resource - -examples/restful-multi-containers - -examples/restful-form-handling - -examples/restful-CORS-filter - -examples/restful-options-filter - -examples/restful-curly-router - -examples/restful-cpuprofiler-service - -examples/restful-pre-post-filters - -curly.prof - -examples/restful-NCSA-logging - -examples/restful-html-template - -s.html -restful-path-tail diff --git a/vendor/github.com/emicklei/go-restful/.travis.yml b/vendor/github.com/emicklei/go-restful/.travis.yml deleted file mode 100644 index b22f8f54..00000000 --- a/vendor/github.com/emicklei/go-restful/.travis.yml +++ /dev/null @@ -1,6 +0,0 @@ -language: go - -go: - - 1.x - -script: go test -v \ No newline at end of file diff --git a/vendor/github.com/emicklei/go-restful/CHANGES.md b/vendor/github.com/emicklei/go-restful/CHANGES.md deleted file mode 100644 index 0adca766..00000000 --- a/vendor/github.com/emicklei/go-restful/CHANGES.md +++ /dev/null @@ -1,223 +0,0 @@ -Change history of go-restful -= -2017-02-16 -- solved issue #304, make operation names unique - -2017-01-30 - - [IMPORTANT] For swagger users, change your import statement to: - swagger "github.com/emicklei/go-restful-swagger12" - -- moved swagger 1.2 code to go-restful-swagger12 -- created TAG 2.0.0 - -2017-01-27 - -- remove defer request body close -- expose Dispatch for testing filters and Routefunctions -- swagger response model cannot be array -- created TAG 1.0.0 - -2016-12-22 - -- (API change) Remove code related to caching request content. Removes SetCacheReadEntity(doCache bool) - -2016-11-26 - -- Default change! now use CurlyRouter (was RouterJSR311) -- Default change! no more caching of request content -- Default change! do not recover from panics - -2016-09-22 - -- fix the DefaultRequestContentType feature - -2016-02-14 - -- take the qualify factor of the Accept header mediatype into account when deciding the contentype of the response -- add constructors for custom entity accessors for xml and json - -2015-09-27 - -- rename new WriteStatusAnd... to WriteHeaderAnd... for consistency - -2015-09-25 - -- fixed problem with changing Header after WriteHeader (issue 235) - -2015-09-14 - -- changed behavior of WriteHeader (immediate write) and WriteEntity (no status write) -- added support for custom EntityReaderWriters. - -2015-08-06 - -- add support for reading entities from compressed request content -- use sync.Pool for compressors of http response and request body -- add Description to Parameter for documentation in Swagger UI - -2015-03-20 - -- add configurable logging - -2015-03-18 - -- if not specified, the Operation is derived from the Route function - -2015-03-17 - -- expose Parameter creation functions -- make trace logger an interface -- fix OPTIONSFilter -- customize rendering of ServiceError -- JSR311 router now handles wildcards -- add Notes to Route - -2014-11-27 - -- (api add) PrettyPrint per response. (as proposed in #167) - -2014-11-12 - -- (api add) ApiVersion(.) for documentation in Swagger UI - -2014-11-10 - -- (api change) struct fields tagged with "description" show up in Swagger UI - -2014-10-31 - -- (api change) ReturnsError -> Returns -- (api add) RouteBuilder.Do(aBuilder) for DRY use of RouteBuilder -- fix swagger nested structs -- sort Swagger response messages by code - -2014-10-23 - -- (api add) ReturnsError allows you to document Http codes in swagger -- fixed problem with greedy CurlyRouter -- (api add) Access-Control-Max-Age in CORS -- add tracing functionality (injectable) for debugging purposes -- support JSON parse 64bit int -- fix empty parameters for swagger -- WebServicesUrl is now optional for swagger -- fixed duplicate AccessControlAllowOrigin in CORS -- (api change) expose ServeMux in container -- (api add) added AllowedDomains in CORS -- (api add) ParameterNamed for detailed documentation - -2014-04-16 - -- (api add) expose constructor of Request for testing. - -2014-06-27 - -- (api add) ParameterNamed gives access to a Parameter definition and its data (for further specification). -- (api add) SetCacheReadEntity allow scontrol over whether or not the request body is being cached (default true for compatibility reasons). - -2014-07-03 - -- (api add) CORS can be configured with a list of allowed domains - -2014-03-12 - -- (api add) Route path parameters can use wildcard or regular expressions. (requires CurlyRouter) - -2014-02-26 - -- (api add) Request now provides information about the matched Route, see method SelectedRoutePath - -2014-02-17 - -- (api change) renamed parameter constants (go-lint checks) - -2014-01-10 - -- (api add) support for CloseNotify, see http://golang.org/pkg/net/http/#CloseNotifier - -2014-01-07 - -- (api change) Write* methods in Response now return the error or nil. -- added example of serving HTML from a Go template. -- fixed comparing Allowed headers in CORS (is now case-insensitive) - -2013-11-13 - -- (api add) Response knows how many bytes are written to the response body. - -2013-10-29 - -- (api add) RecoverHandler(handler RecoverHandleFunction) to change how panic recovery is handled. Default behavior is to log and return a stacktrace. This may be a security issue as it exposes sourcecode information. - -2013-10-04 - -- (api add) Response knows what HTTP status has been written -- (api add) Request can have attributes (map of string->interface, also called request-scoped variables - -2013-09-12 - -- (api change) Router interface simplified -- Implemented CurlyRouter, a Router that does not use|allow regular expressions in paths - -2013-08-05 - - add OPTIONS support - - add CORS support - -2013-08-27 - -- fixed some reported issues (see github) -- (api change) deprecated use of WriteError; use WriteErrorString instead - -2014-04-15 - -- (fix) v1.0.1 tag: fix Issue 111: WriteErrorString - -2013-08-08 - -- (api add) Added implementation Container: a WebServices collection with its own http.ServeMux allowing multiple endpoints per program. Existing uses of go-restful will register their services to the DefaultContainer. -- (api add) the swagger package has be extended to have a UI per container. -- if panic is detected then a small stack trace is printed (thanks to runner-mei) -- (api add) WriteErrorString to Response - -Important API changes: - -- (api remove) package variable DoNotRecover no longer works ; use restful.DefaultContainer.DoNotRecover(true) instead. -- (api remove) package variable EnableContentEncoding no longer works ; use restful.DefaultContainer.EnableContentEncoding(true) instead. - - -2013-07-06 - -- (api add) Added support for response encoding (gzip and deflate(zlib)). This feature is disabled on default (for backwards compatibility). Use restful.EnableContentEncoding = true in your initialization to enable this feature. - -2013-06-19 - -- (improve) DoNotRecover option, moved request body closer, improved ReadEntity - -2013-06-03 - -- (api change) removed Dispatcher interface, hide PathExpression -- changed receiver names of type functions to be more idiomatic Go - -2013-06-02 - -- (optimize) Cache the RegExp compilation of Paths. - -2013-05-22 - -- (api add) Added support for request/response filter functions - -2013-05-18 - - -- (api add) Added feature to change the default Http Request Dispatch function (travis cline) -- (api change) Moved Swagger Webservice to swagger package (see example restful-user) - -[2012-11-14 .. 2013-05-18> - -- See https://github.com/emicklei/go-restful/commits - -2012-11-14 - -- Initial commit - - diff --git a/vendor/github.com/emicklei/go-restful/LICENSE b/vendor/github.com/emicklei/go-restful/LICENSE deleted file mode 100644 index ece7ec61..00000000 --- a/vendor/github.com/emicklei/go-restful/LICENSE +++ /dev/null @@ -1,22 +0,0 @@ -Copyright (c) 2012,2013 Ernest Micklei - -MIT License - -Permission is hereby granted, free of charge, to any person obtaining -a copy of this software and associated documentation files (the -"Software"), to deal in the Software without restriction, including -without limitation the rights to use, copy, modify, merge, publish, -distribute, sublicense, and/or sell copies of the Software, and to -permit persons to whom the Software is furnished to do so, subject to -the following conditions: - -The above copyright notice and this permission notice shall be -included in all copies or substantial portions of the Software. - -THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, -EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF -MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND -NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE -LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION -OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION -WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. \ No newline at end of file diff --git a/vendor/github.com/emicklei/go-restful/Makefile b/vendor/github.com/emicklei/go-restful/Makefile deleted file mode 100644 index b40081cc..00000000 --- a/vendor/github.com/emicklei/go-restful/Makefile +++ /dev/null @@ -1,7 +0,0 @@ -all: test - -test: - go test -v . - -ex: - cd examples && ls *.go | xargs go build -o /tmp/ignore \ No newline at end of file diff --git a/vendor/github.com/emicklei/go-restful/README.md b/vendor/github.com/emicklei/go-restful/README.md deleted file mode 100644 index cd1f2d0c..00000000 --- a/vendor/github.com/emicklei/go-restful/README.md +++ /dev/null @@ -1,74 +0,0 @@ -go-restful -========== -package for building REST-style Web Services using Google Go - -[![Build Status](https://travis-ci.org/emicklei/go-restful.png)](https://travis-ci.org/emicklei/go-restful) -[![Go Report Card](https://goreportcard.com/badge/github.com/emicklei/go-restful)](https://goreportcard.com/report/github.com/emicklei/go-restful) -[![GoDoc](https://godoc.org/github.com/emicklei/go-restful?status.svg)](https://godoc.org/github.com/emicklei/go-restful) - -- [Code examples](https://github.com/emicklei/go-restful/tree/master/examples) - -REST asks developers to use HTTP methods explicitly and in a way that's consistent with the protocol definition. This basic REST design principle establishes a one-to-one mapping between create, read, update, and delete (CRUD) operations and HTTP methods. According to this mapping: - -- GET = Retrieve a representation of a resource -- POST = Create if you are sending content to the server to create a subordinate of the specified resource collection, using some server-side algorithm. -- PUT = Create if you are sending the full content of the specified resource (URI). -- PUT = Update if you are updating the full content of the specified resource. -- DELETE = Delete if you are requesting the server to delete the resource -- PATCH = Update partial content of a resource -- OPTIONS = Get information about the communication options for the request URI - -### Example - -```Go -ws := new(restful.WebService) -ws. - Path("/users"). - Consumes(restful.MIME_XML, restful.MIME_JSON). - Produces(restful.MIME_JSON, restful.MIME_XML) - -ws.Route(ws.GET("/{user-id}").To(u.findUser). - Doc("get a user"). - Param(ws.PathParameter("user-id", "identifier of the user").DataType("string")). - Writes(User{})) -... - -func (u UserResource) findUser(request *restful.Request, response *restful.Response) { - id := request.PathParameter("user-id") - ... -} -``` - -[Full API of a UserResource](https://github.com/emicklei/go-restful/tree/master/examples/restful-user-resource.go) - -### Features - -- Routes for request → function mapping with path parameter (e.g. {id}) support -- Configurable router: - - (default) Fast routing algorithm that allows static elements, regular expressions and dynamic parameters in the URL path (e.g. /meetings/{id} or /static/{subpath:*} - - Routing algorithm after [JSR311](http://jsr311.java.net/nonav/releases/1.1/spec/spec.html) that is implemented using (but does **not** accept) regular expressions -- Request API for reading structs from JSON/XML and accesing parameters (path,query,header) -- Response API for writing structs to JSON/XML and setting headers -- Customizable encoding using EntityReaderWriter registration -- Filters for intercepting the request → response flow on Service or Route level -- Request-scoped variables using attributes -- Containers for WebServices on different HTTP endpoints -- Content encoding (gzip,deflate) of request and response payloads -- Automatic responses on OPTIONS (using a filter) -- Automatic CORS request handling (using a filter) -- API declaration for Swagger UI (see [go-restful-swagger12](https://github.com/emicklei/go-restful-swagger12),[go-restful-openapi](https://github.com/emicklei/go-restful-openapi)) -- Panic recovery to produce HTTP 500, customizable using RecoverHandler(...) -- Route errors produce HTTP 404/405/406/415 errors, customizable using ServiceErrorHandler(...) -- Configurable (trace) logging -- Customizable gzip/deflate readers and writers using CompressorProvider registration - -### Resources - -- [Example posted on blog](http://ernestmicklei.com/2012/11/go-restful-first-working-example/) -- [Design explained on blog](http://ernestmicklei.com/2012/11/go-restful-api-design/) -- [sourcegraph](https://sourcegraph.com/github.com/emicklei/go-restful) -- [showcase: Mora - MongoDB REST Api server](https://github.com/emicklei/mora) - -Type ```git shortlog -s``` for a full list of contributors. - -© 2012 - 2017, http://ernestmicklei.com. MIT License. Contributions are welcome. \ No newline at end of file diff --git a/vendor/github.com/emicklei/go-restful/Srcfile b/vendor/github.com/emicklei/go-restful/Srcfile deleted file mode 100644 index 16fd1868..00000000 --- a/vendor/github.com/emicklei/go-restful/Srcfile +++ /dev/null @@ -1 +0,0 @@ -{"SkipDirs": ["examples"]} diff --git a/vendor/github.com/emicklei/go-restful/bench_test.sh b/vendor/github.com/emicklei/go-restful/bench_test.sh deleted file mode 100644 index 47ffbe4a..00000000 --- a/vendor/github.com/emicklei/go-restful/bench_test.sh +++ /dev/null @@ -1,10 +0,0 @@ -#go test -run=none -file bench_test.go -test.bench . -cpuprofile=bench_test.out - -go test -c -./go-restful.test -test.run=none -test.cpuprofile=tmp.prof -test.bench=BenchmarkMany -./go-restful.test -test.run=none -test.cpuprofile=curly.prof -test.bench=BenchmarkManyCurly - -#go tool pprof go-restful.test tmp.prof -go tool pprof go-restful.test curly.prof - - diff --git a/vendor/github.com/emicklei/go-restful/compress.go b/vendor/github.com/emicklei/go-restful/compress.go deleted file mode 100644 index 220b3771..00000000 --- a/vendor/github.com/emicklei/go-restful/compress.go +++ /dev/null @@ -1,123 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "bufio" - "compress/gzip" - "compress/zlib" - "errors" - "io" - "net" - "net/http" - "strings" -) - -// OBSOLETE : use restful.DefaultContainer.EnableContentEncoding(true) to change this setting. -var EnableContentEncoding = false - -// CompressingResponseWriter is a http.ResponseWriter that can perform content encoding (gzip and zlib) -type CompressingResponseWriter struct { - writer http.ResponseWriter - compressor io.WriteCloser - encoding string -} - -// Header is part of http.ResponseWriter interface -func (c *CompressingResponseWriter) Header() http.Header { - return c.writer.Header() -} - -// WriteHeader is part of http.ResponseWriter interface -func (c *CompressingResponseWriter) WriteHeader(status int) { - c.writer.WriteHeader(status) -} - -// Write is part of http.ResponseWriter interface -// It is passed through the compressor -func (c *CompressingResponseWriter) Write(bytes []byte) (int, error) { - if c.isCompressorClosed() { - return -1, errors.New("Compressing error: tried to write data using closed compressor") - } - return c.compressor.Write(bytes) -} - -// CloseNotify is part of http.CloseNotifier interface -func (c *CompressingResponseWriter) CloseNotify() <-chan bool { - return c.writer.(http.CloseNotifier).CloseNotify() -} - -// Close the underlying compressor -func (c *CompressingResponseWriter) Close() error { - if c.isCompressorClosed() { - return errors.New("Compressing error: tried to close already closed compressor") - } - - c.compressor.Close() - if ENCODING_GZIP == c.encoding { - currentCompressorProvider.ReleaseGzipWriter(c.compressor.(*gzip.Writer)) - } - if ENCODING_DEFLATE == c.encoding { - currentCompressorProvider.ReleaseZlibWriter(c.compressor.(*zlib.Writer)) - } - // gc hint needed? - c.compressor = nil - return nil -} - -func (c *CompressingResponseWriter) isCompressorClosed() bool { - return nil == c.compressor -} - -// Hijack implements the Hijacker interface -// This is especially useful when combining Container.EnabledContentEncoding -// in combination with websockets (for instance gorilla/websocket) -func (c *CompressingResponseWriter) Hijack() (net.Conn, *bufio.ReadWriter, error) { - hijacker, ok := c.writer.(http.Hijacker) - if !ok { - return nil, nil, errors.New("ResponseWriter doesn't support Hijacker interface") - } - return hijacker.Hijack() -} - -// WantsCompressedResponse reads the Accept-Encoding header to see if and which encoding is requested. -func wantsCompressedResponse(httpRequest *http.Request) (bool, string) { - header := httpRequest.Header.Get(HEADER_AcceptEncoding) - gi := strings.Index(header, ENCODING_GZIP) - zi := strings.Index(header, ENCODING_DEFLATE) - // use in order of appearance - if gi == -1 { - return zi != -1, ENCODING_DEFLATE - } else if zi == -1 { - return gi != -1, ENCODING_GZIP - } else { - if gi < zi { - return true, ENCODING_GZIP - } - return true, ENCODING_DEFLATE - } -} - -// NewCompressingResponseWriter create a CompressingResponseWriter for a known encoding = {gzip,deflate} -func NewCompressingResponseWriter(httpWriter http.ResponseWriter, encoding string) (*CompressingResponseWriter, error) { - httpWriter.Header().Set(HEADER_ContentEncoding, encoding) - c := new(CompressingResponseWriter) - c.writer = httpWriter - var err error - if ENCODING_GZIP == encoding { - w := currentCompressorProvider.AcquireGzipWriter() - w.Reset(httpWriter) - c.compressor = w - c.encoding = ENCODING_GZIP - } else if ENCODING_DEFLATE == encoding { - w := currentCompressorProvider.AcquireZlibWriter() - w.Reset(httpWriter) - c.compressor = w - c.encoding = ENCODING_DEFLATE - } else { - return nil, errors.New("Unknown encoding:" + encoding) - } - return c, err -} diff --git a/vendor/github.com/emicklei/go-restful/compressor_cache.go b/vendor/github.com/emicklei/go-restful/compressor_cache.go deleted file mode 100644 index ee426010..00000000 --- a/vendor/github.com/emicklei/go-restful/compressor_cache.go +++ /dev/null @@ -1,103 +0,0 @@ -package restful - -// Copyright 2015 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "compress/gzip" - "compress/zlib" -) - -// BoundedCachedCompressors is a CompressorProvider that uses a cache with a fixed amount -// of writers and readers (resources). -// If a new resource is acquired and all are in use, it will return a new unmanaged resource. -type BoundedCachedCompressors struct { - gzipWriters chan *gzip.Writer - gzipReaders chan *gzip.Reader - zlibWriters chan *zlib.Writer - writersCapacity int - readersCapacity int -} - -// NewBoundedCachedCompressors returns a new, with filled cache, BoundedCachedCompressors. -func NewBoundedCachedCompressors(writersCapacity, readersCapacity int) *BoundedCachedCompressors { - b := &BoundedCachedCompressors{ - gzipWriters: make(chan *gzip.Writer, writersCapacity), - gzipReaders: make(chan *gzip.Reader, readersCapacity), - zlibWriters: make(chan *zlib.Writer, writersCapacity), - writersCapacity: writersCapacity, - readersCapacity: readersCapacity, - } - for ix := 0; ix < writersCapacity; ix++ { - b.gzipWriters <- newGzipWriter() - b.zlibWriters <- newZlibWriter() - } - for ix := 0; ix < readersCapacity; ix++ { - b.gzipReaders <- newGzipReader() - } - return b -} - -// AcquireGzipWriter returns an resettable *gzip.Writer. Needs to be released. -func (b *BoundedCachedCompressors) AcquireGzipWriter() *gzip.Writer { - var writer *gzip.Writer - select { - case writer, _ = <-b.gzipWriters: - default: - // return a new unmanaged one - writer = newGzipWriter() - } - return writer -} - -// ReleaseGzipWriter accepts a writer (does not have to be one that was cached) -// only when the cache has room for it. It will ignore it otherwise. -func (b *BoundedCachedCompressors) ReleaseGzipWriter(w *gzip.Writer) { - // forget the unmanaged ones - if len(b.gzipWriters) < b.writersCapacity { - b.gzipWriters <- w - } -} - -// AcquireGzipReader returns a *gzip.Reader. Needs to be released. -func (b *BoundedCachedCompressors) AcquireGzipReader() *gzip.Reader { - var reader *gzip.Reader - select { - case reader, _ = <-b.gzipReaders: - default: - // return a new unmanaged one - reader = newGzipReader() - } - return reader -} - -// ReleaseGzipReader accepts a reader (does not have to be one that was cached) -// only when the cache has room for it. It will ignore it otherwise. -func (b *BoundedCachedCompressors) ReleaseGzipReader(r *gzip.Reader) { - // forget the unmanaged ones - if len(b.gzipReaders) < b.readersCapacity { - b.gzipReaders <- r - } -} - -// AcquireZlibWriter returns an resettable *zlib.Writer. Needs to be released. -func (b *BoundedCachedCompressors) AcquireZlibWriter() *zlib.Writer { - var writer *zlib.Writer - select { - case writer, _ = <-b.zlibWriters: - default: - // return a new unmanaged one - writer = newZlibWriter() - } - return writer -} - -// ReleaseZlibWriter accepts a writer (does not have to be one that was cached) -// only when the cache has room for it. It will ignore it otherwise. -func (b *BoundedCachedCompressors) ReleaseZlibWriter(w *zlib.Writer) { - // forget the unmanaged ones - if len(b.zlibWriters) < b.writersCapacity { - b.zlibWriters <- w - } -} diff --git a/vendor/github.com/emicklei/go-restful/compressor_pools.go b/vendor/github.com/emicklei/go-restful/compressor_pools.go deleted file mode 100644 index d866ce64..00000000 --- a/vendor/github.com/emicklei/go-restful/compressor_pools.go +++ /dev/null @@ -1,91 +0,0 @@ -package restful - -// Copyright 2015 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "bytes" - "compress/gzip" - "compress/zlib" - "sync" -) - -// SyncPoolCompessors is a CompressorProvider that use the standard sync.Pool. -type SyncPoolCompessors struct { - GzipWriterPool *sync.Pool - GzipReaderPool *sync.Pool - ZlibWriterPool *sync.Pool -} - -// NewSyncPoolCompessors returns a new ("empty") SyncPoolCompessors. -func NewSyncPoolCompessors() *SyncPoolCompessors { - return &SyncPoolCompessors{ - GzipWriterPool: &sync.Pool{ - New: func() interface{} { return newGzipWriter() }, - }, - GzipReaderPool: &sync.Pool{ - New: func() interface{} { return newGzipReader() }, - }, - ZlibWriterPool: &sync.Pool{ - New: func() interface{} { return newZlibWriter() }, - }, - } -} - -func (s *SyncPoolCompessors) AcquireGzipWriter() *gzip.Writer { - return s.GzipWriterPool.Get().(*gzip.Writer) -} - -func (s *SyncPoolCompessors) ReleaseGzipWriter(w *gzip.Writer) { - s.GzipWriterPool.Put(w) -} - -func (s *SyncPoolCompessors) AcquireGzipReader() *gzip.Reader { - return s.GzipReaderPool.Get().(*gzip.Reader) -} - -func (s *SyncPoolCompessors) ReleaseGzipReader(r *gzip.Reader) { - s.GzipReaderPool.Put(r) -} - -func (s *SyncPoolCompessors) AcquireZlibWriter() *zlib.Writer { - return s.ZlibWriterPool.Get().(*zlib.Writer) -} - -func (s *SyncPoolCompessors) ReleaseZlibWriter(w *zlib.Writer) { - s.ZlibWriterPool.Put(w) -} - -func newGzipWriter() *gzip.Writer { - // create with an empty bytes writer; it will be replaced before using the gzipWriter - writer, err := gzip.NewWriterLevel(new(bytes.Buffer), gzip.BestSpeed) - if err != nil { - panic(err.Error()) - } - return writer -} - -func newGzipReader() *gzip.Reader { - // create with an empty reader (but with GZIP header); it will be replaced before using the gzipReader - // we can safely use currentCompressProvider because it is set on package initialization. - w := currentCompressorProvider.AcquireGzipWriter() - defer currentCompressorProvider.ReleaseGzipWriter(w) - b := new(bytes.Buffer) - w.Reset(b) - w.Flush() - w.Close() - reader, err := gzip.NewReader(bytes.NewReader(b.Bytes())) - if err != nil { - panic(err.Error()) - } - return reader -} - -func newZlibWriter() *zlib.Writer { - writer, err := zlib.NewWriterLevel(new(bytes.Buffer), gzip.BestSpeed) - if err != nil { - panic(err.Error()) - } - return writer -} diff --git a/vendor/github.com/emicklei/go-restful/compressors.go b/vendor/github.com/emicklei/go-restful/compressors.go deleted file mode 100644 index cb32f7ef..00000000 --- a/vendor/github.com/emicklei/go-restful/compressors.go +++ /dev/null @@ -1,54 +0,0 @@ -package restful - -// Copyright 2015 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "compress/gzip" - "compress/zlib" -) - -// CompressorProvider describes a component that can provider compressors for the std methods. -type CompressorProvider interface { - // Returns a *gzip.Writer which needs to be released later. - // Before using it, call Reset(). - AcquireGzipWriter() *gzip.Writer - - // Releases an aqcuired *gzip.Writer. - ReleaseGzipWriter(w *gzip.Writer) - - // Returns a *gzip.Reader which needs to be released later. - AcquireGzipReader() *gzip.Reader - - // Releases an aqcuired *gzip.Reader. - ReleaseGzipReader(w *gzip.Reader) - - // Returns a *zlib.Writer which needs to be released later. - // Before using it, call Reset(). - AcquireZlibWriter() *zlib.Writer - - // Releases an aqcuired *zlib.Writer. - ReleaseZlibWriter(w *zlib.Writer) -} - -// DefaultCompressorProvider is the actual provider of compressors (zlib or gzip). -var currentCompressorProvider CompressorProvider - -func init() { - currentCompressorProvider = NewSyncPoolCompessors() -} - -// CurrentCompressorProvider returns the current CompressorProvider. -// It is initialized using a SyncPoolCompessors. -func CurrentCompressorProvider() CompressorProvider { - return currentCompressorProvider -} - -// CompressorProvider sets the actual provider of compressors (zlib or gzip). -func SetCompressorProvider(p CompressorProvider) { - if p == nil { - panic("cannot set compressor provider to nil") - } - currentCompressorProvider = p -} diff --git a/vendor/github.com/emicklei/go-restful/constants.go b/vendor/github.com/emicklei/go-restful/constants.go deleted file mode 100644 index 203439c5..00000000 --- a/vendor/github.com/emicklei/go-restful/constants.go +++ /dev/null @@ -1,30 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -const ( - MIME_XML = "application/xml" // Accept or Content-Type used in Consumes() and/or Produces() - MIME_JSON = "application/json" // Accept or Content-Type used in Consumes() and/or Produces() - MIME_OCTET = "application/octet-stream" // If Content-Type is not present in request, use the default - - HEADER_Allow = "Allow" - HEADER_Accept = "Accept" - HEADER_Origin = "Origin" - HEADER_ContentType = "Content-Type" - HEADER_LastModified = "Last-Modified" - HEADER_AcceptEncoding = "Accept-Encoding" - HEADER_ContentEncoding = "Content-Encoding" - HEADER_AccessControlExposeHeaders = "Access-Control-Expose-Headers" - HEADER_AccessControlRequestMethod = "Access-Control-Request-Method" - HEADER_AccessControlRequestHeaders = "Access-Control-Request-Headers" - HEADER_AccessControlAllowMethods = "Access-Control-Allow-Methods" - HEADER_AccessControlAllowOrigin = "Access-Control-Allow-Origin" - HEADER_AccessControlAllowCredentials = "Access-Control-Allow-Credentials" - HEADER_AccessControlAllowHeaders = "Access-Control-Allow-Headers" - HEADER_AccessControlMaxAge = "Access-Control-Max-Age" - - ENCODING_GZIP = "gzip" - ENCODING_DEFLATE = "deflate" -) diff --git a/vendor/github.com/emicklei/go-restful/container.go b/vendor/github.com/emicklei/go-restful/container.go deleted file mode 100644 index 657d5b6d..00000000 --- a/vendor/github.com/emicklei/go-restful/container.go +++ /dev/null @@ -1,366 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "bytes" - "errors" - "fmt" - "net/http" - "os" - "runtime" - "strings" - "sync" - - "github.com/emicklei/go-restful/log" -) - -// Container holds a collection of WebServices and a http.ServeMux to dispatch http requests. -// The requests are further dispatched to routes of WebServices using a RouteSelector -type Container struct { - webServicesLock sync.RWMutex - webServices []*WebService - ServeMux *http.ServeMux - isRegisteredOnRoot bool - containerFilters []FilterFunction - doNotRecover bool // default is true - recoverHandleFunc RecoverHandleFunction - serviceErrorHandleFunc ServiceErrorHandleFunction - router RouteSelector // default is a CurlyRouter (RouterJSR311 is a slower alternative) - contentEncodingEnabled bool // default is false -} - -// NewContainer creates a new Container using a new ServeMux and default router (CurlyRouter) -func NewContainer() *Container { - return &Container{ - webServices: []*WebService{}, - ServeMux: http.NewServeMux(), - isRegisteredOnRoot: false, - containerFilters: []FilterFunction{}, - doNotRecover: true, - recoverHandleFunc: logStackOnRecover, - serviceErrorHandleFunc: writeServiceError, - router: CurlyRouter{}, - contentEncodingEnabled: false} -} - -// RecoverHandleFunction declares functions that can be used to handle a panic situation. -// The first argument is what recover() returns. The second must be used to communicate an error response. -type RecoverHandleFunction func(interface{}, http.ResponseWriter) - -// RecoverHandler changes the default function (logStackOnRecover) to be called -// when a panic is detected. DoNotRecover must be have its default value (=false). -func (c *Container) RecoverHandler(handler RecoverHandleFunction) { - c.recoverHandleFunc = handler -} - -// ServiceErrorHandleFunction declares functions that can be used to handle a service error situation. -// The first argument is the service error, the second is the request that resulted in the error and -// the third must be used to communicate an error response. -type ServiceErrorHandleFunction func(ServiceError, *Request, *Response) - -// ServiceErrorHandler changes the default function (writeServiceError) to be called -// when a ServiceError is detected. -func (c *Container) ServiceErrorHandler(handler ServiceErrorHandleFunction) { - c.serviceErrorHandleFunc = handler -} - -// DoNotRecover controls whether panics will be caught to return HTTP 500. -// If set to true, Route functions are responsible for handling any error situation. -// Default value is true. -func (c *Container) DoNotRecover(doNot bool) { - c.doNotRecover = doNot -} - -// Router changes the default Router (currently CurlyRouter) -func (c *Container) Router(aRouter RouteSelector) { - c.router = aRouter -} - -// EnableContentEncoding (default=false) allows for GZIP or DEFLATE encoding of responses. -func (c *Container) EnableContentEncoding(enabled bool) { - c.contentEncodingEnabled = enabled -} - -// Add a WebService to the Container. It will detect duplicate root paths and exit in that case. -func (c *Container) Add(service *WebService) *Container { - c.webServicesLock.Lock() - defer c.webServicesLock.Unlock() - - // if rootPath was not set then lazy initialize it - if len(service.rootPath) == 0 { - service.Path("/") - } - - // cannot have duplicate root paths - for _, each := range c.webServices { - if each.RootPath() == service.RootPath() { - log.Printf("[restful] WebService with duplicate root path detected:['%v']", each) - os.Exit(1) - } - } - - // If not registered on root then add specific mapping - if !c.isRegisteredOnRoot { - c.isRegisteredOnRoot = c.addHandler(service, c.ServeMux) - } - c.webServices = append(c.webServices, service) - return c -} - -// addHandler may set a new HandleFunc for the serveMux -// this function must run inside the critical region protected by the webServicesLock. -// returns true if the function was registered on root ("/") -func (c *Container) addHandler(service *WebService, serveMux *http.ServeMux) bool { - pattern := fixedPrefixPath(service.RootPath()) - // check if root path registration is needed - if "/" == pattern || "" == pattern { - serveMux.HandleFunc("/", c.dispatch) - return true - } - // detect if registration already exists - alreadyMapped := false - for _, each := range c.webServices { - if each.RootPath() == service.RootPath() { - alreadyMapped = true - break - } - } - if !alreadyMapped { - serveMux.HandleFunc(pattern, c.dispatch) - if !strings.HasSuffix(pattern, "/") { - serveMux.HandleFunc(pattern+"/", c.dispatch) - } - } - return false -} - -func (c *Container) Remove(ws *WebService) error { - if c.ServeMux == http.DefaultServeMux { - errMsg := fmt.Sprintf("[restful] cannot remove a WebService from a Container using the DefaultServeMux: ['%v']", ws) - log.Printf(errMsg) - return errors.New(errMsg) - } - c.webServicesLock.Lock() - defer c.webServicesLock.Unlock() - // build a new ServeMux and re-register all WebServices - newServeMux := http.NewServeMux() - newServices := []*WebService{} - newIsRegisteredOnRoot := false - for _, each := range c.webServices { - if each.rootPath != ws.rootPath { - // If not registered on root then add specific mapping - if !newIsRegisteredOnRoot { - newIsRegisteredOnRoot = c.addHandler(each, newServeMux) - } - newServices = append(newServices, each) - } - } - c.webServices, c.ServeMux, c.isRegisteredOnRoot = newServices, newServeMux, newIsRegisteredOnRoot - return nil -} - -// logStackOnRecover is the default RecoverHandleFunction and is called -// when DoNotRecover is false and the recoverHandleFunc is not set for the container. -// Default implementation logs the stacktrace and writes the stacktrace on the response. -// This may be a security issue as it exposes sourcecode information. -func logStackOnRecover(panicReason interface{}, httpWriter http.ResponseWriter) { - var buffer bytes.Buffer - buffer.WriteString(fmt.Sprintf("[restful] recover from panic situation: - %v\r\n", panicReason)) - for i := 2; ; i += 1 { - _, file, line, ok := runtime.Caller(i) - if !ok { - break - } - buffer.WriteString(fmt.Sprintf(" %s:%d\r\n", file, line)) - } - log.Print(buffer.String()) - httpWriter.WriteHeader(http.StatusInternalServerError) - httpWriter.Write(buffer.Bytes()) -} - -// writeServiceError is the default ServiceErrorHandleFunction and is called -// when a ServiceError is returned during route selection. Default implementation -// calls resp.WriteErrorString(err.Code, err.Message) -func writeServiceError(err ServiceError, req *Request, resp *Response) { - resp.WriteErrorString(err.Code, err.Message) -} - -// Dispatch the incoming Http Request to a matching WebService. -func (c *Container) Dispatch(httpWriter http.ResponseWriter, httpRequest *http.Request) { - if httpWriter == nil { - panic("httpWriter cannot be nil") - } - if httpRequest == nil { - panic("httpRequest cannot be nil") - } - c.dispatch(httpWriter, httpRequest) -} - -// Dispatch the incoming Http Request to a matching WebService. -func (c *Container) dispatch(httpWriter http.ResponseWriter, httpRequest *http.Request) { - writer := httpWriter - - // CompressingResponseWriter should be closed after all operations are done - defer func() { - if compressWriter, ok := writer.(*CompressingResponseWriter); ok { - compressWriter.Close() - } - }() - - // Instal panic recovery unless told otherwise - if !c.doNotRecover { // catch all for 500 response - defer func() { - if r := recover(); r != nil { - c.recoverHandleFunc(r, writer) - return - } - }() - } - - // Detect if compression is needed - // assume without compression, test for override - if c.contentEncodingEnabled { - doCompress, encoding := wantsCompressedResponse(httpRequest) - if doCompress { - var err error - writer, err = NewCompressingResponseWriter(httpWriter, encoding) - if err != nil { - log.Print("[restful] unable to install compressor: ", err) - httpWriter.WriteHeader(http.StatusInternalServerError) - return - } - } - } - // Find best match Route ; err is non nil if no match was found - var webService *WebService - var route *Route - var err error - func() { - c.webServicesLock.RLock() - defer c.webServicesLock.RUnlock() - webService, route, err = c.router.SelectRoute( - c.webServices, - httpRequest) - }() - if err != nil { - // a non-200 response has already been written - // run container filters anyway ; they should not touch the response... - chain := FilterChain{Filters: c.containerFilters, Target: func(req *Request, resp *Response) { - switch err.(type) { - case ServiceError: - ser := err.(ServiceError) - c.serviceErrorHandleFunc(ser, req, resp) - } - // TODO - }} - chain.ProcessFilter(NewRequest(httpRequest), NewResponse(writer)) - return - } - wrappedRequest, wrappedResponse := route.wrapRequestResponse(writer, httpRequest) - // pass through filters (if any) - if len(c.containerFilters)+len(webService.filters)+len(route.Filters) > 0 { - // compose filter chain - allFilters := []FilterFunction{} - allFilters = append(allFilters, c.containerFilters...) - allFilters = append(allFilters, webService.filters...) - allFilters = append(allFilters, route.Filters...) - chain := FilterChain{Filters: allFilters, Target: func(req *Request, resp *Response) { - // handle request by route after passing all filters - route.Function(wrappedRequest, wrappedResponse) - }} - chain.ProcessFilter(wrappedRequest, wrappedResponse) - } else { - // no filters, handle request by route - route.Function(wrappedRequest, wrappedResponse) - } -} - -// fixedPrefixPath returns the fixed part of the partspec ; it may include template vars {} -func fixedPrefixPath(pathspec string) string { - varBegin := strings.Index(pathspec, "{") - if -1 == varBegin { - return pathspec - } - return pathspec[:varBegin] -} - -// ServeHTTP implements net/http.Handler therefore a Container can be a Handler in a http.Server -func (c *Container) ServeHTTP(httpwriter http.ResponseWriter, httpRequest *http.Request) { - c.ServeMux.ServeHTTP(httpwriter, httpRequest) -} - -// Handle registers the handler for the given pattern. If a handler already exists for pattern, Handle panics. -func (c *Container) Handle(pattern string, handler http.Handler) { - c.ServeMux.Handle(pattern, handler) -} - -// HandleWithFilter registers the handler for the given pattern. -// Container's filter chain is applied for handler. -// If a handler already exists for pattern, HandleWithFilter panics. -func (c *Container) HandleWithFilter(pattern string, handler http.Handler) { - f := func(httpResponse http.ResponseWriter, httpRequest *http.Request) { - if len(c.containerFilters) == 0 { - handler.ServeHTTP(httpResponse, httpRequest) - return - } - - chain := FilterChain{Filters: c.containerFilters, Target: func(req *Request, resp *Response) { - handler.ServeHTTP(httpResponse, httpRequest) - }} - chain.ProcessFilter(NewRequest(httpRequest), NewResponse(httpResponse)) - } - - c.Handle(pattern, http.HandlerFunc(f)) -} - -// Filter appends a container FilterFunction. These are called before dispatching -// a http.Request to a WebService from the container -func (c *Container) Filter(filter FilterFunction) { - c.containerFilters = append(c.containerFilters, filter) -} - -// RegisteredWebServices returns the collections of added WebServices -func (c *Container) RegisteredWebServices() []*WebService { - c.webServicesLock.RLock() - defer c.webServicesLock.RUnlock() - result := make([]*WebService, len(c.webServices)) - for ix := range c.webServices { - result[ix] = c.webServices[ix] - } - return result -} - -// computeAllowedMethods returns a list of HTTP methods that are valid for a Request -func (c *Container) computeAllowedMethods(req *Request) []string { - // Go through all RegisteredWebServices() and all its Routes to collect the options - methods := []string{} - requestPath := req.Request.URL.Path - for _, ws := range c.RegisteredWebServices() { - matches := ws.pathExpr.Matcher.FindStringSubmatch(requestPath) - if matches != nil { - finalMatch := matches[len(matches)-1] - for _, rt := range ws.Routes() { - matches := rt.pathExpr.Matcher.FindStringSubmatch(finalMatch) - if matches != nil { - lastMatch := matches[len(matches)-1] - if lastMatch == "" || lastMatch == "/" { // do not include if value is neither empty nor ‘/’. - methods = append(methods, rt.Method) - } - } - } - } - } - // methods = append(methods, "OPTIONS") not sure about this - return methods -} - -// newBasicRequestResponse creates a pair of Request,Response from its http versions. -// It is basic because no parameter or (produces) content-type information is given. -func newBasicRequestResponse(httpWriter http.ResponseWriter, httpRequest *http.Request) (*Request, *Response) { - resp := NewResponse(httpWriter) - resp.requestAccept = httpRequest.Header.Get(HEADER_Accept) - return NewRequest(httpRequest), resp -} diff --git a/vendor/github.com/emicklei/go-restful/cors_filter.go b/vendor/github.com/emicklei/go-restful/cors_filter.go deleted file mode 100644 index 1efeef07..00000000 --- a/vendor/github.com/emicklei/go-restful/cors_filter.go +++ /dev/null @@ -1,202 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "regexp" - "strconv" - "strings" -) - -// CrossOriginResourceSharing is used to create a Container Filter that implements CORS. -// Cross-origin resource sharing (CORS) is a mechanism that allows JavaScript on a web page -// to make XMLHttpRequests to another domain, not the domain the JavaScript originated from. -// -// http://en.wikipedia.org/wiki/Cross-origin_resource_sharing -// http://enable-cors.org/server.html -// http://www.html5rocks.com/en/tutorials/cors/#toc-handling-a-not-so-simple-request -type CrossOriginResourceSharing struct { - ExposeHeaders []string // list of Header names - AllowedHeaders []string // list of Header names - AllowedDomains []string // list of allowed values for Http Origin. An allowed value can be a regular expression to support subdomain matching. If empty all are allowed. - AllowedMethods []string - MaxAge int // number of seconds before requiring new Options request - CookiesAllowed bool - Container *Container - - allowedOriginPatterns []*regexp.Regexp // internal field for origin regexp check. -} - -// Filter is a filter function that implements the CORS flow as documented on http://enable-cors.org/server.html -// and http://www.html5rocks.com/static/images/cors_server_flowchart.png -func (c CrossOriginResourceSharing) Filter(req *Request, resp *Response, chain *FilterChain) { - origin := req.Request.Header.Get(HEADER_Origin) - if len(origin) == 0 { - if trace { - traceLogger.Print("no Http header Origin set") - } - chain.ProcessFilter(req, resp) - return - } - if !c.isOriginAllowed(origin) { // check whether this origin is allowed - if trace { - traceLogger.Printf("HTTP Origin:%s is not part of %v, neither matches any part of %v", origin, c.AllowedDomains, c.allowedOriginPatterns) - } - chain.ProcessFilter(req, resp) - return - } - if req.Request.Method != "OPTIONS" { - c.doActualRequest(req, resp) - chain.ProcessFilter(req, resp) - return - } - if acrm := req.Request.Header.Get(HEADER_AccessControlRequestMethod); acrm != "" { - c.doPreflightRequest(req, resp) - } else { - c.doActualRequest(req, resp) - chain.ProcessFilter(req, resp) - return - } -} - -func (c CrossOriginResourceSharing) doActualRequest(req *Request, resp *Response) { - c.setOptionsHeaders(req, resp) - // continue processing the response -} - -func (c *CrossOriginResourceSharing) doPreflightRequest(req *Request, resp *Response) { - if len(c.AllowedMethods) == 0 { - if c.Container == nil { - c.AllowedMethods = DefaultContainer.computeAllowedMethods(req) - } else { - c.AllowedMethods = c.Container.computeAllowedMethods(req) - } - } - - acrm := req.Request.Header.Get(HEADER_AccessControlRequestMethod) - if !c.isValidAccessControlRequestMethod(acrm, c.AllowedMethods) { - if trace { - traceLogger.Printf("Http header %s:%s is not in %v", - HEADER_AccessControlRequestMethod, - acrm, - c.AllowedMethods) - } - return - } - acrhs := req.Request.Header.Get(HEADER_AccessControlRequestHeaders) - if len(acrhs) > 0 { - for _, each := range strings.Split(acrhs, ",") { - if !c.isValidAccessControlRequestHeader(strings.Trim(each, " ")) { - if trace { - traceLogger.Printf("Http header %s:%s is not in %v", - HEADER_AccessControlRequestHeaders, - acrhs, - c.AllowedHeaders) - } - return - } - } - } - resp.AddHeader(HEADER_AccessControlAllowMethods, strings.Join(c.AllowedMethods, ",")) - resp.AddHeader(HEADER_AccessControlAllowHeaders, acrhs) - c.setOptionsHeaders(req, resp) - - // return http 200 response, no body -} - -func (c CrossOriginResourceSharing) setOptionsHeaders(req *Request, resp *Response) { - c.checkAndSetExposeHeaders(resp) - c.setAllowOriginHeader(req, resp) - c.checkAndSetAllowCredentials(resp) - if c.MaxAge > 0 { - resp.AddHeader(HEADER_AccessControlMaxAge, strconv.Itoa(c.MaxAge)) - } -} - -func (c CrossOriginResourceSharing) isOriginAllowed(origin string) bool { - if len(origin) == 0 { - return false - } - if len(c.AllowedDomains) == 0 { - return true - } - - allowed := false - for _, domain := range c.AllowedDomains { - if domain == origin { - allowed = true - break - } - } - - if !allowed { - if len(c.allowedOriginPatterns) == 0 { - // compile allowed domains to allowed origin patterns - allowedOriginRegexps, err := compileRegexps(c.AllowedDomains) - if err != nil { - return false - } - c.allowedOriginPatterns = allowedOriginRegexps - } - - for _, pattern := range c.allowedOriginPatterns { - if allowed = pattern.MatchString(origin); allowed { - break - } - } - } - - return allowed -} - -func (c CrossOriginResourceSharing) setAllowOriginHeader(req *Request, resp *Response) { - origin := req.Request.Header.Get(HEADER_Origin) - if c.isOriginAllowed(origin) { - resp.AddHeader(HEADER_AccessControlAllowOrigin, origin) - } -} - -func (c CrossOriginResourceSharing) checkAndSetExposeHeaders(resp *Response) { - if len(c.ExposeHeaders) > 0 { - resp.AddHeader(HEADER_AccessControlExposeHeaders, strings.Join(c.ExposeHeaders, ",")) - } -} - -func (c CrossOriginResourceSharing) checkAndSetAllowCredentials(resp *Response) { - if c.CookiesAllowed { - resp.AddHeader(HEADER_AccessControlAllowCredentials, "true") - } -} - -func (c CrossOriginResourceSharing) isValidAccessControlRequestMethod(method string, allowedMethods []string) bool { - for _, each := range allowedMethods { - if each == method { - return true - } - } - return false -} - -func (c CrossOriginResourceSharing) isValidAccessControlRequestHeader(header string) bool { - for _, each := range c.AllowedHeaders { - if strings.ToLower(each) == strings.ToLower(header) { - return true - } - } - return false -} - -// Take a list of strings and compile them into a list of regular expressions. -func compileRegexps(regexpStrings []string) ([]*regexp.Regexp, error) { - regexps := []*regexp.Regexp{} - for _, regexpStr := range regexpStrings { - r, err := regexp.Compile(regexpStr) - if err != nil { - return regexps, err - } - regexps = append(regexps, r) - } - return regexps, nil -} diff --git a/vendor/github.com/emicklei/go-restful/coverage.sh b/vendor/github.com/emicklei/go-restful/coverage.sh deleted file mode 100644 index e27dbf1a..00000000 --- a/vendor/github.com/emicklei/go-restful/coverage.sh +++ /dev/null @@ -1,2 +0,0 @@ -go test -coverprofile=coverage.out -go tool cover -html=coverage.out \ No newline at end of file diff --git a/vendor/github.com/emicklei/go-restful/curly.go b/vendor/github.com/emicklei/go-restful/curly.go deleted file mode 100644 index 79f1f5aa..00000000 --- a/vendor/github.com/emicklei/go-restful/curly.go +++ /dev/null @@ -1,164 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "net/http" - "regexp" - "sort" - "strings" -) - -// CurlyRouter expects Routes with paths that contain zero or more parameters in curly brackets. -type CurlyRouter struct{} - -// SelectRoute is part of the Router interface and returns the best match -// for the WebService and its Route for the given Request. -func (c CurlyRouter) SelectRoute( - webServices []*WebService, - httpRequest *http.Request) (selectedService *WebService, selected *Route, err error) { - - requestTokens := tokenizePath(httpRequest.URL.Path) - - detectedService := c.detectWebService(requestTokens, webServices) - if detectedService == nil { - if trace { - traceLogger.Printf("no WebService was found to match URL path:%s\n", httpRequest.URL.Path) - } - return nil, nil, NewError(http.StatusNotFound, "404: Page Not Found") - } - candidateRoutes := c.selectRoutes(detectedService, requestTokens) - if len(candidateRoutes) == 0 { - if trace { - traceLogger.Printf("no Route in WebService with path %s was found to match URL path:%s\n", detectedService.rootPath, httpRequest.URL.Path) - } - return detectedService, nil, NewError(http.StatusNotFound, "404: Page Not Found") - } - selectedRoute, err := c.detectRoute(candidateRoutes, httpRequest) - if selectedRoute == nil { - return detectedService, nil, err - } - return detectedService, selectedRoute, nil -} - -// selectRoutes return a collection of Route from a WebService that matches the path tokens from the request. -func (c CurlyRouter) selectRoutes(ws *WebService, requestTokens []string) sortableCurlyRoutes { - candidates := sortableCurlyRoutes{} - for _, each := range ws.routes { - matches, paramCount, staticCount := c.matchesRouteByPathTokens(each.pathParts, requestTokens) - if matches { - candidates.add(curlyRoute{each, paramCount, staticCount}) // TODO make sure Routes() return pointers? - } - } - sort.Sort(sort.Reverse(candidates)) - return candidates -} - -// matchesRouteByPathTokens computes whether it matches, howmany parameters do match and what the number of static path elements are. -func (c CurlyRouter) matchesRouteByPathTokens(routeTokens, requestTokens []string) (matches bool, paramCount int, staticCount int) { - if len(routeTokens) < len(requestTokens) { - // proceed in matching only if last routeToken is wildcard - count := len(routeTokens) - if count == 0 || !strings.HasSuffix(routeTokens[count-1], "*}") { - return false, 0, 0 - } - // proceed - } - for i, routeToken := range routeTokens { - if i == len(requestTokens) { - // reached end of request path - return false, 0, 0 - } - requestToken := requestTokens[i] - if strings.HasPrefix(routeToken, "{") { - paramCount++ - if colon := strings.Index(routeToken, ":"); colon != -1 { - // match by regex - matchesToken, matchesRemainder := c.regularMatchesPathToken(routeToken, colon, requestToken) - if !matchesToken { - return false, 0, 0 - } - if matchesRemainder { - break - } - } - } else { // no { prefix - if requestToken != routeToken { - return false, 0, 0 - } - staticCount++ - } - } - return true, paramCount, staticCount -} - -// regularMatchesPathToken tests whether the regular expression part of routeToken matches the requestToken or all remaining tokens -// format routeToken is {someVar:someExpression}, e.g. {zipcode:[\d][\d][\d][\d][A-Z][A-Z]} -func (c CurlyRouter) regularMatchesPathToken(routeToken string, colon int, requestToken string) (matchesToken bool, matchesRemainder bool) { - regPart := routeToken[colon+1 : len(routeToken)-1] - if regPart == "*" { - if trace { - traceLogger.Printf("wildcard parameter detected in route token %s that matches %s\n", routeToken, requestToken) - } - return true, true - } - matched, err := regexp.MatchString(regPart, requestToken) - return (matched && err == nil), false -} - -var jsr311Router = RouterJSR311{} - -// detectRoute selectes from a list of Route the first match by inspecting both the Accept and Content-Type -// headers of the Request. See also RouterJSR311 in jsr311.go -func (c CurlyRouter) detectRoute(candidateRoutes sortableCurlyRoutes, httpRequest *http.Request) (*Route, error) { - // tracing is done inside detectRoute - return jsr311Router.detectRoute(candidateRoutes.routes(), httpRequest) -} - -// detectWebService returns the best matching webService given the list of path tokens. -// see also computeWebserviceScore -func (c CurlyRouter) detectWebService(requestTokens []string, webServices []*WebService) *WebService { - var best *WebService - score := -1 - for _, each := range webServices { - matches, eachScore := c.computeWebserviceScore(requestTokens, each.pathExpr.tokens) - if matches && (eachScore > score) { - best = each - score = eachScore - } - } - return best -} - -// computeWebserviceScore returns whether tokens match and -// the weighted score of the longest matching consecutive tokens from the beginning. -func (c CurlyRouter) computeWebserviceScore(requestTokens []string, tokens []string) (bool, int) { - if len(tokens) > len(requestTokens) { - return false, 0 - } - score := 0 - for i := 0; i < len(tokens); i++ { - each := requestTokens[i] - other := tokens[i] - if len(each) == 0 && len(other) == 0 { - score++ - continue - } - if len(other) > 0 && strings.HasPrefix(other, "{") { - // no empty match - if len(each) == 0 { - return false, score - } - score += 1 - } else { - // not a parameter - if each != other { - return false, score - } - score += (len(tokens) - i) * 10 //fuzzy - } - } - return true, score -} diff --git a/vendor/github.com/emicklei/go-restful/curly_route.go b/vendor/github.com/emicklei/go-restful/curly_route.go deleted file mode 100644 index 296f9465..00000000 --- a/vendor/github.com/emicklei/go-restful/curly_route.go +++ /dev/null @@ -1,52 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -// curlyRoute exits for sorting Routes by the CurlyRouter based on number of parameters and number of static path elements. -type curlyRoute struct { - route Route - paramCount int - staticCount int -} - -type sortableCurlyRoutes []curlyRoute - -func (s *sortableCurlyRoutes) add(route curlyRoute) { - *s = append(*s, route) -} - -func (s sortableCurlyRoutes) routes() (routes []Route) { - for _, each := range s { - routes = append(routes, each.route) // TODO change return type - } - return routes -} - -func (s sortableCurlyRoutes) Len() int { - return len(s) -} -func (s sortableCurlyRoutes) Swap(i, j int) { - s[i], s[j] = s[j], s[i] -} -func (s sortableCurlyRoutes) Less(i, j int) bool { - ci := s[i] - cj := s[j] - - // primary key - if ci.staticCount < cj.staticCount { - return true - } - if ci.staticCount > cj.staticCount { - return false - } - // secundary key - if ci.paramCount < cj.paramCount { - return true - } - if ci.paramCount > cj.paramCount { - return false - } - return ci.route.Path < cj.route.Path -} diff --git a/vendor/github.com/emicklei/go-restful/doc.go b/vendor/github.com/emicklei/go-restful/doc.go deleted file mode 100644 index f7c16b01..00000000 --- a/vendor/github.com/emicklei/go-restful/doc.go +++ /dev/null @@ -1,185 +0,0 @@ -/* -Package restful , a lean package for creating REST-style WebServices without magic. - -WebServices and Routes - -A WebService has a collection of Route objects that dispatch incoming Http Requests to a function calls. -Typically, a WebService has a root path (e.g. /users) and defines common MIME types for its routes. -WebServices must be added to a container (see below) in order to handler Http requests from a server. - -A Route is defined by a HTTP method, an URL path and (optionally) the MIME types it consumes (Content-Type) and produces (Accept). -This package has the logic to find the best matching Route and if found, call its Function. - - ws := new(restful.WebService) - ws. - Path("/users"). - Consumes(restful.MIME_JSON, restful.MIME_XML). - Produces(restful.MIME_JSON, restful.MIME_XML) - - ws.Route(ws.GET("/{user-id}").To(u.findUser)) // u is a UserResource - - ... - - // GET http://localhost:8080/users/1 - func (u UserResource) findUser(request *restful.Request, response *restful.Response) { - id := request.PathParameter("user-id") - ... - } - -The (*Request, *Response) arguments provide functions for reading information from the request and writing information back to the response. - -See the example https://github.com/emicklei/go-restful/blob/master/examples/restful-user-resource.go with a full implementation. - -Regular expression matching Routes - -A Route parameter can be specified using the format "uri/{var[:regexp]}" or the special version "uri/{var:*}" for matching the tail of the path. -For example, /persons/{name:[A-Z][A-Z]} can be used to restrict values for the parameter "name" to only contain capital alphabetic characters. -Regular expressions must use the standard Go syntax as described in the regexp package. (https://code.google.com/p/re2/wiki/Syntax) -This feature requires the use of a CurlyRouter. - -Containers - -A Container holds a collection of WebServices, Filters and a http.ServeMux for multiplexing http requests. -Using the statements "restful.Add(...) and restful.Filter(...)" will register WebServices and Filters to the Default Container. -The Default container of go-restful uses the http.DefaultServeMux. -You can create your own Container and create a new http.Server for that particular container. - - container := restful.NewContainer() - server := &http.Server{Addr: ":8081", Handler: container} - -Filters - -A filter dynamically intercepts requests and responses to transform or use the information contained in the requests or responses. -You can use filters to perform generic logging, measurement, authentication, redirect, set response headers etc. -In the restful package there are three hooks into the request,response flow where filters can be added. -Each filter must define a FilterFunction: - - func (req *restful.Request, resp *restful.Response, chain *restful.FilterChain) - -Use the following statement to pass the request,response pair to the next filter or RouteFunction - - chain.ProcessFilter(req, resp) - -Container Filters - -These are processed before any registered WebService. - - // install a (global) filter for the default container (processed before any webservice) - restful.Filter(globalLogging) - -WebService Filters - -These are processed before any Route of a WebService. - - // install a webservice filter (processed before any route) - ws.Filter(webserviceLogging).Filter(measureTime) - - -Route Filters - -These are processed before calling the function associated with the Route. - - // install 2 chained route filters (processed before calling findUser) - ws.Route(ws.GET("/{user-id}").Filter(routeLogging).Filter(NewCountFilter().routeCounter).To(findUser)) - -See the example https://github.com/emicklei/go-restful/blob/master/examples/restful-filters.go with full implementations. - -Response Encoding - -Two encodings are supported: gzip and deflate. To enable this for all responses: - - restful.DefaultContainer.EnableContentEncoding(true) - -If a Http request includes the Accept-Encoding header then the response content will be compressed using the specified encoding. -Alternatively, you can create a Filter that performs the encoding and install it per WebService or Route. - -See the example https://github.com/emicklei/go-restful/blob/master/examples/restful-encoding-filter.go - -OPTIONS support - -By installing a pre-defined container filter, your Webservice(s) can respond to the OPTIONS Http request. - - Filter(OPTIONSFilter()) - -CORS - -By installing the filter of a CrossOriginResourceSharing (CORS), your WebService(s) can handle CORS requests. - - cors := CrossOriginResourceSharing{ExposeHeaders: []string{"X-My-Header"}, CookiesAllowed: false, Container: DefaultContainer} - Filter(cors.Filter) - -Error Handling - -Unexpected things happen. If a request cannot be processed because of a failure, your service needs to tell via the response what happened and why. -For this reason HTTP status codes exist and it is important to use the correct code in every exceptional situation. - - 400: Bad Request - -If path or query parameters are not valid (content or type) then use http.StatusBadRequest. - - 404: Not Found - -Despite a valid URI, the resource requested may not be available - - 500: Internal Server Error - -If the application logic could not process the request (or write the response) then use http.StatusInternalServerError. - - 405: Method Not Allowed - -The request has a valid URL but the method (GET,PUT,POST,...) is not allowed. - - 406: Not Acceptable - -The request does not have or has an unknown Accept Header set for this operation. - - 415: Unsupported Media Type - -The request does not have or has an unknown Content-Type Header set for this operation. - -ServiceError - -In addition to setting the correct (error) Http status code, you can choose to write a ServiceError message on the response. - -Performance options - -This package has several options that affect the performance of your service. It is important to understand them and how you can change it. - - restful.DefaultContainer.DoNotRecover(false) - -DoNotRecover controls whether panics will be caught to return HTTP 500. -If set to false, the container will recover from panics. -Default value is true - - restful.SetCompressorProvider(NewBoundedCachedCompressors(20, 20)) - -If content encoding is enabled then the default strategy for getting new gzip/zlib writers and readers is to use a sync.Pool. -Because writers are expensive structures, performance is even more improved when using a preloaded cache. You can also inject your own implementation. - -Trouble shooting - -This package has the means to produce detail logging of the complete Http request matching process and filter invocation. -Enabling this feature requires you to set an implementation of restful.StdLogger (e.g. log.Logger) instance such as: - - restful.TraceLogger(log.New(os.Stdout, "[restful] ", log.LstdFlags|log.Lshortfile)) - -Logging - -The restful.SetLogger() method allows you to override the logger used by the package. By default restful -uses the standard library `log` package and logs to stdout. Different logging packages are supported as -long as they conform to `StdLogger` interface defined in the `log` sub-package, writing an adapter for your -preferred package is simple. - -Resources - -[project]: https://github.com/emicklei/go-restful - -[examples]: https://github.com/emicklei/go-restful/blob/master/examples - -[design]: http://ernestmicklei.com/2012/11/11/go-restful-api-design/ - -[showcases]: https://github.com/emicklei/mora, https://github.com/emicklei/landskape - -(c) 2012-2015, http://ernestmicklei.com. MIT License -*/ -package restful diff --git a/vendor/github.com/emicklei/go-restful/entity_accessors.go b/vendor/github.com/emicklei/go-restful/entity_accessors.go deleted file mode 100644 index 6ecf6c7f..00000000 --- a/vendor/github.com/emicklei/go-restful/entity_accessors.go +++ /dev/null @@ -1,163 +0,0 @@ -package restful - -// Copyright 2015 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "encoding/json" - "encoding/xml" - "strings" - "sync" -) - -// EntityReaderWriter can read and write values using an encoding such as JSON,XML. -type EntityReaderWriter interface { - // Read a serialized version of the value from the request. - // The Request may have a decompressing reader. Depends on Content-Encoding. - Read(req *Request, v interface{}) error - - // Write a serialized version of the value on the response. - // The Response may have a compressing writer. Depends on Accept-Encoding. - // status should be a valid Http Status code - Write(resp *Response, status int, v interface{}) error -} - -// entityAccessRegistry is a singleton -var entityAccessRegistry = &entityReaderWriters{ - protection: new(sync.RWMutex), - accessors: map[string]EntityReaderWriter{}, -} - -// entityReaderWriters associates MIME to an EntityReaderWriter -type entityReaderWriters struct { - protection *sync.RWMutex - accessors map[string]EntityReaderWriter -} - -func init() { - RegisterEntityAccessor(MIME_JSON, NewEntityAccessorJSON(MIME_JSON)) - RegisterEntityAccessor(MIME_XML, NewEntityAccessorXML(MIME_XML)) -} - -// RegisterEntityAccessor add/overrides the ReaderWriter for encoding content with this MIME type. -func RegisterEntityAccessor(mime string, erw EntityReaderWriter) { - entityAccessRegistry.protection.Lock() - defer entityAccessRegistry.protection.Unlock() - entityAccessRegistry.accessors[mime] = erw -} - -// NewEntityAccessorJSON returns a new EntityReaderWriter for accessing JSON content. -// This package is already initialized with such an accessor using the MIME_JSON contentType. -func NewEntityAccessorJSON(contentType string) EntityReaderWriter { - return entityJSONAccess{ContentType: contentType} -} - -// NewEntityAccessorXML returns a new EntityReaderWriter for accessing XML content. -// This package is already initialized with such an accessor using the MIME_XML contentType. -func NewEntityAccessorXML(contentType string) EntityReaderWriter { - return entityXMLAccess{ContentType: contentType} -} - -// accessorAt returns the registered ReaderWriter for this MIME type. -func (r *entityReaderWriters) accessorAt(mime string) (EntityReaderWriter, bool) { - r.protection.RLock() - defer r.protection.RUnlock() - er, ok := r.accessors[mime] - if !ok { - // retry with reverse lookup - // more expensive but we are in an exceptional situation anyway - for k, v := range r.accessors { - if strings.Contains(mime, k) { - return v, true - } - } - } - return er, ok -} - -// entityXMLAccess is a EntityReaderWriter for XML encoding -type entityXMLAccess struct { - // This is used for setting the Content-Type header when writing - ContentType string -} - -// Read unmarshalls the value from XML -func (e entityXMLAccess) Read(req *Request, v interface{}) error { - return xml.NewDecoder(req.Request.Body).Decode(v) -} - -// Write marshalls the value to JSON and set the Content-Type Header. -func (e entityXMLAccess) Write(resp *Response, status int, v interface{}) error { - return writeXML(resp, status, e.ContentType, v) -} - -// writeXML marshalls the value to JSON and set the Content-Type Header. -func writeXML(resp *Response, status int, contentType string, v interface{}) error { - if v == nil { - resp.WriteHeader(status) - // do not write a nil representation - return nil - } - if resp.prettyPrint { - // pretty output must be created and written explicitly - output, err := xml.MarshalIndent(v, " ", " ") - if err != nil { - return err - } - resp.Header().Set(HEADER_ContentType, contentType) - resp.WriteHeader(status) - _, err = resp.Write([]byte(xml.Header)) - if err != nil { - return err - } - _, err = resp.Write(output) - return err - } - // not-so-pretty - resp.Header().Set(HEADER_ContentType, contentType) - resp.WriteHeader(status) - return xml.NewEncoder(resp).Encode(v) -} - -// entityJSONAccess is a EntityReaderWriter for JSON encoding -type entityJSONAccess struct { - // This is used for setting the Content-Type header when writing - ContentType string -} - -// Read unmarshalls the value from JSON -func (e entityJSONAccess) Read(req *Request, v interface{}) error { - decoder := json.NewDecoder(req.Request.Body) - decoder.UseNumber() - return decoder.Decode(v) -} - -// Write marshalls the value to JSON and set the Content-Type Header. -func (e entityJSONAccess) Write(resp *Response, status int, v interface{}) error { - return writeJSON(resp, status, e.ContentType, v) -} - -// write marshalls the value to JSON and set the Content-Type Header. -func writeJSON(resp *Response, status int, contentType string, v interface{}) error { - if v == nil { - resp.WriteHeader(status) - // do not write a nil representation - return nil - } - if resp.prettyPrint { - // pretty output must be created and written explicitly - output, err := json.MarshalIndent(v, " ", " ") - if err != nil { - return err - } - resp.Header().Set(HEADER_ContentType, contentType) - resp.WriteHeader(status) - _, err = resp.Write(output) - return err - } - // not-so-pretty - resp.Header().Set(HEADER_ContentType, contentType) - resp.WriteHeader(status) - return json.NewEncoder(resp).Encode(v) -} diff --git a/vendor/github.com/emicklei/go-restful/filter.go b/vendor/github.com/emicklei/go-restful/filter.go deleted file mode 100644 index c23bfb59..00000000 --- a/vendor/github.com/emicklei/go-restful/filter.go +++ /dev/null @@ -1,35 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -// FilterChain is a request scoped object to process one or more filters before calling the target RouteFunction. -type FilterChain struct { - Filters []FilterFunction // ordered list of FilterFunction - Index int // index into filters that is currently in progress - Target RouteFunction // function to call after passing all filters -} - -// ProcessFilter passes the request,response pair through the next of Filters. -// Each filter can decide to proceed to the next Filter or handle the Response itself. -func (f *FilterChain) ProcessFilter(request *Request, response *Response) { - if f.Index < len(f.Filters) { - f.Index++ - f.Filters[f.Index-1](request, response, f) - } else { - f.Target(request, response) - } -} - -// FilterFunction definitions must call ProcessFilter on the FilterChain to pass on the control and eventually call the RouteFunction -type FilterFunction func(*Request, *Response, *FilterChain) - -// NoBrowserCacheFilter is a filter function to set HTTP headers that disable browser caching -// See examples/restful-no-cache-filter.go for usage -func NoBrowserCacheFilter(req *Request, resp *Response, chain *FilterChain) { - resp.Header().Set("Cache-Control", "no-cache, no-store, must-revalidate") // HTTP 1.1. - resp.Header().Set("Pragma", "no-cache") // HTTP 1.0. - resp.Header().Set("Expires", "0") // Proxies. - chain.ProcessFilter(req, resp) -} diff --git a/vendor/github.com/emicklei/go-restful/jsr311.go b/vendor/github.com/emicklei/go-restful/jsr311.go deleted file mode 100644 index 511444ac..00000000 --- a/vendor/github.com/emicklei/go-restful/jsr311.go +++ /dev/null @@ -1,248 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "errors" - "fmt" - "net/http" - "sort" -) - -// RouterJSR311 implements the flow for matching Requests to Routes (and consequently Resource Functions) -// as specified by the JSR311 http://jsr311.java.net/nonav/releases/1.1/spec/spec.html. -// RouterJSR311 implements the Router interface. -// Concept of locators is not implemented. -type RouterJSR311 struct{} - -// SelectRoute is part of the Router interface and returns the best match -// for the WebService and its Route for the given Request. -func (r RouterJSR311) SelectRoute( - webServices []*WebService, - httpRequest *http.Request) (selectedService *WebService, selectedRoute *Route, err error) { - - // Identify the root resource class (WebService) - dispatcher, finalMatch, err := r.detectDispatcher(httpRequest.URL.Path, webServices) - if err != nil { - return nil, nil, NewError(http.StatusNotFound, "") - } - // Obtain the set of candidate methods (Routes) - routes := r.selectRoutes(dispatcher, finalMatch) - if len(routes) == 0 { - return dispatcher, nil, NewError(http.StatusNotFound, "404: Page Not Found") - } - - // Identify the method (Route) that will handle the request - route, ok := r.detectRoute(routes, httpRequest) - return dispatcher, route, ok -} - -// http://jsr311.java.net/nonav/releases/1.1/spec/spec3.html#x3-360003.7.2 -func (r RouterJSR311) detectRoute(routes []Route, httpRequest *http.Request) (*Route, error) { - // http method - methodOk := []Route{} - for _, each := range routes { - if httpRequest.Method == each.Method { - methodOk = append(methodOk, each) - } - } - if len(methodOk) == 0 { - if trace { - traceLogger.Printf("no Route found (in %d routes) that matches HTTP method %s\n", len(routes), httpRequest.Method) - } - return nil, NewError(http.StatusMethodNotAllowed, "405: Method Not Allowed") - } - inputMediaOk := methodOk - - // content-type - contentType := httpRequest.Header.Get(HEADER_ContentType) - inputMediaOk = []Route{} - for _, each := range methodOk { - if each.matchesContentType(contentType) { - inputMediaOk = append(inputMediaOk, each) - } - } - if len(inputMediaOk) == 0 { - if trace { - traceLogger.Printf("no Route found (from %d) that matches HTTP Content-Type: %s\n", len(methodOk), contentType) - } - return nil, NewError(http.StatusUnsupportedMediaType, "415: Unsupported Media Type") - } - - // accept - outputMediaOk := []Route{} - accept := httpRequest.Header.Get(HEADER_Accept) - if len(accept) == 0 { - accept = "*/*" - } - for _, each := range inputMediaOk { - if each.matchesAccept(accept) { - outputMediaOk = append(outputMediaOk, each) - } - } - if len(outputMediaOk) == 0 { - if trace { - traceLogger.Printf("no Route found (from %d) that matches HTTP Accept: %s\n", len(inputMediaOk), accept) - } - return nil, NewError(http.StatusNotAcceptable, "406: Not Acceptable") - } - // return r.bestMatchByMedia(outputMediaOk, contentType, accept), nil - return &outputMediaOk[0], nil -} - -// http://jsr311.java.net/nonav/releases/1.1/spec/spec3.html#x3-360003.7.2 -// n/m > n/* > */* -func (r RouterJSR311) bestMatchByMedia(routes []Route, contentType string, accept string) *Route { - // TODO - return &routes[0] -} - -// http://jsr311.java.net/nonav/releases/1.1/spec/spec3.html#x3-360003.7.2 (step 2) -func (r RouterJSR311) selectRoutes(dispatcher *WebService, pathRemainder string) []Route { - filtered := &sortableRouteCandidates{} - for _, each := range dispatcher.Routes() { - pathExpr := each.pathExpr - matches := pathExpr.Matcher.FindStringSubmatch(pathRemainder) - if matches != nil { - lastMatch := matches[len(matches)-1] - if len(lastMatch) == 0 || lastMatch == "/" { // do not include if value is neither empty nor ‘/’. - filtered.candidates = append(filtered.candidates, - routeCandidate{each, len(matches) - 1, pathExpr.LiteralCount, pathExpr.VarCount}) - } - } - } - if len(filtered.candidates) == 0 { - if trace { - traceLogger.Printf("WebService on path %s has no routes that match URL path remainder:%s\n", dispatcher.rootPath, pathRemainder) - } - return []Route{} - } - sort.Sort(sort.Reverse(filtered)) - - // select other routes from candidates whoes expression matches rmatch - matchingRoutes := []Route{filtered.candidates[0].route} - for c := 1; c < len(filtered.candidates); c++ { - each := filtered.candidates[c] - if each.route.pathExpr.Matcher.MatchString(pathRemainder) { - matchingRoutes = append(matchingRoutes, each.route) - } - } - return matchingRoutes -} - -// http://jsr311.java.net/nonav/releases/1.1/spec/spec3.html#x3-360003.7.2 (step 1) -func (r RouterJSR311) detectDispatcher(requestPath string, dispatchers []*WebService) (*WebService, string, error) { - filtered := &sortableDispatcherCandidates{} - for _, each := range dispatchers { - matches := each.pathExpr.Matcher.FindStringSubmatch(requestPath) - if matches != nil { - filtered.candidates = append(filtered.candidates, - dispatcherCandidate{each, matches[len(matches)-1], len(matches), each.pathExpr.LiteralCount, each.pathExpr.VarCount}) - } - } - if len(filtered.candidates) == 0 { - if trace { - traceLogger.Printf("no WebService was found to match URL path:%s\n", requestPath) - } - return nil, "", errors.New("not found") - } - sort.Sort(sort.Reverse(filtered)) - return filtered.candidates[0].dispatcher, filtered.candidates[0].finalMatch, nil -} - -// Types and functions to support the sorting of Routes - -type routeCandidate struct { - route Route - matchesCount int // the number of capturing groups - literalCount int // the number of literal characters (means those not resulting from template variable substitution) - nonDefaultCount int // the number of capturing groups with non-default regular expressions (i.e. not ‘([^ /]+?)’) -} - -func (r routeCandidate) expressionToMatch() string { - return r.route.pathExpr.Source -} - -func (r routeCandidate) String() string { - return fmt.Sprintf("(m=%d,l=%d,n=%d)", r.matchesCount, r.literalCount, r.nonDefaultCount) -} - -type sortableRouteCandidates struct { - candidates []routeCandidate -} - -func (rcs *sortableRouteCandidates) Len() int { - return len(rcs.candidates) -} -func (rcs *sortableRouteCandidates) Swap(i, j int) { - rcs.candidates[i], rcs.candidates[j] = rcs.candidates[j], rcs.candidates[i] -} -func (rcs *sortableRouteCandidates) Less(i, j int) bool { - ci := rcs.candidates[i] - cj := rcs.candidates[j] - // primary key - if ci.literalCount < cj.literalCount { - return true - } - if ci.literalCount > cj.literalCount { - return false - } - // secundary key - if ci.matchesCount < cj.matchesCount { - return true - } - if ci.matchesCount > cj.matchesCount { - return false - } - // tertiary key - if ci.nonDefaultCount < cj.nonDefaultCount { - return true - } - if ci.nonDefaultCount > cj.nonDefaultCount { - return false - } - // quaternary key ("source" is interpreted as Path) - return ci.route.Path < cj.route.Path -} - -// Types and functions to support the sorting of Dispatchers - -type dispatcherCandidate struct { - dispatcher *WebService - finalMatch string - matchesCount int // the number of capturing groups - literalCount int // the number of literal characters (means those not resulting from template variable substitution) - nonDefaultCount int // the number of capturing groups with non-default regular expressions (i.e. not ‘([^ /]+?)’) -} -type sortableDispatcherCandidates struct { - candidates []dispatcherCandidate -} - -func (dc *sortableDispatcherCandidates) Len() int { - return len(dc.candidates) -} -func (dc *sortableDispatcherCandidates) Swap(i, j int) { - dc.candidates[i], dc.candidates[j] = dc.candidates[j], dc.candidates[i] -} -func (dc *sortableDispatcherCandidates) Less(i, j int) bool { - ci := dc.candidates[i] - cj := dc.candidates[j] - // primary key - if ci.matchesCount < cj.matchesCount { - return true - } - if ci.matchesCount > cj.matchesCount { - return false - } - // secundary key - if ci.literalCount < cj.literalCount { - return true - } - if ci.literalCount > cj.literalCount { - return false - } - // tertiary key - return ci.nonDefaultCount < cj.nonDefaultCount -} diff --git a/vendor/github.com/emicklei/go-restful/log/log.go b/vendor/github.com/emicklei/go-restful/log/log.go deleted file mode 100644 index 6cd44c7a..00000000 --- a/vendor/github.com/emicklei/go-restful/log/log.go +++ /dev/null @@ -1,34 +0,0 @@ -package log - -import ( - stdlog "log" - "os" -) - -// StdLogger corresponds to a minimal subset of the interface satisfied by stdlib log.Logger -type StdLogger interface { - Print(v ...interface{}) - Printf(format string, v ...interface{}) -} - -var Logger StdLogger - -func init() { - // default Logger - SetLogger(stdlog.New(os.Stderr, "[restful] ", stdlog.LstdFlags|stdlog.Lshortfile)) -} - -// SetLogger sets the logger for this package -func SetLogger(customLogger StdLogger) { - Logger = customLogger -} - -// Print delegates to the Logger -func Print(v ...interface{}) { - Logger.Print(v...) -} - -// Printf delegates to the Logger -func Printf(format string, v ...interface{}) { - Logger.Printf(format, v...) -} diff --git a/vendor/github.com/emicklei/go-restful/logger.go b/vendor/github.com/emicklei/go-restful/logger.go deleted file mode 100644 index 3f1c4db8..00000000 --- a/vendor/github.com/emicklei/go-restful/logger.go +++ /dev/null @@ -1,32 +0,0 @@ -package restful - -// Copyright 2014 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. -import ( - "github.com/emicklei/go-restful/log" -) - -var trace bool = false -var traceLogger log.StdLogger - -func init() { - traceLogger = log.Logger // use the package logger by default -} - -// TraceLogger enables detailed logging of Http request matching and filter invocation. Default no logger is set. -// You may call EnableTracing() directly to enable trace logging to the package-wide logger. -func TraceLogger(logger log.StdLogger) { - traceLogger = logger - EnableTracing(logger != nil) -} - -// expose the setter for the global logger on the top-level package -func SetLogger(customLogger log.StdLogger) { - log.SetLogger(customLogger) -} - -// EnableTracing can be used to Trace logging on and off. -func EnableTracing(enabled bool) { - trace = enabled -} diff --git a/vendor/github.com/emicklei/go-restful/mime.go b/vendor/github.com/emicklei/go-restful/mime.go deleted file mode 100644 index d7ea2b61..00000000 --- a/vendor/github.com/emicklei/go-restful/mime.go +++ /dev/null @@ -1,45 +0,0 @@ -package restful - -import ( - "strconv" - "strings" -) - -type mime struct { - media string - quality float64 -} - -// insertMime adds a mime to a list and keeps it sorted by quality. -func insertMime(l []mime, e mime) []mime { - for i, each := range l { - // if current mime has lower quality then insert before - if e.quality > each.quality { - left := append([]mime{}, l[0:i]...) - return append(append(left, e), l[i:]...) - } - } - return append(l, e) -} - -// sortedMimes returns a list of mime sorted (desc) by its specified quality. -func sortedMimes(accept string) (sorted []mime) { - for _, each := range strings.Split(accept, ",") { - typeAndQuality := strings.Split(strings.Trim(each, " "), ";") - if len(typeAndQuality) == 1 { - sorted = insertMime(sorted, mime{typeAndQuality[0], 1.0}) - } else { - // take factor - parts := strings.Split(typeAndQuality[1], "=") - if len(parts) == 2 { - f, err := strconv.ParseFloat(parts[1], 64) - if err != nil { - traceLogger.Printf("unable to parse quality in %s, %v", each, err) - } else { - sorted = insertMime(sorted, mime{typeAndQuality[0], f}) - } - } - } - } - return -} diff --git a/vendor/github.com/emicklei/go-restful/options_filter.go b/vendor/github.com/emicklei/go-restful/options_filter.go deleted file mode 100644 index 4514eadc..00000000 --- a/vendor/github.com/emicklei/go-restful/options_filter.go +++ /dev/null @@ -1,26 +0,0 @@ -package restful - -import "strings" - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -// OPTIONSFilter is a filter function that inspects the Http Request for the OPTIONS method -// and provides the response with a set of allowed methods for the request URL Path. -// As for any filter, you can also install it for a particular WebService within a Container. -// Note: this filter is not needed when using CrossOriginResourceSharing (for CORS). -func (c *Container) OPTIONSFilter(req *Request, resp *Response, chain *FilterChain) { - if "OPTIONS" != req.Request.Method { - chain.ProcessFilter(req, resp) - return - } - resp.AddHeader(HEADER_Allow, strings.Join(c.computeAllowedMethods(req), ",")) -} - -// OPTIONSFilter is a filter function that inspects the Http Request for the OPTIONS method -// and provides the response with a set of allowed methods for the request URL Path. -// Note: this filter is not needed when using CrossOriginResourceSharing (for CORS). -func OPTIONSFilter() FilterFunction { - return DefaultContainer.OPTIONSFilter -} diff --git a/vendor/github.com/emicklei/go-restful/parameter.go b/vendor/github.com/emicklei/go-restful/parameter.go deleted file mode 100644 index e11c8162..00000000 --- a/vendor/github.com/emicklei/go-restful/parameter.go +++ /dev/null @@ -1,114 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -const ( - // PathParameterKind = indicator of Request parameter type "path" - PathParameterKind = iota - - // QueryParameterKind = indicator of Request parameter type "query" - QueryParameterKind - - // BodyParameterKind = indicator of Request parameter type "body" - BodyParameterKind - - // HeaderParameterKind = indicator of Request parameter type "header" - HeaderParameterKind - - // FormParameterKind = indicator of Request parameter type "form" - FormParameterKind -) - -// Parameter is for documententing the parameter used in a Http Request -// ParameterData kinds are Path,Query and Body -type Parameter struct { - data *ParameterData -} - -// ParameterData represents the state of a Parameter. -// It is made public to make it accessible to e.g. the Swagger package. -type ParameterData struct { - Name, Description, DataType, DataFormat string - Kind int - Required bool - AllowableValues map[string]string - AllowMultiple bool - DefaultValue string -} - -// Data returns the state of the Parameter -func (p *Parameter) Data() ParameterData { - return *p.data -} - -// Kind returns the parameter type indicator (see const for valid values) -func (p *Parameter) Kind() int { - return p.data.Kind -} - -func (p *Parameter) bePath() *Parameter { - p.data.Kind = PathParameterKind - return p -} -func (p *Parameter) beQuery() *Parameter { - p.data.Kind = QueryParameterKind - return p -} -func (p *Parameter) beBody() *Parameter { - p.data.Kind = BodyParameterKind - return p -} - -func (p *Parameter) beHeader() *Parameter { - p.data.Kind = HeaderParameterKind - return p -} - -func (p *Parameter) beForm() *Parameter { - p.data.Kind = FormParameterKind - return p -} - -// Required sets the required field and returns the receiver -func (p *Parameter) Required(required bool) *Parameter { - p.data.Required = required - return p -} - -// AllowMultiple sets the allowMultiple field and returns the receiver -func (p *Parameter) AllowMultiple(multiple bool) *Parameter { - p.data.AllowMultiple = multiple - return p -} - -// AllowableValues sets the allowableValues field and returns the receiver -func (p *Parameter) AllowableValues(values map[string]string) *Parameter { - p.data.AllowableValues = values - return p -} - -// DataType sets the dataType field and returns the receiver -func (p *Parameter) DataType(typeName string) *Parameter { - p.data.DataType = typeName - return p -} - -// DataFormat sets the dataFormat field for Swagger UI -func (p *Parameter) DataFormat(formatName string) *Parameter { - p.data.DataFormat = formatName - return p -} - -// DefaultValue sets the default value field and returns the receiver -func (p *Parameter) DefaultValue(stringRepresentation string) *Parameter { - p.data.DefaultValue = stringRepresentation - return p -} - -// Description sets the description value field and returns the receiver -func (p *Parameter) Description(doc string) *Parameter { - p.data.Description = doc - return p -} diff --git a/vendor/github.com/emicklei/go-restful/path_expression.go b/vendor/github.com/emicklei/go-restful/path_expression.go deleted file mode 100644 index a921e6f2..00000000 --- a/vendor/github.com/emicklei/go-restful/path_expression.go +++ /dev/null @@ -1,69 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "bytes" - "fmt" - "regexp" - "strings" -) - -// PathExpression holds a compiled path expression (RegExp) needed to match against -// Http request paths and to extract path parameter values. -type pathExpression struct { - LiteralCount int // the number of literal characters (means those not resulting from template variable substitution) - VarCount int // the number of named parameters (enclosed by {}) in the path - Matcher *regexp.Regexp - Source string // Path as defined by the RouteBuilder - tokens []string -} - -// NewPathExpression creates a PathExpression from the input URL path. -// Returns an error if the path is invalid. -func newPathExpression(path string) (*pathExpression, error) { - expression, literalCount, varCount, tokens := templateToRegularExpression(path) - compiled, err := regexp.Compile(expression) - if err != nil { - return nil, err - } - return &pathExpression{literalCount, varCount, compiled, expression, tokens}, nil -} - -// http://jsr311.java.net/nonav/releases/1.1/spec/spec3.html#x3-370003.7.3 -func templateToRegularExpression(template string) (expression string, literalCount int, varCount int, tokens []string) { - var buffer bytes.Buffer - buffer.WriteString("^") - //tokens = strings.Split(template, "/") - tokens = tokenizePath(template) - for _, each := range tokens { - if each == "" { - continue - } - buffer.WriteString("/") - if strings.HasPrefix(each, "{") { - // check for regular expression in variable - colon := strings.Index(each, ":") - if colon != -1 { - // extract expression - paramExpr := strings.TrimSpace(each[colon+1 : len(each)-1]) - if paramExpr == "*" { // special case - buffer.WriteString("(.*)") - } else { - buffer.WriteString(fmt.Sprintf("(%s)", paramExpr)) // between colon and closing moustache - } - } else { - // plain var - buffer.WriteString("([^/]+?)") - } - varCount += 1 - } else { - literalCount += len(each) - encoded := each // TODO URI encode - buffer.WriteString(regexp.QuoteMeta(encoded)) - } - } - return strings.TrimRight(buffer.String(), "/") + "(/.*)?$", literalCount, varCount, tokens -} diff --git a/vendor/github.com/emicklei/go-restful/request.go b/vendor/github.com/emicklei/go-restful/request.go deleted file mode 100644 index 8c23af12..00000000 --- a/vendor/github.com/emicklei/go-restful/request.go +++ /dev/null @@ -1,113 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "compress/zlib" - "net/http" -) - -var defaultRequestContentType string - -// Request is a wrapper for a http Request that provides convenience methods -type Request struct { - Request *http.Request - pathParameters map[string]string - attributes map[string]interface{} // for storing request-scoped values - selectedRoutePath string // root path + route path that matched the request, e.g. /meetings/{id}/attendees -} - -func NewRequest(httpRequest *http.Request) *Request { - return &Request{ - Request: httpRequest, - pathParameters: map[string]string{}, - attributes: map[string]interface{}{}, - } // empty parameters, attributes -} - -// If ContentType is missing or */* is given then fall back to this type, otherwise -// a "Unable to unmarshal content of type:" response is returned. -// Valid values are restful.MIME_JSON and restful.MIME_XML -// Example: -// restful.DefaultRequestContentType(restful.MIME_JSON) -func DefaultRequestContentType(mime string) { - defaultRequestContentType = mime -} - -// PathParameter accesses the Path parameter value by its name -func (r *Request) PathParameter(name string) string { - return r.pathParameters[name] -} - -// PathParameters accesses the Path parameter values -func (r *Request) PathParameters() map[string]string { - return r.pathParameters -} - -// QueryParameter returns the (first) Query parameter value by its name -func (r *Request) QueryParameter(name string) string { - return r.Request.FormValue(name) -} - -// BodyParameter parses the body of the request (once for typically a POST or a PUT) and returns the value of the given name or an error. -func (r *Request) BodyParameter(name string) (string, error) { - err := r.Request.ParseForm() - if err != nil { - return "", err - } - return r.Request.PostFormValue(name), nil -} - -// HeaderParameter returns the HTTP Header value of a Header name or empty if missing -func (r *Request) HeaderParameter(name string) string { - return r.Request.Header.Get(name) -} - -// ReadEntity checks the Accept header and reads the content into the entityPointer. -func (r *Request) ReadEntity(entityPointer interface{}) (err error) { - contentType := r.Request.Header.Get(HEADER_ContentType) - contentEncoding := r.Request.Header.Get(HEADER_ContentEncoding) - - // check if the request body needs decompression - if ENCODING_GZIP == contentEncoding { - gzipReader := currentCompressorProvider.AcquireGzipReader() - defer currentCompressorProvider.ReleaseGzipReader(gzipReader) - gzipReader.Reset(r.Request.Body) - r.Request.Body = gzipReader - } else if ENCODING_DEFLATE == contentEncoding { - zlibReader, err := zlib.NewReader(r.Request.Body) - if err != nil { - return err - } - r.Request.Body = zlibReader - } - - // lookup the EntityReader, use defaultRequestContentType if needed and provided - entityReader, ok := entityAccessRegistry.accessorAt(contentType) - if !ok { - if len(defaultRequestContentType) != 0 { - entityReader, ok = entityAccessRegistry.accessorAt(defaultRequestContentType) - } - if !ok { - return NewError(http.StatusBadRequest, "Unable to unmarshal content of type:"+contentType) - } - } - return entityReader.Read(r, entityPointer) -} - -// SetAttribute adds or replaces the attribute with the given value. -func (r *Request) SetAttribute(name string, value interface{}) { - r.attributes[name] = value -} - -// Attribute returns the value associated to the given name. Returns nil if absent. -func (r Request) Attribute(name string) interface{} { - return r.attributes[name] -} - -// SelectedRoutePath root path + route path that matched the request, e.g. /meetings/{id}/attendees -func (r Request) SelectedRoutePath() string { - return r.selectedRoutePath -} diff --git a/vendor/github.com/emicklei/go-restful/response.go b/vendor/github.com/emicklei/go-restful/response.go deleted file mode 100644 index 3b33ab22..00000000 --- a/vendor/github.com/emicklei/go-restful/response.go +++ /dev/null @@ -1,236 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "errors" - "net/http" -) - -// DefaultResponseMimeType is DEPRECATED, use DefaultResponseContentType(mime) -var DefaultResponseMimeType string - -//PrettyPrintResponses controls the indentation feature of XML and JSON serialization -var PrettyPrintResponses = true - -// Response is a wrapper on the actual http ResponseWriter -// It provides several convenience methods to prepare and write response content. -type Response struct { - http.ResponseWriter - requestAccept string // mime-type what the Http Request says it wants to receive - routeProduces []string // mime-types what the Route says it can produce - statusCode int // HTTP status code that has been written explicity (if zero then net/http has written 200) - contentLength int // number of bytes written for the response body - prettyPrint bool // controls the indentation feature of XML and JSON serialization. It is initialized using var PrettyPrintResponses. - err error // err property is kept when WriteError is called -} - -// NewResponse creates a new response based on a http ResponseWriter. -func NewResponse(httpWriter http.ResponseWriter) *Response { - return &Response{httpWriter, "", []string{}, http.StatusOK, 0, PrettyPrintResponses, nil} // empty content-types -} - -// DefaultResponseContentType set a default. -// If Accept header matching fails, fall back to this type. -// Valid values are restful.MIME_JSON and restful.MIME_XML -// Example: -// restful.DefaultResponseContentType(restful.MIME_JSON) -func DefaultResponseContentType(mime string) { - DefaultResponseMimeType = mime -} - -// InternalServerError writes the StatusInternalServerError header. -// DEPRECATED, use WriteErrorString(http.StatusInternalServerError,reason) -func (r Response) InternalServerError() Response { - r.WriteHeader(http.StatusInternalServerError) - return r -} - -// PrettyPrint changes whether this response must produce pretty (line-by-line, indented) JSON or XML output. -func (r *Response) PrettyPrint(bePretty bool) { - r.prettyPrint = bePretty -} - -// AddHeader is a shortcut for .Header().Add(header,value) -func (r Response) AddHeader(header string, value string) Response { - r.Header().Add(header, value) - return r -} - -// SetRequestAccepts tells the response what Mime-type(s) the HTTP request said it wants to accept. Exposed for testing. -func (r *Response) SetRequestAccepts(mime string) { - r.requestAccept = mime -} - -// EntityWriter returns the registered EntityWriter that the entity (requested resource) -// can write according to what the request wants (Accept) and what the Route can produce or what the restful defaults say. -// If called before WriteEntity and WriteHeader then a false return value can be used to write a 406: Not Acceptable. -func (r *Response) EntityWriter() (EntityReaderWriter, bool) { - sorted := sortedMimes(r.requestAccept) - for _, eachAccept := range sorted { - for _, eachProduce := range r.routeProduces { - if eachProduce == eachAccept.media { - if w, ok := entityAccessRegistry.accessorAt(eachAccept.media); ok { - return w, true - } - } - } - if eachAccept.media == "*/*" { - for _, each := range r.routeProduces { - if w, ok := entityAccessRegistry.accessorAt(each); ok { - return w, true - } - } - } - } - // if requestAccept is empty - writer, ok := entityAccessRegistry.accessorAt(r.requestAccept) - if !ok { - // if not registered then fallback to the defaults (if set) - if DefaultResponseMimeType == MIME_JSON { - return entityAccessRegistry.accessorAt(MIME_JSON) - } - if DefaultResponseMimeType == MIME_XML { - return entityAccessRegistry.accessorAt(MIME_XML) - } - // Fallback to whatever the route says it can produce. - // https://www.w3.org/Protocols/rfc2616/rfc2616-sec14.html - for _, each := range r.routeProduces { - if w, ok := entityAccessRegistry.accessorAt(each); ok { - return w, true - } - } - if trace { - traceLogger.Printf("no registered EntityReaderWriter found for %s", r.requestAccept) - } - } - return writer, ok -} - -// WriteEntity calls WriteHeaderAndEntity with Http Status OK (200) -func (r *Response) WriteEntity(value interface{}) error { - return r.WriteHeaderAndEntity(http.StatusOK, value) -} - -// WriteHeaderAndEntity marshals the value using the representation denoted by the Accept Header and the registered EntityWriters. -// If no Accept header is specified (or */*) then respond with the Content-Type as specified by the first in the Route.Produces. -// If an Accept header is specified then respond with the Content-Type as specified by the first in the Route.Produces that is matched with the Accept header. -// If the value is nil then no response is send except for the Http status. You may want to call WriteHeader(http.StatusNotFound) instead. -// If there is no writer available that can represent the value in the requested MIME type then Http Status NotAcceptable is written. -// Current implementation ignores any q-parameters in the Accept Header. -// Returns an error if the value could not be written on the response. -func (r *Response) WriteHeaderAndEntity(status int, value interface{}) error { - writer, ok := r.EntityWriter() - if !ok { - r.WriteHeader(http.StatusNotAcceptable) - return nil - } - return writer.Write(r, status, value) -} - -// WriteAsXml is a convenience method for writing a value in xml (requires Xml tags on the value) -// It uses the standard encoding/xml package for marshalling the value ; not using a registered EntityReaderWriter. -func (r *Response) WriteAsXml(value interface{}) error { - return writeXML(r, http.StatusOK, MIME_XML, value) -} - -// WriteHeaderAndXml is a convenience method for writing a status and value in xml (requires Xml tags on the value) -// It uses the standard encoding/xml package for marshalling the value ; not using a registered EntityReaderWriter. -func (r *Response) WriteHeaderAndXml(status int, value interface{}) error { - return writeXML(r, status, MIME_XML, value) -} - -// WriteAsJson is a convenience method for writing a value in json. -// It uses the standard encoding/json package for marshalling the value ; not using a registered EntityReaderWriter. -func (r *Response) WriteAsJson(value interface{}) error { - return writeJSON(r, http.StatusOK, MIME_JSON, value) -} - -// WriteJson is a convenience method for writing a value in Json with a given Content-Type. -// It uses the standard encoding/json package for marshalling the value ; not using a registered EntityReaderWriter. -func (r *Response) WriteJson(value interface{}, contentType string) error { - return writeJSON(r, http.StatusOK, contentType, value) -} - -// WriteHeaderAndJson is a convenience method for writing the status and a value in Json with a given Content-Type. -// It uses the standard encoding/json package for marshalling the value ; not using a registered EntityReaderWriter. -func (r *Response) WriteHeaderAndJson(status int, value interface{}, contentType string) error { - return writeJSON(r, status, contentType, value) -} - -// WriteError write the http status and the error string on the response. -func (r *Response) WriteError(httpStatus int, err error) error { - r.err = err - return r.WriteErrorString(httpStatus, err.Error()) -} - -// WriteServiceError is a convenience method for a responding with a status and a ServiceError -func (r *Response) WriteServiceError(httpStatus int, err ServiceError) error { - r.err = err - return r.WriteHeaderAndEntity(httpStatus, err) -} - -// WriteErrorString is a convenience method for an error status with the actual error -func (r *Response) WriteErrorString(httpStatus int, errorReason string) error { - if r.err == nil { - // if not called from WriteError - r.err = errors.New(errorReason) - } - r.WriteHeader(httpStatus) - if _, err := r.Write([]byte(errorReason)); err != nil { - return err - } - return nil -} - -// Flush implements http.Flusher interface, which sends any buffered data to the client. -func (r *Response) Flush() { - if f, ok := r.ResponseWriter.(http.Flusher); ok { - f.Flush() - } else if trace { - traceLogger.Printf("ResponseWriter %v doesn't support Flush", r) - } -} - -// WriteHeader is overridden to remember the Status Code that has been written. -// Changes to the Header of the response have no effect after this. -func (r *Response) WriteHeader(httpStatus int) { - r.statusCode = httpStatus - r.ResponseWriter.WriteHeader(httpStatus) -} - -// StatusCode returns the code that has been written using WriteHeader. -func (r Response) StatusCode() int { - if 0 == r.statusCode { - // no status code has been written yet; assume OK - return http.StatusOK - } - return r.statusCode -} - -// Write writes the data to the connection as part of an HTTP reply. -// Write is part of http.ResponseWriter interface. -func (r *Response) Write(bytes []byte) (int, error) { - written, err := r.ResponseWriter.Write(bytes) - r.contentLength += written - return written, err -} - -// ContentLength returns the number of bytes written for the response content. -// Note that this value is only correct if all data is written through the Response using its Write* methods. -// Data written directly using the underlying http.ResponseWriter is not accounted for. -func (r Response) ContentLength() int { - return r.contentLength -} - -// CloseNotify is part of http.CloseNotifier interface -func (r Response) CloseNotify() <-chan bool { - return r.ResponseWriter.(http.CloseNotifier).CloseNotify() -} - -// Error returns the err created by WriteError -func (r Response) Error() error { - return r.err -} diff --git a/vendor/github.com/emicklei/go-restful/route.go b/vendor/github.com/emicklei/go-restful/route.go deleted file mode 100644 index 3dd520ee..00000000 --- a/vendor/github.com/emicklei/go-restful/route.go +++ /dev/null @@ -1,186 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "bytes" - "net/http" - "strings" -) - -// RouteFunction declares the signature of a function that can be bound to a Route. -type RouteFunction func(*Request, *Response) - -// Route binds a HTTP Method,Path,Consumes combination to a RouteFunction. -type Route struct { - Method string - Produces []string - Consumes []string - Path string // webservice root path + described path - Function RouteFunction - Filters []FilterFunction - - // cached values for dispatching - relativePath string - pathParts []string - pathExpr *pathExpression // cached compilation of relativePath as RegExp - - // documentation - Doc string - Notes string - Operation string - ParameterDocs []*Parameter - ResponseErrors map[int]ResponseError - ReadSample, WriteSample interface{} // structs that model an example request or response payload - - // Extra information used to store custom information about the route. - Metadata map[string]interface{} -} - -// Initialize for Route -func (r *Route) postBuild() { - r.pathParts = tokenizePath(r.Path) -} - -// Create Request and Response from their http versions -func (r *Route) wrapRequestResponse(httpWriter http.ResponseWriter, httpRequest *http.Request) (*Request, *Response) { - params := r.extractParameters(httpRequest.URL.Path) - wrappedRequest := NewRequest(httpRequest) - wrappedRequest.pathParameters = params - wrappedRequest.selectedRoutePath = r.Path - wrappedResponse := NewResponse(httpWriter) - wrappedResponse.requestAccept = httpRequest.Header.Get(HEADER_Accept) - wrappedResponse.routeProduces = r.Produces - return wrappedRequest, wrappedResponse -} - -// dispatchWithFilters call the function after passing through its own filters -func (r *Route) dispatchWithFilters(wrappedRequest *Request, wrappedResponse *Response) { - if len(r.Filters) > 0 { - chain := FilterChain{Filters: r.Filters, Target: r.Function} - chain.ProcessFilter(wrappedRequest, wrappedResponse) - } else { - // unfiltered - r.Function(wrappedRequest, wrappedResponse) - } -} - -// Return whether the mimeType matches to what this Route can produce. -func (r Route) matchesAccept(mimeTypesWithQuality string) bool { - parts := strings.Split(mimeTypesWithQuality, ",") - for _, each := range parts { - var withoutQuality string - if strings.Contains(each, ";") { - withoutQuality = strings.Split(each, ";")[0] - } else { - withoutQuality = each - } - // trim before compare - withoutQuality = strings.Trim(withoutQuality, " ") - if withoutQuality == "*/*" { - return true - } - for _, producibleType := range r.Produces { - if producibleType == "*/*" || producibleType == withoutQuality { - return true - } - } - } - return false -} - -// Return whether this Route can consume content with a type specified by mimeTypes (can be empty). -func (r Route) matchesContentType(mimeTypes string) bool { - - if len(r.Consumes) == 0 { - // did not specify what it can consume ; any media type (“*/*”) is assumed - return true - } - - if len(mimeTypes) == 0 { - // idempotent methods with (most-likely or garanteed) empty content match missing Content-Type - m := r.Method - if m == "GET" || m == "HEAD" || m == "OPTIONS" || m == "DELETE" || m == "TRACE" { - return true - } - // proceed with default - mimeTypes = MIME_OCTET - } - - parts := strings.Split(mimeTypes, ",") - for _, each := range parts { - var contentType string - if strings.Contains(each, ";") { - contentType = strings.Split(each, ";")[0] - } else { - contentType = each - } - // trim before compare - contentType = strings.Trim(contentType, " ") - for _, consumeableType := range r.Consumes { - if consumeableType == "*/*" || consumeableType == contentType { - return true - } - } - } - return false -} - -// Extract the parameters from the request url path -func (r Route) extractParameters(urlPath string) map[string]string { - urlParts := tokenizePath(urlPath) - pathParameters := map[string]string{} - for i, key := range r.pathParts { - var value string - if i >= len(urlParts) { - value = "" - } else { - value = urlParts[i] - } - if strings.HasPrefix(key, "{") { // path-parameter - if colon := strings.Index(key, ":"); colon != -1 { - // extract by regex - regPart := key[colon+1 : len(key)-1] - keyPart := key[1:colon] - if regPart == "*" { - pathParameters[keyPart] = untokenizePath(i, urlParts) - break - } else { - pathParameters[keyPart] = value - } - } else { - // without enclosing {} - pathParameters[key[1:len(key)-1]] = value - } - } - } - return pathParameters -} - -// Untokenize back into an URL path using the slash separator -func untokenizePath(offset int, parts []string) string { - var buffer bytes.Buffer - for p := offset; p < len(parts); p++ { - buffer.WriteString(parts[p]) - // do not end - if p < len(parts)-1 { - buffer.WriteString("/") - } - } - return buffer.String() -} - -// Tokenize an URL path using the slash separator ; the result does not have empty tokens -func tokenizePath(path string) []string { - if "/" == path { - return []string{} - } - return strings.Split(strings.Trim(path, "/"), "/") -} - -// for debugging -func (r Route) String() string { - return r.Method + " " + r.Path -} diff --git a/vendor/github.com/emicklei/go-restful/route_builder.go b/vendor/github.com/emicklei/go-restful/route_builder.go deleted file mode 100644 index 5ad4a3a7..00000000 --- a/vendor/github.com/emicklei/go-restful/route_builder.go +++ /dev/null @@ -1,293 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "fmt" - "os" - "reflect" - "runtime" - "strings" - "sync/atomic" - - "github.com/emicklei/go-restful/log" -) - -// RouteBuilder is a helper to construct Routes. -type RouteBuilder struct { - rootPath string - currentPath string - produces []string - consumes []string - httpMethod string // required - function RouteFunction // required - filters []FilterFunction - - typeNameHandleFunc TypeNameHandleFunction // required - - // documentation - doc string - notes string - operation string - readSample, writeSample interface{} - parameters []*Parameter - errorMap map[int]ResponseError - metadata map[string]interface{} -} - -// Do evaluates each argument with the RouteBuilder itself. -// This allows you to follow DRY principles without breaking the fluent programming style. -// Example: -// ws.Route(ws.DELETE("/{name}").To(t.deletePerson).Do(Returns200, Returns500)) -// -// func Returns500(b *RouteBuilder) { -// b.Returns(500, "Internal Server Error", restful.ServiceError{}) -// } -func (b *RouteBuilder) Do(oneArgBlocks ...func(*RouteBuilder)) *RouteBuilder { - for _, each := range oneArgBlocks { - each(b) - } - return b -} - -// To bind the route to a function. -// If this route is matched with the incoming Http Request then call this function with the *Request,*Response pair. Required. -func (b *RouteBuilder) To(function RouteFunction) *RouteBuilder { - b.function = function - return b -} - -// Method specifies what HTTP method to match. Required. -func (b *RouteBuilder) Method(method string) *RouteBuilder { - b.httpMethod = method - return b -} - -// Produces specifies what MIME types can be produced ; the matched one will appear in the Content-Type Http header. -func (b *RouteBuilder) Produces(mimeTypes ...string) *RouteBuilder { - b.produces = mimeTypes - return b -} - -// Consumes specifies what MIME types can be consumes ; the Accept Http header must matched any of these -func (b *RouteBuilder) Consumes(mimeTypes ...string) *RouteBuilder { - b.consumes = mimeTypes - return b -} - -// Path specifies the relative (w.r.t WebService root path) URL path to match. Default is "/". -func (b *RouteBuilder) Path(subPath string) *RouteBuilder { - b.currentPath = subPath - return b -} - -// Doc tells what this route is all about. Optional. -func (b *RouteBuilder) Doc(documentation string) *RouteBuilder { - b.doc = documentation - return b -} - -// A verbose explanation of the operation behavior. Optional. -func (b *RouteBuilder) Notes(notes string) *RouteBuilder { - b.notes = notes - return b -} - -// Reads tells what resource type will be read from the request payload. Optional. -// A parameter of type "body" is added ,required is set to true and the dataType is set to the qualified name of the sample's type. -func (b *RouteBuilder) Reads(sample interface{}) *RouteBuilder { - fn := b.typeNameHandleFunc - if fn == nil { - fn = reflectTypeName - } - typeAsName := fn(sample) - - b.readSample = sample - bodyParameter := &Parameter{&ParameterData{Name: "body"}} - bodyParameter.beBody() - bodyParameter.Required(true) - bodyParameter.DataType(typeAsName) - b.Param(bodyParameter) - return b -} - -// ParameterNamed returns a Parameter already known to the RouteBuilder. Returns nil if not. -// Use this to modify or extend information for the Parameter (through its Data()). -func (b RouteBuilder) ParameterNamed(name string) (p *Parameter) { - for _, each := range b.parameters { - if each.Data().Name == name { - return each - } - } - return p -} - -// Writes tells what resource type will be written as the response payload. Optional. -func (b *RouteBuilder) Writes(sample interface{}) *RouteBuilder { - b.writeSample = sample - return b -} - -// Param allows you to document the parameters of the Route. It adds a new Parameter (does not check for duplicates). -func (b *RouteBuilder) Param(parameter *Parameter) *RouteBuilder { - if b.parameters == nil { - b.parameters = []*Parameter{} - } - b.parameters = append(b.parameters, parameter) - return b -} - -// Operation allows you to document what the actual method/function call is of the Route. -// Unless called, the operation name is derived from the RouteFunction set using To(..). -func (b *RouteBuilder) Operation(name string) *RouteBuilder { - b.operation = name - return b -} - -// ReturnsError is deprecated, use Returns instead. -func (b *RouteBuilder) ReturnsError(code int, message string, model interface{}) *RouteBuilder { - log.Print("ReturnsError is deprecated, use Returns instead.") - return b.Returns(code, message, model) -} - -// Returns allows you to document what responses (errors or regular) can be expected. -// The model parameter is optional ; either pass a struct instance or use nil if not applicable. -func (b *RouteBuilder) Returns(code int, message string, model interface{}) *RouteBuilder { - err := ResponseError{ - Code: code, - Message: message, - Model: model, - IsDefault: false, - } - // lazy init because there is no NewRouteBuilder (yet) - if b.errorMap == nil { - b.errorMap = map[int]ResponseError{} - } - b.errorMap[code] = err - return b -} - -// DefaultReturns is a special Returns call that sets the default of the response ; the code is zero. -func (b *RouteBuilder) DefaultReturns(message string, model interface{}) *RouteBuilder { - b.Returns(0, message, model) - // Modify the ResponseError just added/updated - re := b.errorMap[0] - // errorMap is initialized - b.errorMap[0] = ResponseError{ - Code: re.Code, - Message: re.Message, - Model: re.Model, - IsDefault: true, - } - return b -} - -// Metadata adds or updates a key=value pair to the metadata map. -func (b *RouteBuilder) Metadata(key string, value interface{}) *RouteBuilder { - if b.metadata == nil { - b.metadata = map[string]interface{}{} - } - b.metadata[key] = value - return b -} - -// ResponseError represents a response; not necessarily an error. -type ResponseError struct { - Code int - Message string - Model interface{} - IsDefault bool -} - -func (b *RouteBuilder) servicePath(path string) *RouteBuilder { - b.rootPath = path - return b -} - -// Filter appends a FilterFunction to the end of filters for this Route to build. -func (b *RouteBuilder) Filter(filter FilterFunction) *RouteBuilder { - b.filters = append(b.filters, filter) - return b -} - -// If no specific Route path then set to rootPath -// If no specific Produces then set to rootProduces -// If no specific Consumes then set to rootConsumes -func (b *RouteBuilder) copyDefaults(rootProduces, rootConsumes []string) { - if len(b.produces) == 0 { - b.produces = rootProduces - } - if len(b.consumes) == 0 { - b.consumes = rootConsumes - } -} - -// typeNameHandler sets the function that will convert types to strings in the parameter -// and model definitions. -func (b *RouteBuilder) typeNameHandler(handler TypeNameHandleFunction) *RouteBuilder { - b.typeNameHandleFunc = handler - return b -} - -// Build creates a new Route using the specification details collected by the RouteBuilder -func (b *RouteBuilder) Build() Route { - pathExpr, err := newPathExpression(b.currentPath) - if err != nil { - log.Printf("[restful] Invalid path:%s because:%v", b.currentPath, err) - os.Exit(1) - } - if b.function == nil { - log.Printf("[restful] No function specified for route:" + b.currentPath) - os.Exit(1) - } - operationName := b.operation - if len(operationName) == 0 && b.function != nil { - // extract from definition - operationName = nameOfFunction(b.function) - } - route := Route{ - Method: b.httpMethod, - Path: concatPath(b.rootPath, b.currentPath), - Produces: b.produces, - Consumes: b.consumes, - Function: b.function, - Filters: b.filters, - relativePath: b.currentPath, - pathExpr: pathExpr, - Doc: b.doc, - Notes: b.notes, - Operation: operationName, - ParameterDocs: b.parameters, - ResponseErrors: b.errorMap, - ReadSample: b.readSample, - WriteSample: b.writeSample, - Metadata: b.metadata} - route.postBuild() - return route -} - -func concatPath(path1, path2 string) string { - return strings.TrimRight(path1, "/") + "/" + strings.TrimLeft(path2, "/") -} - -var anonymousFuncCount int32 - -// nameOfFunction returns the short name of the function f for documentation. -// It uses a runtime feature for debugging ; its value may change for later Go versions. -func nameOfFunction(f interface{}) string { - fun := runtime.FuncForPC(reflect.ValueOf(f).Pointer()) - tokenized := strings.Split(fun.Name(), ".") - last := tokenized[len(tokenized)-1] - last = strings.TrimSuffix(last, ")·fm") // < Go 1.5 - last = strings.TrimSuffix(last, ")-fm") // Go 1.5 - last = strings.TrimSuffix(last, "·fm") // < Go 1.5 - last = strings.TrimSuffix(last, "-fm") // Go 1.5 - if last == "func1" { // this could mean conflicts in API docs - val := atomic.AddInt32(&anonymousFuncCount, 1) - last = "func" + fmt.Sprintf("%d", val) - atomic.StoreInt32(&anonymousFuncCount, val) - } - return last -} diff --git a/vendor/github.com/emicklei/go-restful/router.go b/vendor/github.com/emicklei/go-restful/router.go deleted file mode 100644 index 9b32fb67..00000000 --- a/vendor/github.com/emicklei/go-restful/router.go +++ /dev/null @@ -1,18 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import "net/http" - -// A RouteSelector finds the best matching Route given the input HTTP Request -type RouteSelector interface { - - // SelectRoute finds a Route given the input HTTP Request and a list of WebServices. - // It returns a selected Route and its containing WebService or an error indicating - // a problem. - SelectRoute( - webServices []*WebService, - httpRequest *http.Request) (selectedService *WebService, selected *Route, err error) -} diff --git a/vendor/github.com/emicklei/go-restful/service_error.go b/vendor/github.com/emicklei/go-restful/service_error.go deleted file mode 100644 index 62d1108b..00000000 --- a/vendor/github.com/emicklei/go-restful/service_error.go +++ /dev/null @@ -1,23 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import "fmt" - -// ServiceError is a transport object to pass information about a non-Http error occurred in a WebService while processing a request. -type ServiceError struct { - Code int - Message string -} - -// NewError returns a ServiceError using the code and reason -func NewError(code int, message string) ServiceError { - return ServiceError{Code: code, Message: message} -} - -// Error returns a text representation of the service error -func (s ServiceError) Error() string { - return fmt.Sprintf("[ServiceError:%v] %v", s.Code, s.Message) -} diff --git a/vendor/github.com/emicklei/go-restful/web_service.go b/vendor/github.com/emicklei/go-restful/web_service.go deleted file mode 100644 index 7af60233..00000000 --- a/vendor/github.com/emicklei/go-restful/web_service.go +++ /dev/null @@ -1,290 +0,0 @@ -package restful - -import ( - "errors" - "os" - "reflect" - "sync" - - "github.com/emicklei/go-restful/log" -) - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -// WebService holds a collection of Route values that bind a Http Method + URL Path to a function. -type WebService struct { - rootPath string - pathExpr *pathExpression // cached compilation of rootPath as RegExp - routes []Route - produces []string - consumes []string - pathParameters []*Parameter - filters []FilterFunction - documentation string - apiVersion string - - typeNameHandleFunc TypeNameHandleFunction - - dynamicRoutes bool - - // protects 'routes' if dynamic routes are enabled - routesLock sync.RWMutex -} - -func (w *WebService) SetDynamicRoutes(enable bool) { - w.dynamicRoutes = enable -} - -// TypeNameHandleFunction declares functions that can handle translating the name of a sample object -// into the restful documentation for the service. -type TypeNameHandleFunction func(sample interface{}) string - -// TypeNameHandler sets the function that will convert types to strings in the parameter -// and model definitions. If not set, the web service will invoke -// reflect.TypeOf(object).String(). -func (w *WebService) TypeNameHandler(handler TypeNameHandleFunction) *WebService { - w.typeNameHandleFunc = handler - return w -} - -// reflectTypeName is the default TypeNameHandleFunction and for a given object -// returns the name that Go identifies it with (e.g. "string" or "v1.Object") via -// the reflection API. -func reflectTypeName(sample interface{}) string { - return reflect.TypeOf(sample).String() -} - -// compilePathExpression ensures that the path is compiled into a RegEx for those routers that need it. -func (w *WebService) compilePathExpression() { - compiled, err := newPathExpression(w.rootPath) - if err != nil { - log.Printf("[restful] invalid path:%s because:%v", w.rootPath, err) - os.Exit(1) - } - w.pathExpr = compiled -} - -// ApiVersion sets the API version for documentation purposes. -func (w *WebService) ApiVersion(apiVersion string) *WebService { - w.apiVersion = apiVersion - return w -} - -// Version returns the API version for documentation purposes. -func (w *WebService) Version() string { return w.apiVersion } - -// Path specifies the root URL template path of the WebService. -// All Routes will be relative to this path. -func (w *WebService) Path(root string) *WebService { - w.rootPath = root - if len(w.rootPath) == 0 { - w.rootPath = "/" - } - w.compilePathExpression() - return w -} - -// Param adds a PathParameter to document parameters used in the root path. -func (w *WebService) Param(parameter *Parameter) *WebService { - if w.pathParameters == nil { - w.pathParameters = []*Parameter{} - } - w.pathParameters = append(w.pathParameters, parameter) - return w -} - -// PathParameter creates a new Parameter of kind Path for documentation purposes. -// It is initialized as required with string as its DataType. -func (w *WebService) PathParameter(name, description string) *Parameter { - return PathParameter(name, description) -} - -// PathParameter creates a new Parameter of kind Path for documentation purposes. -// It is initialized as required with string as its DataType. -func PathParameter(name, description string) *Parameter { - p := &Parameter{&ParameterData{Name: name, Description: description, Required: true, DataType: "string"}} - p.bePath() - return p -} - -// QueryParameter creates a new Parameter of kind Query for documentation purposes. -// It is initialized as not required with string as its DataType. -func (w *WebService) QueryParameter(name, description string) *Parameter { - return QueryParameter(name, description) -} - -// QueryParameter creates a new Parameter of kind Query for documentation purposes. -// It is initialized as not required with string as its DataType. -func QueryParameter(name, description string) *Parameter { - p := &Parameter{&ParameterData{Name: name, Description: description, Required: false, DataType: "string"}} - p.beQuery() - return p -} - -// BodyParameter creates a new Parameter of kind Body for documentation purposes. -// It is initialized as required without a DataType. -func (w *WebService) BodyParameter(name, description string) *Parameter { - return BodyParameter(name, description) -} - -// BodyParameter creates a new Parameter of kind Body for documentation purposes. -// It is initialized as required without a DataType. -func BodyParameter(name, description string) *Parameter { - p := &Parameter{&ParameterData{Name: name, Description: description, Required: true}} - p.beBody() - return p -} - -// HeaderParameter creates a new Parameter of kind (Http) Header for documentation purposes. -// It is initialized as not required with string as its DataType. -func (w *WebService) HeaderParameter(name, description string) *Parameter { - return HeaderParameter(name, description) -} - -// HeaderParameter creates a new Parameter of kind (Http) Header for documentation purposes. -// It is initialized as not required with string as its DataType. -func HeaderParameter(name, description string) *Parameter { - p := &Parameter{&ParameterData{Name: name, Description: description, Required: false, DataType: "string"}} - p.beHeader() - return p -} - -// FormParameter creates a new Parameter of kind Form (using application/x-www-form-urlencoded) for documentation purposes. -// It is initialized as required with string as its DataType. -func (w *WebService) FormParameter(name, description string) *Parameter { - return FormParameter(name, description) -} - -// FormParameter creates a new Parameter of kind Form (using application/x-www-form-urlencoded) for documentation purposes. -// It is initialized as required with string as its DataType. -func FormParameter(name, description string) *Parameter { - p := &Parameter{&ParameterData{Name: name, Description: description, Required: false, DataType: "string"}} - p.beForm() - return p -} - -// Route creates a new Route using the RouteBuilder and add to the ordered list of Routes. -func (w *WebService) Route(builder *RouteBuilder) *WebService { - w.routesLock.Lock() - defer w.routesLock.Unlock() - builder.copyDefaults(w.produces, w.consumes) - w.routes = append(w.routes, builder.Build()) - return w -} - -// RemoveRoute removes the specified route, looks for something that matches 'path' and 'method' -func (w *WebService) RemoveRoute(path, method string) error { - if !w.dynamicRoutes { - return errors.New("dynamic routes are not enabled.") - } - w.routesLock.Lock() - defer w.routesLock.Unlock() - newRoutes := make([]Route, (len(w.routes) - 1)) - current := 0 - for ix := range w.routes { - if w.routes[ix].Method == method && w.routes[ix].Path == path { - continue - } - newRoutes[current] = w.routes[ix] - current = current + 1 - } - w.routes = newRoutes - return nil -} - -// Method creates a new RouteBuilder and initialize its http method -func (w *WebService) Method(httpMethod string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method(httpMethod) -} - -// Produces specifies that this WebService can produce one or more MIME types. -// Http requests must have one of these values set for the Accept header. -func (w *WebService) Produces(contentTypes ...string) *WebService { - w.produces = contentTypes - return w -} - -// Consumes specifies that this WebService can consume one or more MIME types. -// Http requests must have one of these values set for the Content-Type header. -func (w *WebService) Consumes(accepts ...string) *WebService { - w.consumes = accepts - return w -} - -// Routes returns the Routes associated with this WebService -func (w *WebService) Routes() []Route { - if !w.dynamicRoutes { - return w.routes - } - // Make a copy of the array to prevent concurrency problems - w.routesLock.RLock() - defer w.routesLock.RUnlock() - result := make([]Route, len(w.routes)) - for ix := range w.routes { - result[ix] = w.routes[ix] - } - return result -} - -// RootPath returns the RootPath associated with this WebService. Default "/" -func (w *WebService) RootPath() string { - return w.rootPath -} - -// PathParameters return the path parameter names for (shared amoung its Routes) -func (w *WebService) PathParameters() []*Parameter { - return w.pathParameters -} - -// Filter adds a filter function to the chain of filters applicable to all its Routes -func (w *WebService) Filter(filter FilterFunction) *WebService { - w.filters = append(w.filters, filter) - return w -} - -// Doc is used to set the documentation of this service. -func (w *WebService) Doc(plainText string) *WebService { - w.documentation = plainText - return w -} - -// Documentation returns it. -func (w *WebService) Documentation() string { - return w.documentation -} - -/* - Convenience methods -*/ - -// HEAD is a shortcut for .Method("HEAD").Path(subPath) -func (w *WebService) HEAD(subPath string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method("HEAD").Path(subPath) -} - -// GET is a shortcut for .Method("GET").Path(subPath) -func (w *WebService) GET(subPath string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method("GET").Path(subPath) -} - -// POST is a shortcut for .Method("POST").Path(subPath) -func (w *WebService) POST(subPath string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method("POST").Path(subPath) -} - -// PUT is a shortcut for .Method("PUT").Path(subPath) -func (w *WebService) PUT(subPath string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method("PUT").Path(subPath) -} - -// PATCH is a shortcut for .Method("PATCH").Path(subPath) -func (w *WebService) PATCH(subPath string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method("PATCH").Path(subPath) -} - -// DELETE is a shortcut for .Method("DELETE").Path(subPath) -func (w *WebService) DELETE(subPath string) *RouteBuilder { - return new(RouteBuilder).typeNameHandler(w.typeNameHandleFunc).servicePath(w.rootPath).Method("DELETE").Path(subPath) -} diff --git a/vendor/github.com/emicklei/go-restful/web_service_container.go b/vendor/github.com/emicklei/go-restful/web_service_container.go deleted file mode 100644 index c9d31b06..00000000 --- a/vendor/github.com/emicklei/go-restful/web_service_container.go +++ /dev/null @@ -1,39 +0,0 @@ -package restful - -// Copyright 2013 Ernest Micklei. All rights reserved. -// Use of this source code is governed by a license -// that can be found in the LICENSE file. - -import ( - "net/http" -) - -// DefaultContainer is a restful.Container that uses http.DefaultServeMux -var DefaultContainer *Container - -func init() { - DefaultContainer = NewContainer() - DefaultContainer.ServeMux = http.DefaultServeMux -} - -// If set the true then panics will not be caught to return HTTP 500. -// In that case, Route functions are responsible for handling any error situation. -// Default value is false = recover from panics. This has performance implications. -// OBSOLETE ; use restful.DefaultContainer.DoNotRecover(true) -var DoNotRecover = false - -// Add registers a new WebService add it to the DefaultContainer. -func Add(service *WebService) { - DefaultContainer.Add(service) -} - -// Filter appends a container FilterFunction from the DefaultContainer. -// These are called before dispatching a http.Request to a WebService. -func Filter(filter FilterFunction) { - DefaultContainer.Filter(filter) -} - -// RegisteredWebServices returns the collections of WebServices from the DefaultContainer -func RegisteredWebServices() []*WebService { - return DefaultContainer.RegisteredWebServices() -} diff --git a/vendor/github.com/go-openapi/jsonpointer/.drone.sec b/vendor/github.com/go-openapi/jsonpointer/.drone.sec deleted file mode 100644 index a1d7bbe0..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/.drone.sec +++ /dev/null @@ -1 +0,0 @@ -eyJhbGciOiJSU0EtT0FFUCIsImVuYyI6IkExMjhHQ00ifQ.pDqezepze0YqRx4u6M8GFaWtnVR-utTWZic-GX-RvMATAoYpG4H2sc9tlnGNCxa44dbRY0vY10qfBU7Sno8vkp21fsK42ofGLfen_suum_0ilm0sFS0X-kAwk7TIq5L5lPPKiChPMUiGp5oJW-g5MqMFX1jNiI-4fP-vSM3B3-eyZtJD_O517TgfIRLnblCzqwIkyRmAfPNopi-Fe8Y31TmO2Vd0nFc1Aqro_VaJSACzEVxOHTNpjETcMjlYzwgMXLeiAfLV-5hM0f6DXgHMlLSuMkB_Ndnw25dkB7hreGk4x0tHQ3X9mUfTgLq1hIDoyeeKDIM83Tqw4LBRph20BQ.qd_pNuyi23B0PlWz.JtpO7kqOm0SWOGzWDalkWheHuNd-eDpVbqI9WPAEFDOIBvz7TbsYMBlIYVWEGWbat4mkx_ejxnMn1L1l996NJnyP7eY-QE82cfPJbjx94d0Ob70KZ4DCm_UxcY2t-OKFiPJqxW7MA5jKyDuGD16bdxpjLEoe_cMSEr8FNu-MVG6wcchPcyYyRkqTQSl4mb09KikkAzHjwjo-DcO0f8ps4Uzsoc0aqAAWdE-ocG0YqierLoemjusYMiLH-eLF6MvaLRvHSte-cLzPuYCeZURnBDgxu3i3UApgddnX7g1c7tdGGBGvgCl-tEEDW58Vxgdjksim2S7y3lfoJ8FFzSWeRH2y7Kq04hgew3b2J_RiDB9ejzIopzG8ZGjJa3EO1-i9ORTl12nXK1RdlLGqu604ENaeVOPCIHL-0C8e6_wHdUGHydLZImSxKYSrNvy8resP1D_9t4B-3q2mkS9mhnMONrXbPDVw5QY5mvXlWs0Db99ARwzsl-Qlu0A_tsZwMjWT2I1QMvWPyTRScmMm0FJSv9zStjzxWa_q2GL7Naz1fI4Dd6ZgNJWYYq-mHN5chEeBdIcwb_zMPHczMQXXNL5nmfRGM1aPffkToFWCDpIlI8IXec83ZC6_POxZegS6n9Drrvc.6Nz8EXxs1lWX3ASaCeNElA \ No newline at end of file diff --git a/vendor/github.com/go-openapi/jsonpointer/.drone.yml b/vendor/github.com/go-openapi/jsonpointer/.drone.yml deleted file mode 100644 index cb8c7b50..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/.drone.yml +++ /dev/null @@ -1,32 +0,0 @@ -clone: - path: github.com/go-openapi/jsonpointer - -matrix: - GO_VERSION: - - "1.6" - -build: - integration: - image: golang:$$GO_VERSION - pull: true - commands: - - go get -u github.com/stretchr/testify/assert - - go get -u github.com/go-openapi/swag - - go test -race - - go test -v -cover -coverprofile=coverage.out -covermode=count ./... - -notify: - slack: - channel: bots - webhook_url: $$SLACK_URL - username: drone - -publish: - coverage: - server: https://coverage.vmware.run - token: $$GITHUB_TOKEN - # threshold: 70 - # must_increase: true - when: - matrix: - GO_VERSION: "1.6" diff --git a/vendor/github.com/go-openapi/jsonpointer/.gitignore b/vendor/github.com/go-openapi/jsonpointer/.gitignore deleted file mode 100644 index 769c2440..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/.gitignore +++ /dev/null @@ -1 +0,0 @@ -secrets.yml diff --git a/vendor/github.com/go-openapi/jsonpointer/.pullapprove.yml b/vendor/github.com/go-openapi/jsonpointer/.pullapprove.yml deleted file mode 100644 index 5ec183e2..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/.pullapprove.yml +++ /dev/null @@ -1,13 +0,0 @@ -approve_by_comment: true -approve_regex: '^(:shipit:|:\+1:|\+1|LGTM|lgtm|Approved)' -reject_regex: ^[Rr]ejected -reset_on_push: false -reviewers: - members: - - casualjim - - chancez - - frapposelli - - vburenin - - pytlesk4 - name: pullapprove - required: 1 diff --git a/vendor/github.com/go-openapi/jsonpointer/CODE_OF_CONDUCT.md b/vendor/github.com/go-openapi/jsonpointer/CODE_OF_CONDUCT.md deleted file mode 100644 index 9322b065..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/CODE_OF_CONDUCT.md +++ /dev/null @@ -1,74 +0,0 @@ -# Contributor Covenant Code of Conduct - -## Our Pledge - -In the interest of fostering an open and welcoming environment, we as -contributors and maintainers pledge to making participation in our project and -our community a harassment-free experience for everyone, regardless of age, body -size, disability, ethnicity, gender identity and expression, level of experience, -nationality, personal appearance, race, religion, or sexual identity and -orientation. - -## Our Standards - -Examples of behavior that contributes to creating a positive environment -include: - -* Using welcoming and inclusive language -* Being respectful of differing viewpoints and experiences -* Gracefully accepting constructive criticism -* Focusing on what is best for the community -* Showing empathy towards other community members - -Examples of unacceptable behavior by participants include: - -* The use of sexualized language or imagery and unwelcome sexual attention or -advances -* Trolling, insulting/derogatory comments, and personal or political attacks -* Public or private harassment -* Publishing others' private information, such as a physical or electronic - address, without explicit permission -* Other conduct which could reasonably be considered inappropriate in a - professional setting - -## Our Responsibilities - -Project maintainers are responsible for clarifying the standards of acceptable -behavior and are expected to take appropriate and fair corrective action in -response to any instances of unacceptable behavior. - -Project maintainers have the right and responsibility to remove, edit, or -reject comments, commits, code, wiki edits, issues, and other contributions -that are not aligned to this Code of Conduct, or to ban temporarily or -permanently any contributor for other behaviors that they deem inappropriate, -threatening, offensive, or harmful. - -## Scope - -This Code of Conduct applies both within project spaces and in public spaces -when an individual is representing the project or its community. Examples of -representing a project or community include using an official project e-mail -address, posting via an official social media account, or acting as an appointed -representative at an online or offline event. Representation of a project may be -further defined and clarified by project maintainers. - -## Enforcement - -Instances of abusive, harassing, or otherwise unacceptable behavior may be -reported by contacting the project team at ivan+abuse@flanders.co.nz. All -complaints will be reviewed and investigated and will result in a response that -is deemed necessary and appropriate to the circumstances. The project team is -obligated to maintain confidentiality with regard to the reporter of an incident. -Further details of specific enforcement policies may be posted separately. - -Project maintainers who do not follow or enforce the Code of Conduct in good -faith may face temporary or permanent repercussions as determined by other -members of the project's leadership. - -## Attribution - -This Code of Conduct is adapted from the [Contributor Covenant][homepage], version 1.4, -available at [http://contributor-covenant.org/version/1/4][version] - -[homepage]: http://contributor-covenant.org -[version]: http://contributor-covenant.org/version/1/4/ diff --git a/vendor/github.com/go-openapi/jsonpointer/LICENSE b/vendor/github.com/go-openapi/jsonpointer/LICENSE deleted file mode 100644 index d6456956..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/LICENSE +++ /dev/null @@ -1,202 +0,0 @@ - - Apache License - Version 2.0, January 2004 - http://www.apache.org/licenses/ - - TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION - - 1. Definitions. - - "License" shall mean the terms and conditions for use, reproduction, - and distribution as defined by Sections 1 through 9 of this document. - - "Licensor" shall mean the copyright owner or entity authorized by - the copyright owner that is granting the License. - - "Legal Entity" shall mean the union of the acting entity and all - other entities that control, are controlled by, or are under common - control with that entity. For the purposes of this definition, - "control" means (i) the power, direct or indirect, to cause the - direction or management of such entity, whether by contract or - otherwise, or (ii) ownership of fifty percent (50%) or more of the - outstanding shares, or (iii) beneficial ownership of such entity. - - "You" (or "Your") shall mean an individual or Legal Entity - exercising permissions granted by this License. - - "Source" form shall mean the preferred form for making modifications, - including but not limited to software source code, documentation - source, and configuration files. - - "Object" form shall mean any form resulting from mechanical - transformation or translation of a Source form, including but - not limited to compiled object code, generated documentation, - and conversions to other media types. - - "Work" shall mean the work of authorship, whether in Source or - Object form, made available under the License, as indicated by a - copyright notice that is included in or attached to the work - (an example is provided in the Appendix below). - - "Derivative Works" shall mean any work, whether in Source or Object - form, that is based on (or derived from) the Work and for which the - editorial revisions, annotations, elaborations, or other modifications - represent, as a whole, an original work of authorship. For the purposes - of this License, Derivative Works shall not include works that remain - separable from, or merely link (or bind by name) to the interfaces of, - the Work and Derivative Works thereof. - - "Contribution" shall mean any work of authorship, including - the original version of the Work and any modifications or additions - to that Work or Derivative Works thereof, that is intentionally - submitted to Licensor for inclusion in the Work by the copyright owner - or by an individual or Legal Entity authorized to submit on behalf of - the copyright owner. For the purposes of this definition, "submitted" - means any form of electronic, verbal, or written communication sent - to the Licensor or its representatives, including but not limited to - communication on electronic mailing lists, source code control systems, - and issue tracking systems that are managed by, or on behalf of, the - Licensor for the purpose of discussing and improving the Work, but - excluding communication that is conspicuously marked or otherwise - designated in writing by the copyright owner as "Not a Contribution." - - "Contributor" shall mean Licensor and any individual or Legal Entity - on behalf of whom a Contribution has been received by Licensor and - subsequently incorporated within the Work. - - 2. Grant of Copyright License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - copyright license to reproduce, prepare Derivative Works of, - publicly display, publicly perform, sublicense, and distribute the - Work and such Derivative Works in Source or Object form. - - 3. Grant of Patent License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - (except as stated in this section) patent license to make, have made, - use, offer to sell, sell, import, and otherwise transfer the Work, - where such license applies only to those patent claims licensable - by such Contributor that are necessarily infringed by their - Contribution(s) alone or by combination of their Contribution(s) - with the Work to which such Contribution(s) was submitted. If You - institute patent litigation against any entity (including a - cross-claim or counterclaim in a lawsuit) alleging that the Work - or a Contribution incorporated within the Work constitutes direct - or contributory patent infringement, then any patent licenses - granted to You under this License for that Work shall terminate - as of the date such litigation is filed. - - 4. Redistribution. You may reproduce and distribute copies of the - Work or Derivative Works thereof in any medium, with or without - modifications, and in Source or Object form, provided that You - meet the following conditions: - - (a) You must give any other recipients of the Work or - Derivative Works a copy of this License; and - - (b) You must cause any modified files to carry prominent notices - stating that You changed the files; and - - (c) You must retain, in the Source form of any Derivative Works - that You distribute, all copyright, patent, trademark, and - attribution notices from the Source form of the Work, - excluding those notices that do not pertain to any part of - the Derivative Works; and - - (d) If the Work includes a "NOTICE" text file as part of its - distribution, then any Derivative Works that You distribute must - include a readable copy of the attribution notices contained - within such NOTICE file, excluding those notices that do not - pertain to any part of the Derivative Works, in at least one - of the following places: within a NOTICE text file distributed - as part of the Derivative Works; within the Source form or - documentation, if provided along with the Derivative Works; or, - within a display generated by the Derivative Works, if and - wherever such third-party notices normally appear. The contents - of the NOTICE file are for informational purposes only and - do not modify the License. You may add Your own attribution - notices within Derivative Works that You distribute, alongside - or as an addendum to the NOTICE text from the Work, provided - that such additional attribution notices cannot be construed - as modifying the License. - - You may add Your own copyright statement to Your modifications and - may provide additional or different license terms and conditions - for use, reproduction, or distribution of Your modifications, or - for any such Derivative Works as a whole, provided Your use, - reproduction, and distribution of the Work otherwise complies with - the conditions stated in this License. - - 5. Submission of Contributions. Unless You explicitly state otherwise, - any Contribution intentionally submitted for inclusion in the Work - by You to the Licensor shall be under the terms and conditions of - this License, without any additional terms or conditions. - Notwithstanding the above, nothing herein shall supersede or modify - the terms of any separate license agreement you may have executed - with Licensor regarding such Contributions. - - 6. Trademarks. This License does not grant permission to use the trade - names, trademarks, service marks, or product names of the Licensor, - except as required for reasonable and customary use in describing the - origin of the Work and reproducing the content of the NOTICE file. - - 7. Disclaimer of Warranty. Unless required by applicable law or - agreed to in writing, Licensor provides the Work (and each - Contributor provides its Contributions) on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or - implied, including, without limitation, any warranties or conditions - of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A - PARTICULAR PURPOSE. You are solely responsible for determining the - appropriateness of using or redistributing the Work and assume any - risks associated with Your exercise of permissions under this License. - - 8. Limitation of Liability. In no event and under no legal theory, - whether in tort (including negligence), contract, or otherwise, - unless required by applicable law (such as deliberate and grossly - negligent acts) or agreed to in writing, shall any Contributor be - liable to You for damages, including any direct, indirect, special, - incidental, or consequential damages of any character arising as a - result of this License or out of the use or inability to use the - Work (including but not limited to damages for loss of goodwill, - work stoppage, computer failure or malfunction, or any and all - other commercial damages or losses), even if such Contributor - has been advised of the possibility of such damages. - - 9. Accepting Warranty or Additional Liability. While redistributing - the Work or Derivative Works thereof, You may choose to offer, - and charge a fee for, acceptance of support, warranty, indemnity, - or other liability obligations and/or rights consistent with this - License. However, in accepting such obligations, You may act only - on Your own behalf and on Your sole responsibility, not on behalf - of any other Contributor, and only if You agree to indemnify, - defend, and hold each Contributor harmless for any liability - incurred by, or claims asserted against, such Contributor by reason - of your accepting any such warranty or additional liability. - - END OF TERMS AND CONDITIONS - - APPENDIX: How to apply the Apache License to your work. - - To apply the Apache License to your work, attach the following - boilerplate notice, with the fields enclosed by brackets "[]" - replaced with your own identifying information. (Don't include - the brackets!) The text should be enclosed in the appropriate - comment syntax for the file format. We also recommend that a - file or class name and description of purpose be included on the - same "printed page" as the copyright notice for easier - identification within third-party archives. - - Copyright [yyyy] [name of copyright owner] - - Licensed under the Apache License, Version 2.0 (the "License"); - you may not use this file except in compliance with the License. - You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - - Unless required by applicable law or agreed to in writing, software - distributed under the License is distributed on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - See the License for the specific language governing permissions and - limitations under the License. diff --git a/vendor/github.com/go-openapi/jsonpointer/README.md b/vendor/github.com/go-openapi/jsonpointer/README.md deleted file mode 100644 index 9c9b1fd4..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/README.md +++ /dev/null @@ -1,15 +0,0 @@ -# gojsonpointer [![Build Status](https://ci.vmware.run/api/badges/go-openapi/jsonpointer/status.svg)](https://ci.vmware.run/go-openapi/jsonpointer) [![Coverage](https://coverage.vmware.run/badges/go-openapi/jsonpointer/coverage.svg)](https://coverage.vmware.run/go-openapi/jsonpointer) [![Slack Status](https://slackin.goswagger.io/badge.svg)](https://slackin.goswagger.io) - -[![license](http://img.shields.io/badge/license-Apache%20v2-orange.svg)](https://raw.githubusercontent.com/go-openapi/jsonpointer/master/LICENSE) [![GoDoc](https://godoc.org/github.com/go-openapi/jsonpointer?status.svg)](http://godoc.org/github.com/go-openapi/jsonpointer) -An implementation of JSON Pointer - Go language - -## Status -Completed YES - -Tested YES - -## References -http://tools.ietf.org/html/draft-ietf-appsawg-json-pointer-07 - -### Note -The 4.Evaluation part of the previous reference, starting with 'If the currently referenced value is a JSON array, the reference token MUST contain either...' is not implemented. diff --git a/vendor/github.com/go-openapi/jsonpointer/pointer.go b/vendor/github.com/go-openapi/jsonpointer/pointer.go deleted file mode 100644 index 39dd012c..00000000 --- a/vendor/github.com/go-openapi/jsonpointer/pointer.go +++ /dev/null @@ -1,238 +0,0 @@ -// Copyright 2013 sigu-399 ( https://github.com/sigu-399 ) -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -// author sigu-399 -// author-github https://github.com/sigu-399 -// author-mail sigu.399@gmail.com -// -// repository-name jsonpointer -// repository-desc An implementation of JSON Pointer - Go language -// -// description Main and unique file. -// -// created 25-02-2013 - -package jsonpointer - -import ( - "errors" - "fmt" - "reflect" - "strconv" - "strings" - - "github.com/go-openapi/swag" -) - -const ( - emptyPointer = `` - pointerSeparator = `/` - - invalidStart = `JSON pointer must be empty or start with a "` + pointerSeparator -) - -var jsonPointableType = reflect.TypeOf(new(JSONPointable)).Elem() - -// JSONPointable is an interface for structs to implement when they need to customize the -// json pointer process -type JSONPointable interface { - JSONLookup(string) (interface{}, error) -} - -type implStruct struct { - mode string // "SET" or "GET" - - inDocument interface{} - - setInValue interface{} - - getOutNode interface{} - getOutKind reflect.Kind - outError error -} - -// New creates a new json pointer for the given string -func New(jsonPointerString string) (Pointer, error) { - - var p Pointer - err := p.parse(jsonPointerString) - return p, err - -} - -// Pointer the json pointer reprsentation -type Pointer struct { - referenceTokens []string -} - -// "Constructor", parses the given string JSON pointer -func (p *Pointer) parse(jsonPointerString string) error { - - var err error - - if jsonPointerString != emptyPointer { - if !strings.HasPrefix(jsonPointerString, pointerSeparator) { - err = errors.New(invalidStart) - } else { - referenceTokens := strings.Split(jsonPointerString, pointerSeparator) - for _, referenceToken := range referenceTokens[1:] { - p.referenceTokens = append(p.referenceTokens, referenceToken) - } - } - } - - return err -} - -// Get uses the pointer to retrieve a value from a JSON document -func (p *Pointer) Get(document interface{}) (interface{}, reflect.Kind, error) { - return p.get(document, swag.DefaultJSONNameProvider) -} - -// GetForToken gets a value for a json pointer token 1 level deep -func GetForToken(document interface{}, decodedToken string) (interface{}, reflect.Kind, error) { - return getSingleImpl(document, decodedToken, swag.DefaultJSONNameProvider) -} - -func getSingleImpl(node interface{}, decodedToken string, nameProvider *swag.NameProvider) (interface{}, reflect.Kind, error) { - kind := reflect.Invalid - rValue := reflect.Indirect(reflect.ValueOf(node)) - kind = rValue.Kind() - switch kind { - - case reflect.Struct: - if rValue.Type().Implements(jsonPointableType) { - r, err := node.(JSONPointable).JSONLookup(decodedToken) - if err != nil { - return nil, kind, err - } - return r, kind, nil - } - nm, ok := nameProvider.GetGoNameForType(rValue.Type(), decodedToken) - if !ok { - return nil, kind, fmt.Errorf("object has no field %q", decodedToken) - } - fld := rValue.FieldByName(nm) - return fld.Interface(), kind, nil - - case reflect.Map: - kv := reflect.ValueOf(decodedToken) - mv := rValue.MapIndex(kv) - if mv.IsValid() && !swag.IsZero(mv) { - return mv.Interface(), kind, nil - } - return nil, kind, fmt.Errorf("object has no key %q", decodedToken) - - case reflect.Slice: - tokenIndex, err := strconv.Atoi(decodedToken) - if err != nil { - return nil, kind, err - } - sLength := rValue.Len() - if tokenIndex < 0 || tokenIndex >= sLength { - return nil, kind, fmt.Errorf("index out of bounds array[0,%d] index '%d'", sLength, tokenIndex) - } - - elem := rValue.Index(tokenIndex) - return elem.Interface(), kind, nil - - default: - return nil, kind, fmt.Errorf("invalid token reference %q", decodedToken) - } - -} - -func (p *Pointer) get(node interface{}, nameProvider *swag.NameProvider) (interface{}, reflect.Kind, error) { - - if nameProvider == nil { - nameProvider = swag.DefaultJSONNameProvider - } - - kind := reflect.Invalid - - // Full document when empty - if len(p.referenceTokens) == 0 { - return node, kind, nil - } - - for _, token := range p.referenceTokens { - - decodedToken := Unescape(token) - - r, knd, err := getSingleImpl(node, decodedToken, nameProvider) - if err != nil { - return nil, knd, err - } - node, kind = r, knd - - } - - rValue := reflect.ValueOf(node) - kind = rValue.Kind() - - return node, kind, nil -} - -// DecodedTokens returns the decoded tokens -func (p *Pointer) DecodedTokens() []string { - result := make([]string, 0, len(p.referenceTokens)) - for _, t := range p.referenceTokens { - result = append(result, Unescape(t)) - } - return result -} - -// IsEmpty returns true if this is an empty json pointer -// this indicates that it points to the root document -func (p *Pointer) IsEmpty() bool { - return len(p.referenceTokens) == 0 -} - -// Pointer to string representation function -func (p *Pointer) String() string { - - if len(p.referenceTokens) == 0 { - return emptyPointer - } - - pointerString := pointerSeparator + strings.Join(p.referenceTokens, pointerSeparator) - - return pointerString -} - -// Specific JSON pointer encoding here -// ~0 => ~ -// ~1 => / -// ... and vice versa - -const ( - encRefTok0 = `~0` - encRefTok1 = `~1` - decRefTok0 = `~` - decRefTok1 = `/` -) - -// Unescape unescapes a json pointer reference token string to the original representation -func Unescape(token string) string { - step1 := strings.Replace(token, encRefTok1, decRefTok1, -1) - step2 := strings.Replace(step1, encRefTok0, decRefTok0, -1) - return step2 -} - -// Escape escapes a pointer reference token string -func Escape(token string) string { - step1 := strings.Replace(token, decRefTok0, encRefTok0, -1) - step2 := strings.Replace(step1, decRefTok1, encRefTok1, -1) - return step2 -} diff --git a/vendor/github.com/go-openapi/jsonreference/.drone.sec b/vendor/github.com/go-openapi/jsonreference/.drone.sec deleted file mode 100644 index 5ff54fb9..00000000 --- a/vendor/github.com/go-openapi/jsonreference/.drone.sec +++ /dev/null @@ -1 +0,0 @@ -eyJhbGciOiJSU0EtT0FFUCIsImVuYyI6IkExMjhHQ00ifQ.Xe40Wx6g5Y-iN0JVMhKyFfubtOId3zAVE564szw_yYGzFNhc_cGZO9F3BtAcJ55CfHG9C_ozn9dpnUDl_zYZoy_6cPCq13Ekb95z8NAC3ekDtbAATsc9HZwRNwI7UfkhstdwxljEouGB01qoLcUn6lFutrou-Ho21COHeDb2caemnPSA-rEAnXkOiBFu0RQ1MIwMygzvHXIHHYNpNwAtXqmiggM10miSjqBM3JmRPxCi7VK6_Rxij5p6LlhmK1BDi8Y6oBh-9BX3--5GAJeWZ6Vof5TnP-Enioia18j8c8KFtfY4q0y6Ednjb-AarLZ12gj695ppkBNJUdTJQmwGwA.fVcz_RiLrUB5fgMS.rjWllDYC6m_NB-ket_LizNEy9mlJ27odBTZQcMKaUqqXZBtWUCmPrOoMXGq-_cc-c7chg7D-WMh9SPQ23pV0P-DY-jsDpbOqHG2STOMEfW9ZREoaOLJXQaWcuBldLjRyWFcq0HGj97LgE6szD1Zlou3bmdHS_Q-U9Up9YQ_8_YnDcESD_cj1w5FZom7HjchKJFeGjQjfDQpoCKCQNMJaavUqy9jHQEeQ_uVocSrETg3GpewDcUF2tuv8uGq7ZZWu7Vl8zmnY1MFTynaGBWzTCSRmCkAXjcsaUheDP_NT5D7k-xUS6LwtqEUiXAXV07SNFraorFj5lnBQZRDlZMYcA3NWR6zHiOxekR9LBYPofst6w1rIqUchj_5m1tDpVTBMPir1eAaFcnJtPgo4ch17OF-kmcmQGLhJI3U7n8wv4sTrmP1dewtRRKrvlJe5r3_6eDiK4xZ8K0rnK1D4g6zuQqU1gA8KaU7pmZkKpFx3Bew4v-6DH32YwQBvAI7Lbb8afou9WsCNB_iswz5XGimP4bifiJRwpWBEz9VGhZFdiw-hZpYWgbxzVb5gtqfTDLIvpbLDmFz1vge16uUQHHVFpo1pSozyr7A60X8qsh9pmmO3RcJ-ZGZBWqiRC-Kl5ejz7WQ.LFoK4Ibi11B2lWQ5WcPSag \ No newline at end of file diff --git a/vendor/github.com/go-openapi/jsonreference/.drone.yml b/vendor/github.com/go-openapi/jsonreference/.drone.yml deleted file mode 100644 index 157ffe57..00000000 --- a/vendor/github.com/go-openapi/jsonreference/.drone.yml +++ /dev/null @@ -1,33 +0,0 @@ -clone: - path: github.com/go-openapi/jsonreference - -matrix: - GO_VERSION: - - "1.6" - -build: - integration: - image: golang:$$GO_VERSION - pull: true - commands: - - go get -u github.com/stretchr/testify/assert - - go get -u github.com/PuerkitoBio/purell - - go get -u github.com/go-openapi/jsonpointer - - go test -race - - go test -v -cover -coverprofile=coverage.out -covermode=count ./... - -notify: - slack: - channel: bots - webhook_url: $$SLACK_URL - username: drone - -publish: - coverage: - server: https://coverage.vmware.run - token: $$GITHUB_TOKEN - # threshold: 70 - # must_increase: true - when: - matrix: - GO_VERSION: "1.6" diff --git a/vendor/github.com/go-openapi/jsonreference/.gitignore b/vendor/github.com/go-openapi/jsonreference/.gitignore deleted file mode 100644 index 769c2440..00000000 --- a/vendor/github.com/go-openapi/jsonreference/.gitignore +++ /dev/null @@ -1 +0,0 @@ -secrets.yml diff --git a/vendor/github.com/go-openapi/jsonreference/.pullapprove.yml b/vendor/github.com/go-openapi/jsonreference/.pullapprove.yml deleted file mode 100644 index 5ec183e2..00000000 --- a/vendor/github.com/go-openapi/jsonreference/.pullapprove.yml +++ /dev/null @@ -1,13 +0,0 @@ -approve_by_comment: true -approve_regex: '^(:shipit:|:\+1:|\+1|LGTM|lgtm|Approved)' -reject_regex: ^[Rr]ejected -reset_on_push: false -reviewers: - members: - - casualjim - - chancez - - frapposelli - - vburenin - - pytlesk4 - name: pullapprove - required: 1 diff --git a/vendor/github.com/go-openapi/jsonreference/CODE_OF_CONDUCT.md b/vendor/github.com/go-openapi/jsonreference/CODE_OF_CONDUCT.md deleted file mode 100644 index 9322b065..00000000 --- a/vendor/github.com/go-openapi/jsonreference/CODE_OF_CONDUCT.md +++ /dev/null @@ -1,74 +0,0 @@ -# Contributor Covenant Code of Conduct - -## Our Pledge - -In the interest of fostering an open and welcoming environment, we as -contributors and maintainers pledge to making participation in our project and -our community a harassment-free experience for everyone, regardless of age, body -size, disability, ethnicity, gender identity and expression, level of experience, -nationality, personal appearance, race, religion, or sexual identity and -orientation. - -## Our Standards - -Examples of behavior that contributes to creating a positive environment -include: - -* Using welcoming and inclusive language -* Being respectful of differing viewpoints and experiences -* Gracefully accepting constructive criticism -* Focusing on what is best for the community -* Showing empathy towards other community members - -Examples of unacceptable behavior by participants include: - -* The use of sexualized language or imagery and unwelcome sexual attention or -advances -* Trolling, insulting/derogatory comments, and personal or political attacks -* Public or private harassment -* Publishing others' private information, such as a physical or electronic - address, without explicit permission -* Other conduct which could reasonably be considered inappropriate in a - professional setting - -## Our Responsibilities - -Project maintainers are responsible for clarifying the standards of acceptable -behavior and are expected to take appropriate and fair corrective action in -response to any instances of unacceptable behavior. - -Project maintainers have the right and responsibility to remove, edit, or -reject comments, commits, code, wiki edits, issues, and other contributions -that are not aligned to this Code of Conduct, or to ban temporarily or -permanently any contributor for other behaviors that they deem inappropriate, -threatening, offensive, or harmful. - -## Scope - -This Code of Conduct applies both within project spaces and in public spaces -when an individual is representing the project or its community. Examples of -representing a project or community include using an official project e-mail -address, posting via an official social media account, or acting as an appointed -representative at an online or offline event. Representation of a project may be -further defined and clarified by project maintainers. - -## Enforcement - -Instances of abusive, harassing, or otherwise unacceptable behavior may be -reported by contacting the project team at ivan+abuse@flanders.co.nz. All -complaints will be reviewed and investigated and will result in a response that -is deemed necessary and appropriate to the circumstances. The project team is -obligated to maintain confidentiality with regard to the reporter of an incident. -Further details of specific enforcement policies may be posted separately. - -Project maintainers who do not follow or enforce the Code of Conduct in good -faith may face temporary or permanent repercussions as determined by other -members of the project's leadership. - -## Attribution - -This Code of Conduct is adapted from the [Contributor Covenant][homepage], version 1.4, -available at [http://contributor-covenant.org/version/1/4][version] - -[homepage]: http://contributor-covenant.org -[version]: http://contributor-covenant.org/version/1/4/ diff --git a/vendor/github.com/go-openapi/jsonreference/LICENSE b/vendor/github.com/go-openapi/jsonreference/LICENSE deleted file mode 100644 index d6456956..00000000 --- a/vendor/github.com/go-openapi/jsonreference/LICENSE +++ /dev/null @@ -1,202 +0,0 @@ - - Apache License - Version 2.0, January 2004 - http://www.apache.org/licenses/ - - TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION - - 1. Definitions. - - "License" shall mean the terms and conditions for use, reproduction, - and distribution as defined by Sections 1 through 9 of this document. - - "Licensor" shall mean the copyright owner or entity authorized by - the copyright owner that is granting the License. - - "Legal Entity" shall mean the union of the acting entity and all - other entities that control, are controlled by, or are under common - control with that entity. For the purposes of this definition, - "control" means (i) the power, direct or indirect, to cause the - direction or management of such entity, whether by contract or - otherwise, or (ii) ownership of fifty percent (50%) or more of the - outstanding shares, or (iii) beneficial ownership of such entity. - - "You" (or "Your") shall mean an individual or Legal Entity - exercising permissions granted by this License. - - "Source" form shall mean the preferred form for making modifications, - including but not limited to software source code, documentation - source, and configuration files. - - "Object" form shall mean any form resulting from mechanical - transformation or translation of a Source form, including but - not limited to compiled object code, generated documentation, - and conversions to other media types. - - "Work" shall mean the work of authorship, whether in Source or - Object form, made available under the License, as indicated by a - copyright notice that is included in or attached to the work - (an example is provided in the Appendix below). - - "Derivative Works" shall mean any work, whether in Source or Object - form, that is based on (or derived from) the Work and for which the - editorial revisions, annotations, elaborations, or other modifications - represent, as a whole, an original work of authorship. For the purposes - of this License, Derivative Works shall not include works that remain - separable from, or merely link (or bind by name) to the interfaces of, - the Work and Derivative Works thereof. - - "Contribution" shall mean any work of authorship, including - the original version of the Work and any modifications or additions - to that Work or Derivative Works thereof, that is intentionally - submitted to Licensor for inclusion in the Work by the copyright owner - or by an individual or Legal Entity authorized to submit on behalf of - the copyright owner. For the purposes of this definition, "submitted" - means any form of electronic, verbal, or written communication sent - to the Licensor or its representatives, including but not limited to - communication on electronic mailing lists, source code control systems, - and issue tracking systems that are managed by, or on behalf of, the - Licensor for the purpose of discussing and improving the Work, but - excluding communication that is conspicuously marked or otherwise - designated in writing by the copyright owner as "Not a Contribution." - - "Contributor" shall mean Licensor and any individual or Legal Entity - on behalf of whom a Contribution has been received by Licensor and - subsequently incorporated within the Work. - - 2. Grant of Copyright License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - copyright license to reproduce, prepare Derivative Works of, - publicly display, publicly perform, sublicense, and distribute the - Work and such Derivative Works in Source or Object form. - - 3. Grant of Patent License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - (except as stated in this section) patent license to make, have made, - use, offer to sell, sell, import, and otherwise transfer the Work, - where such license applies only to those patent claims licensable - by such Contributor that are necessarily infringed by their - Contribution(s) alone or by combination of their Contribution(s) - with the Work to which such Contribution(s) was submitted. If You - institute patent litigation against any entity (including a - cross-claim or counterclaim in a lawsuit) alleging that the Work - or a Contribution incorporated within the Work constitutes direct - or contributory patent infringement, then any patent licenses - granted to You under this License for that Work shall terminate - as of the date such litigation is filed. - - 4. Redistribution. You may reproduce and distribute copies of the - Work or Derivative Works thereof in any medium, with or without - modifications, and in Source or Object form, provided that You - meet the following conditions: - - (a) You must give any other recipients of the Work or - Derivative Works a copy of this License; and - - (b) You must cause any modified files to carry prominent notices - stating that You changed the files; and - - (c) You must retain, in the Source form of any Derivative Works - that You distribute, all copyright, patent, trademark, and - attribution notices from the Source form of the Work, - excluding those notices that do not pertain to any part of - the Derivative Works; and - - (d) If the Work includes a "NOTICE" text file as part of its - distribution, then any Derivative Works that You distribute must - include a readable copy of the attribution notices contained - within such NOTICE file, excluding those notices that do not - pertain to any part of the Derivative Works, in at least one - of the following places: within a NOTICE text file distributed - as part of the Derivative Works; within the Source form or - documentation, if provided along with the Derivative Works; or, - within a display generated by the Derivative Works, if and - wherever such third-party notices normally appear. The contents - of the NOTICE file are for informational purposes only and - do not modify the License. You may add Your own attribution - notices within Derivative Works that You distribute, alongside - or as an addendum to the NOTICE text from the Work, provided - that such additional attribution notices cannot be construed - as modifying the License. - - You may add Your own copyright statement to Your modifications and - may provide additional or different license terms and conditions - for use, reproduction, or distribution of Your modifications, or - for any such Derivative Works as a whole, provided Your use, - reproduction, and distribution of the Work otherwise complies with - the conditions stated in this License. - - 5. Submission of Contributions. Unless You explicitly state otherwise, - any Contribution intentionally submitted for inclusion in the Work - by You to the Licensor shall be under the terms and conditions of - this License, without any additional terms or conditions. - Notwithstanding the above, nothing herein shall supersede or modify - the terms of any separate license agreement you may have executed - with Licensor regarding such Contributions. - - 6. Trademarks. This License does not grant permission to use the trade - names, trademarks, service marks, or product names of the Licensor, - except as required for reasonable and customary use in describing the - origin of the Work and reproducing the content of the NOTICE file. - - 7. Disclaimer of Warranty. Unless required by applicable law or - agreed to in writing, Licensor provides the Work (and each - Contributor provides its Contributions) on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or - implied, including, without limitation, any warranties or conditions - of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A - PARTICULAR PURPOSE. You are solely responsible for determining the - appropriateness of using or redistributing the Work and assume any - risks associated with Your exercise of permissions under this License. - - 8. Limitation of Liability. In no event and under no legal theory, - whether in tort (including negligence), contract, or otherwise, - unless required by applicable law (such as deliberate and grossly - negligent acts) or agreed to in writing, shall any Contributor be - liable to You for damages, including any direct, indirect, special, - incidental, or consequential damages of any character arising as a - result of this License or out of the use or inability to use the - Work (including but not limited to damages for loss of goodwill, - work stoppage, computer failure or malfunction, or any and all - other commercial damages or losses), even if such Contributor - has been advised of the possibility of such damages. - - 9. Accepting Warranty or Additional Liability. While redistributing - the Work or Derivative Works thereof, You may choose to offer, - and charge a fee for, acceptance of support, warranty, indemnity, - or other liability obligations and/or rights consistent with this - License. However, in accepting such obligations, You may act only - on Your own behalf and on Your sole responsibility, not on behalf - of any other Contributor, and only if You agree to indemnify, - defend, and hold each Contributor harmless for any liability - incurred by, or claims asserted against, such Contributor by reason - of your accepting any such warranty or additional liability. - - END OF TERMS AND CONDITIONS - - APPENDIX: How to apply the Apache License to your work. - - To apply the Apache License to your work, attach the following - boilerplate notice, with the fields enclosed by brackets "[]" - replaced with your own identifying information. (Don't include - the brackets!) The text should be enclosed in the appropriate - comment syntax for the file format. We also recommend that a - file or class name and description of purpose be included on the - same "printed page" as the copyright notice for easier - identification within third-party archives. - - Copyright [yyyy] [name of copyright owner] - - Licensed under the Apache License, Version 2.0 (the "License"); - you may not use this file except in compliance with the License. - You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - - Unless required by applicable law or agreed to in writing, software - distributed under the License is distributed on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - See the License for the specific language governing permissions and - limitations under the License. diff --git a/vendor/github.com/go-openapi/jsonreference/README.md b/vendor/github.com/go-openapi/jsonreference/README.md deleted file mode 100644 index 5f788127..00000000 --- a/vendor/github.com/go-openapi/jsonreference/README.md +++ /dev/null @@ -1,15 +0,0 @@ -# gojsonreference [![Build Status](https://ci.vmware.run/api/badges/go-openapi/jsonreference/status.svg)](https://ci.vmware.run/go-openapi/jsonreference) [![Coverage](https://coverage.vmware.run/badges/go-openapi/jsonreference/coverage.svg)](https://coverage.vmware.run/go-openapi/jsonreference) [![Slack Status](https://slackin.goswagger.io/badge.svg)](https://slackin.goswagger.io) - -[![license](http://img.shields.io/badge/license-Apache%20v2-orange.svg)](https://raw.githubusercontent.com/go-openapi/jsonreference/master/LICENSE) [![GoDoc](https://godoc.org/github.com/go-openapi/jsonreference?status.svg)](http://godoc.org/github.com/go-openapi/jsonreference) -An implementation of JSON Reference - Go language - -## Status -Work in progress ( 90% done ) - -## Dependencies -https://github.com/xeipuuv/gojsonpointer - -## References -http://tools.ietf.org/html/draft-ietf-appsawg-json-pointer-07 - -http://tools.ietf.org/html/draft-pbryan-zyp-json-ref-03 diff --git a/vendor/github.com/go-openapi/jsonreference/reference.go b/vendor/github.com/go-openapi/jsonreference/reference.go deleted file mode 100644 index 3bc0a6e2..00000000 --- a/vendor/github.com/go-openapi/jsonreference/reference.go +++ /dev/null @@ -1,156 +0,0 @@ -// Copyright 2013 sigu-399 ( https://github.com/sigu-399 ) -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -// author sigu-399 -// author-github https://github.com/sigu-399 -// author-mail sigu.399@gmail.com -// -// repository-name jsonreference -// repository-desc An implementation of JSON Reference - Go language -// -// description Main and unique file. -// -// created 26-02-2013 - -package jsonreference - -import ( - "errors" - "net/url" - "strings" - - "github.com/PuerkitoBio/purell" - "github.com/go-openapi/jsonpointer" -) - -const ( - fragmentRune = `#` -) - -// New creates a new reference for the given string -func New(jsonReferenceString string) (Ref, error) { - - var r Ref - err := r.parse(jsonReferenceString) - return r, err - -} - -// MustCreateRef parses the ref string and panics when it's invalid. -// Use the New method for a version that returns an error -func MustCreateRef(ref string) Ref { - r, err := New(ref) - if err != nil { - panic(err) - } - return r -} - -// Ref represents a json reference object -type Ref struct { - referenceURL *url.URL - referencePointer jsonpointer.Pointer - - HasFullURL bool - HasURLPathOnly bool - HasFragmentOnly bool - HasFileScheme bool - HasFullFilePath bool -} - -// GetURL gets the URL for this reference -func (r *Ref) GetURL() *url.URL { - return r.referenceURL -} - -// GetPointer gets the json pointer for this reference -func (r *Ref) GetPointer() *jsonpointer.Pointer { - return &r.referencePointer -} - -// String returns the best version of the url for this reference -func (r *Ref) String() string { - - if r.referenceURL != nil { - return r.referenceURL.String() - } - - if r.HasFragmentOnly { - return fragmentRune + r.referencePointer.String() - } - - return r.referencePointer.String() -} - -// IsRoot returns true if this reference is a root document -func (r *Ref) IsRoot() bool { - return r.referenceURL != nil && - !r.IsCanonical() && - !r.HasURLPathOnly && - r.referenceURL.Fragment == "" -} - -// IsCanonical returns true when this pointer starts with http(s):// or file:// -func (r *Ref) IsCanonical() bool { - return (r.HasFileScheme && r.HasFullFilePath) || (!r.HasFileScheme && r.HasFullURL) -} - -// "Constructor", parses the given string JSON reference -func (r *Ref) parse(jsonReferenceString string) error { - - parsed, err := url.Parse(jsonReferenceString) - if err != nil { - return err - } - - r.referenceURL, _ = url.Parse(purell.NormalizeURL(parsed, purell.FlagsSafe|purell.FlagRemoveDuplicateSlashes)) - refURL := r.referenceURL - - if refURL.Scheme != "" && refURL.Host != "" { - r.HasFullURL = true - } else { - if refURL.Path != "" { - r.HasURLPathOnly = true - } else if refURL.RawQuery == "" && refURL.Fragment != "" { - r.HasFragmentOnly = true - } - } - - r.HasFileScheme = refURL.Scheme == "file" - r.HasFullFilePath = strings.HasPrefix(refURL.Path, "/") - - // invalid json-pointer error means url has no json-pointer fragment. simply ignore error - r.referencePointer, _ = jsonpointer.New(refURL.Fragment) - - return nil -} - -// Inherits creates a new reference from a parent and a child -// If the child cannot inherit from the parent, an error is returned -func (r *Ref) Inherits(child Ref) (*Ref, error) { - childURL := child.GetURL() - parentURL := r.GetURL() - if childURL == nil { - return nil, errors.New("child url is nil") - } - if parentURL == nil { - return &child, nil - } - - ref, err := New(parentURL.ResolveReference(childURL).String()) - if err != nil { - return nil, err - } - return &ref, nil -} diff --git a/vendor/github.com/go-openapi/spec/.editorconfig b/vendor/github.com/go-openapi/spec/.editorconfig deleted file mode 100644 index 3152da69..00000000 --- a/vendor/github.com/go-openapi/spec/.editorconfig +++ /dev/null @@ -1,26 +0,0 @@ -# top-most EditorConfig file -root = true - -# Unix-style newlines with a newline ending every file -[*] -end_of_line = lf -insert_final_newline = true -indent_style = space -indent_size = 2 -trim_trailing_whitespace = true - -# Set default charset -[*.{js,py,go,scala,rb,java,html,css,less,sass,md}] -charset = utf-8 - -# Tab indentation (no size specified) -[*.go] -indent_style = tab - -[*.md] -trim_trailing_whitespace = false - -# Matches the exact files either package.json or .travis.yml -[{package.json,.travis.yml}] -indent_style = space -indent_size = 2 diff --git a/vendor/github.com/go-openapi/spec/.gitignore b/vendor/github.com/go-openapi/spec/.gitignore deleted file mode 100644 index dd91ed6a..00000000 --- a/vendor/github.com/go-openapi/spec/.gitignore +++ /dev/null @@ -1,2 +0,0 @@ -secrets.yml -coverage.out diff --git a/vendor/github.com/go-openapi/spec/.travis.yml b/vendor/github.com/go-openapi/spec/.travis.yml deleted file mode 100644 index ea80ef2a..00000000 --- a/vendor/github.com/go-openapi/spec/.travis.yml +++ /dev/null @@ -1,16 +0,0 @@ -language: go -go: -- 1.7 -install: -- go get -u github.com/stretchr/testify -- go get -u github.com/go-openapi/swag -- go get -u gopkg.in/yaml.v2 -- go get -u github.com/go-openapi/jsonpointer -- go get -u github.com/go-openapi/jsonreference -script: -- go test -v -race -cover -coverprofile=coverage.txt -covermode=atomic ./... -after_success: -- bash <(curl -s https://codecov.io/bash) -notifications: - slack: - secure: QUWvCkBBK09GF7YtEvHHVt70JOkdlNBG0nIKu/5qc4/nW5HP8I2w0SEf/XR2je0eED1Qe3L/AfMCWwrEj+IUZc3l4v+ju8X8R3Lomhme0Eb0jd1MTMCuPcBT47YCj0M7RON7vXtbFfm1hFJ/jLe5+9FXz0hpXsR24PJc5ZIi/ogNwkaPqG4BmndzecpSh0vc2FJPZUD9LT0I09REY/vXR0oQAalLkW0asGD5taHZTUZq/kBpsNxaAFrLM23i4mUcf33M5fjLpvx5LRICrX/57XpBrDh2TooBU6Qj3CgoY0uPRYUmSNxbVx1czNzl2JtEpb5yjoxfVPQeg0BvQM00G8LJINISR+ohrjhkZmAqchDupAX+yFrxTtORa78CtnIL6z/aTNlgwwVD8kvL/1pFA/JWYmKDmz93mV/+6wubGzNSQCstzjkFA4/iZEKewKUoRIAi/fxyscP6L/rCpmY/4llZZvrnyTqVbt6URWpopUpH4rwYqreXAtJxJsfBJIeSmUIiDIOMGkCTvyTEW3fWGmGoqWtSHLoaWDyAIGb7azb+KvfpWtEcoPFWfSWU+LGee0A/YsUhBl7ADB9A0CJEuR8q4BPpKpfLwPKSiKSAXL7zDkyjExyhtgqbSl2jS+rKIHOZNL8JkCcTP2MKMVd563C5rC5FMKqu3S9m2b6380E= diff --git a/vendor/github.com/go-openapi/spec/CODE_OF_CONDUCT.md b/vendor/github.com/go-openapi/spec/CODE_OF_CONDUCT.md deleted file mode 100644 index 9322b065..00000000 --- a/vendor/github.com/go-openapi/spec/CODE_OF_CONDUCT.md +++ /dev/null @@ -1,74 +0,0 @@ -# Contributor Covenant Code of Conduct - -## Our Pledge - -In the interest of fostering an open and welcoming environment, we as -contributors and maintainers pledge to making participation in our project and -our community a harassment-free experience for everyone, regardless of age, body -size, disability, ethnicity, gender identity and expression, level of experience, -nationality, personal appearance, race, religion, or sexual identity and -orientation. - -## Our Standards - -Examples of behavior that contributes to creating a positive environment -include: - -* Using welcoming and inclusive language -* Being respectful of differing viewpoints and experiences -* Gracefully accepting constructive criticism -* Focusing on what is best for the community -* Showing empathy towards other community members - -Examples of unacceptable behavior by participants include: - -* The use of sexualized language or imagery and unwelcome sexual attention or -advances -* Trolling, insulting/derogatory comments, and personal or political attacks -* Public or private harassment -* Publishing others' private information, such as a physical or electronic - address, without explicit permission -* Other conduct which could reasonably be considered inappropriate in a - professional setting - -## Our Responsibilities - -Project maintainers are responsible for clarifying the standards of acceptable -behavior and are expected to take appropriate and fair corrective action in -response to any instances of unacceptable behavior. - -Project maintainers have the right and responsibility to remove, edit, or -reject comments, commits, code, wiki edits, issues, and other contributions -that are not aligned to this Code of Conduct, or to ban temporarily or -permanently any contributor for other behaviors that they deem inappropriate, -threatening, offensive, or harmful. - -## Scope - -This Code of Conduct applies both within project spaces and in public spaces -when an individual is representing the project or its community. Examples of -representing a project or community include using an official project e-mail -address, posting via an official social media account, or acting as an appointed -representative at an online or offline event. Representation of a project may be -further defined and clarified by project maintainers. - -## Enforcement - -Instances of abusive, harassing, or otherwise unacceptable behavior may be -reported by contacting the project team at ivan+abuse@flanders.co.nz. All -complaints will be reviewed and investigated and will result in a response that -is deemed necessary and appropriate to the circumstances. The project team is -obligated to maintain confidentiality with regard to the reporter of an incident. -Further details of specific enforcement policies may be posted separately. - -Project maintainers who do not follow or enforce the Code of Conduct in good -faith may face temporary or permanent repercussions as determined by other -members of the project's leadership. - -## Attribution - -This Code of Conduct is adapted from the [Contributor Covenant][homepage], version 1.4, -available at [http://contributor-covenant.org/version/1/4][version] - -[homepage]: http://contributor-covenant.org -[version]: http://contributor-covenant.org/version/1/4/ diff --git a/vendor/github.com/go-openapi/spec/LICENSE b/vendor/github.com/go-openapi/spec/LICENSE deleted file mode 100644 index d6456956..00000000 --- a/vendor/github.com/go-openapi/spec/LICENSE +++ /dev/null @@ -1,202 +0,0 @@ - - Apache License - Version 2.0, January 2004 - http://www.apache.org/licenses/ - - TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION - - 1. Definitions. - - "License" shall mean the terms and conditions for use, reproduction, - and distribution as defined by Sections 1 through 9 of this document. - - "Licensor" shall mean the copyright owner or entity authorized by - the copyright owner that is granting the License. - - "Legal Entity" shall mean the union of the acting entity and all - other entities that control, are controlled by, or are under common - control with that entity. For the purposes of this definition, - "control" means (i) the power, direct or indirect, to cause the - direction or management of such entity, whether by contract or - otherwise, or (ii) ownership of fifty percent (50%) or more of the - outstanding shares, or (iii) beneficial ownership of such entity. - - "You" (or "Your") shall mean an individual or Legal Entity - exercising permissions granted by this License. - - "Source" form shall mean the preferred form for making modifications, - including but not limited to software source code, documentation - source, and configuration files. - - "Object" form shall mean any form resulting from mechanical - transformation or translation of a Source form, including but - not limited to compiled object code, generated documentation, - and conversions to other media types. - - "Work" shall mean the work of authorship, whether in Source or - Object form, made available under the License, as indicated by a - copyright notice that is included in or attached to the work - (an example is provided in the Appendix below). - - "Derivative Works" shall mean any work, whether in Source or Object - form, that is based on (or derived from) the Work and for which the - editorial revisions, annotations, elaborations, or other modifications - represent, as a whole, an original work of authorship. For the purposes - of this License, Derivative Works shall not include works that remain - separable from, or merely link (or bind by name) to the interfaces of, - the Work and Derivative Works thereof. - - "Contribution" shall mean any work of authorship, including - the original version of the Work and any modifications or additions - to that Work or Derivative Works thereof, that is intentionally - submitted to Licensor for inclusion in the Work by the copyright owner - or by an individual or Legal Entity authorized to submit on behalf of - the copyright owner. For the purposes of this definition, "submitted" - means any form of electronic, verbal, or written communication sent - to the Licensor or its representatives, including but not limited to - communication on electronic mailing lists, source code control systems, - and issue tracking systems that are managed by, or on behalf of, the - Licensor for the purpose of discussing and improving the Work, but - excluding communication that is conspicuously marked or otherwise - designated in writing by the copyright owner as "Not a Contribution." - - "Contributor" shall mean Licensor and any individual or Legal Entity - on behalf of whom a Contribution has been received by Licensor and - subsequently incorporated within the Work. - - 2. Grant of Copyright License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - copyright license to reproduce, prepare Derivative Works of, - publicly display, publicly perform, sublicense, and distribute the - Work and such Derivative Works in Source or Object form. - - 3. Grant of Patent License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - (except as stated in this section) patent license to make, have made, - use, offer to sell, sell, import, and otherwise transfer the Work, - where such license applies only to those patent claims licensable - by such Contributor that are necessarily infringed by their - Contribution(s) alone or by combination of their Contribution(s) - with the Work to which such Contribution(s) was submitted. If You - institute patent litigation against any entity (including a - cross-claim or counterclaim in a lawsuit) alleging that the Work - or a Contribution incorporated within the Work constitutes direct - or contributory patent infringement, then any patent licenses - granted to You under this License for that Work shall terminate - as of the date such litigation is filed. - - 4. Redistribution. You may reproduce and distribute copies of the - Work or Derivative Works thereof in any medium, with or without - modifications, and in Source or Object form, provided that You - meet the following conditions: - - (a) You must give any other recipients of the Work or - Derivative Works a copy of this License; and - - (b) You must cause any modified files to carry prominent notices - stating that You changed the files; and - - (c) You must retain, in the Source form of any Derivative Works - that You distribute, all copyright, patent, trademark, and - attribution notices from the Source form of the Work, - excluding those notices that do not pertain to any part of - the Derivative Works; and - - (d) If the Work includes a "NOTICE" text file as part of its - distribution, then any Derivative Works that You distribute must - include a readable copy of the attribution notices contained - within such NOTICE file, excluding those notices that do not - pertain to any part of the Derivative Works, in at least one - of the following places: within a NOTICE text file distributed - as part of the Derivative Works; within the Source form or - documentation, if provided along with the Derivative Works; or, - within a display generated by the Derivative Works, if and - wherever such third-party notices normally appear. The contents - of the NOTICE file are for informational purposes only and - do not modify the License. You may add Your own attribution - notices within Derivative Works that You distribute, alongside - or as an addendum to the NOTICE text from the Work, provided - that such additional attribution notices cannot be construed - as modifying the License. - - You may add Your own copyright statement to Your modifications and - may provide additional or different license terms and conditions - for use, reproduction, or distribution of Your modifications, or - for any such Derivative Works as a whole, provided Your use, - reproduction, and distribution of the Work otherwise complies with - the conditions stated in this License. - - 5. Submission of Contributions. Unless You explicitly state otherwise, - any Contribution intentionally submitted for inclusion in the Work - by You to the Licensor shall be under the terms and conditions of - this License, without any additional terms or conditions. - Notwithstanding the above, nothing herein shall supersede or modify - the terms of any separate license agreement you may have executed - with Licensor regarding such Contributions. - - 6. Trademarks. This License does not grant permission to use the trade - names, trademarks, service marks, or product names of the Licensor, - except as required for reasonable and customary use in describing the - origin of the Work and reproducing the content of the NOTICE file. - - 7. Disclaimer of Warranty. Unless required by applicable law or - agreed to in writing, Licensor provides the Work (and each - Contributor provides its Contributions) on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or - implied, including, without limitation, any warranties or conditions - of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A - PARTICULAR PURPOSE. You are solely responsible for determining the - appropriateness of using or redistributing the Work and assume any - risks associated with Your exercise of permissions under this License. - - 8. Limitation of Liability. In no event and under no legal theory, - whether in tort (including negligence), contract, or otherwise, - unless required by applicable law (such as deliberate and grossly - negligent acts) or agreed to in writing, shall any Contributor be - liable to You for damages, including any direct, indirect, special, - incidental, or consequential damages of any character arising as a - result of this License or out of the use or inability to use the - Work (including but not limited to damages for loss of goodwill, - work stoppage, computer failure or malfunction, or any and all - other commercial damages or losses), even if such Contributor - has been advised of the possibility of such damages. - - 9. Accepting Warranty or Additional Liability. While redistributing - the Work or Derivative Works thereof, You may choose to offer, - and charge a fee for, acceptance of support, warranty, indemnity, - or other liability obligations and/or rights consistent with this - License. However, in accepting such obligations, You may act only - on Your own behalf and on Your sole responsibility, not on behalf - of any other Contributor, and only if You agree to indemnify, - defend, and hold each Contributor harmless for any liability - incurred by, or claims asserted against, such Contributor by reason - of your accepting any such warranty or additional liability. - - END OF TERMS AND CONDITIONS - - APPENDIX: How to apply the Apache License to your work. - - To apply the Apache License to your work, attach the following - boilerplate notice, with the fields enclosed by brackets "[]" - replaced with your own identifying information. (Don't include - the brackets!) The text should be enclosed in the appropriate - comment syntax for the file format. We also recommend that a - file or class name and description of purpose be included on the - same "printed page" as the copyright notice for easier - identification within third-party archives. - - Copyright [yyyy] [name of copyright owner] - - Licensed under the Apache License, Version 2.0 (the "License"); - you may not use this file except in compliance with the License. - You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - - Unless required by applicable law or agreed to in writing, software - distributed under the License is distributed on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - See the License for the specific language governing permissions and - limitations under the License. diff --git a/vendor/github.com/go-openapi/spec/README.md b/vendor/github.com/go-openapi/spec/README.md deleted file mode 100644 index 1d162208..00000000 --- a/vendor/github.com/go-openapi/spec/README.md +++ /dev/null @@ -1,5 +0,0 @@ -# OAI object model [![Build Status](https://travis-ci.org/go-openapi/spec.svg?branch=master)](https://travis-ci.org/go-openapi/spec) [![codecov](https://codecov.io/gh/go-openapi/spec/branch/master/graph/badge.svg)](https://codecov.io/gh/go-openapi/spec) [![Slack Status](https://slackin.goswagger.io/badge.svg)](https://slackin.goswagger.io) - -[![license](http://img.shields.io/badge/license-Apache%20v2-orange.svg)](https://raw.githubusercontent.com/go-openapi/spec/master/LICENSE) [![GoDoc](https://godoc.org/github.com/go-openapi/spec?status.svg)](http://godoc.org/github.com/go-openapi/spec) - -The object model for OpenAPI specification documents diff --git a/vendor/github.com/go-openapi/spec/bindata.go b/vendor/github.com/go-openapi/spec/bindata.go deleted file mode 100644 index 9afb5df1..00000000 --- a/vendor/github.com/go-openapi/spec/bindata.go +++ /dev/null @@ -1,260 +0,0 @@ -// Code generated by go-bindata. -// sources: -// schemas/jsonschema-draft-04.json -// schemas/v2/schema.json -// DO NOT EDIT! - -package spec - -import ( - "bytes" - "compress/gzip" - "fmt" - "io" - "io/ioutil" - "os" - "path/filepath" - "strings" - "time" -) - -func bindataRead(data []byte, name string) ([]byte, error) { - gz, err := gzip.NewReader(bytes.NewBuffer(data)) - if err != nil { - return nil, fmt.Errorf("Read %q: %v", name, err) - } - - var buf bytes.Buffer - _, err = io.Copy(&buf, gz) - clErr := gz.Close() - - if err != nil { - return nil, fmt.Errorf("Read %q: %v", name, err) - } - if clErr != nil { - return nil, err - } - - return buf.Bytes(), nil -} - -type asset struct { - bytes []byte - info os.FileInfo -} - -type bindataFileInfo struct { - name string - size int64 - mode os.FileMode - modTime time.Time -} - -func (fi bindataFileInfo) Name() string { - return fi.name -} -func (fi bindataFileInfo) Size() int64 { - return fi.size -} -func (fi bindataFileInfo) Mode() os.FileMode { - return fi.mode -} -func (fi bindataFileInfo) ModTime() time.Time { - return fi.modTime -} -func (fi bindataFileInfo) IsDir() bool { - return false -} -func (fi bindataFileInfo) Sys() interface{} { - return nil -} - -var _jsonschemaDraft04JSON = []byte("\x1f\x8b\x08\x00\x00\x09\x6e\x88\x00\xff\xc4\x57\x3b\x6f\xdb\x3e\x10\xdf\xf3\x29\x08\x26\x63\xf2\x97\xff\x40\x27\x6f\x45\xbb\x18\x68\xd1\x0c\xdd\x0c\x0f\xb4\x75\xb2\x19\x50\xa4\x42\x51\x81\x0d\x43\xdf\xbd\xa0\xa8\x07\x29\x91\x92\x2d\xbb\x8d\x97\x28\xbc\xd7\xef\x8e\xf7\xe2\xf9\x01\x21\x84\x30\x8d\xf1\x12\xe1\x83\x52\xd9\x32\x8a\xde\x72\xc1\x5f\xf2\xdd\x01\x52\xf2\x9f\x90\xfb\x28\x96\x24\x51\x2f\x8b\x2f\x91\x39\x7b\xc4\xcf\x46\xe8\xc9\xfc\x3f\x43\x32\x86\x7c\x27\x69\xa6\xa8\xe0\x5a\xfa\x9b\x90\x80\x0c\x0b\x4a\x41\x91\x5a\x45\xc7\x9d\x50\x4e\x35\x73\x8e\x97\xc8\x20\xae\x08\x86\xed\xab\x94\xe4\xe4\x10\x2a\xa2\x3a\x65\xa0\x95\x93\x8a\xfc\xec\x12\x53\xca\x57\x0a\x52\xad\xef\xff\x1e\x89\xd6\xe7\x67\x84\x9f\x24\x24\x5a\xc5\x23\x46\x65\xcb\x54\x76\xfc\x38\x13\x39\x55\xf4\x03\x56\x5c\xc1\x1e\x64\x18\x04\xad\x19\x86\x30\x68\x5a\xa4\x78\x89\x16\x97\xe8\xff\x0e\x09\x29\x98\x5a\x0c\xed\x10\xc6\x7e\x69\xa8\x6b\x07\x76\x64\x45\x2e\xea\x63\x45\xe5\xb3\x66\x8e\x8d\x4e\x0d\x01\x95\x68\xe3\x85\x91\xd3\x34\x63\xf0\xfb\x94\x41\x3e\x34\x0d\xbc\x72\x60\xdd\x46\x1a\xe1\xad\x10\x0c\x08\xd7\x9f\xad\xe3\x08\xf3\x82\x31\xf3\x37\xdd\x9a\x13\xb1\x7d\x83\x9d\xd2\x5f\xb9\x92\x94\xef\x71\xc8\x7e\x45\x9d\x73\xcf\xd6\x65\x36\x7c\x8d\xa9\xf2\xf2\x94\x28\x38\x7d\x2f\xa0\xa1\x2a\x59\x40\x07\xf3\xc1\x02\xdb\xda\x68\x1c\x33\xa7\x99\x14\x19\x48\x45\x7b\xd1\x33\x45\x17\xf0\xa6\x46\xd9\x03\x92\x08\x99\x12\x7d\x57\xb8\x90\x14\x7b\x63\xd5\x15\xe5\xbd\x35\x2b\xaa\x18\x4c\xea\xf5\x8a\xba\xf5\x3e\x4b\x41\x93\xa5\x67\xfb\x38\x2d\x98\xa2\x19\x83\x2a\xf7\x03\x6a\x9b\x74\x0b\x56\x5e\x8f\x02\xc7\x1d\x2b\x72\xfa\x01\x3f\x5b\x16\xf7\xc6\x6d\xfb\xe4\x58\xb3\x8c\x1b\xf7\x0a\x77\x86\xa6\xb4\xb4\xf5\xe4\x92\xbb\xa0\x24\x84\xe5\x01\x84\xad\x13\x37\x21\x9c\xd2\x72\x0b\x42\x72\xfc\x01\x7c\xaf\x0e\xbd\x9e\x3b\xd5\xbc\x1c\x1f\xaf\xd6\xd0\xb6\x52\xb7\xdf\x12\xa5\x40\x4e\xe7\x68\xb0\x78\x24\xec\xe1\xe8\x0f\x26\x89\xe3\x0a\x0a\x61\x4d\x23\xe9\xf7\x70\x7e\x32\x3d\xdc\x39\xd6\xbf\xf3\x30\xd0\xfd\xf6\x55\xb3\x79\x27\x96\xfe\x6d\x82\x37\x73\xf6\x8f\x36\x3a\x03\xa4\x6d\x7d\x1c\x9e\x73\x35\xf6\x18\xbf\x15\x76\x4a\x8e\x2b\xcf\x00\xbf\x2a\x99\xae\x55\xe0\xcf\x25\x77\x68\xfc\x95\xba\x79\x75\x06\xcb\x5c\x77\x67\x69\xf1\xfb\x2c\xe1\xbd\xa0\x12\xe2\x31\x45\xf6\x30\x0f\x14\xc8\xab\x7f\x60\x4e\x27\xe0\x3f\xaf\x92\xd0\x6a\x8a\x82\xdb\xc0\xa4\xbb\x63\x65\x34\x0d\x28\xb0\x6b\x7c\x1e\x1e\xd3\x51\xc7\x6e\xf4\x33\x60\xc5\x90\x01\x8f\x81\xef\xee\x88\x68\x90\x69\x23\xb9\x8a\x2e\x69\x98\x7d\xa6\x91\x32\x1a\xc8\x6e\x9c\x13\x7f\x10\xea\xcd\xfd\x4e\xef\xa6\xb1\x25\xd9\xde\x22\x8d\xfa\x59\x63\xc5\x0d\x80\xf5\x28\xf1\xd6\xb9\x37\x9e\xa3\xee\xb5\x4c\xbe\x37\xe0\x55\xc6\x27\x82\x75\x49\xd0\xda\xe0\xb9\x1d\xca\xbf\x5b\xd4\xcf\xbf\x0b\x47\xac\x2d\x59\x07\xfe\x7a\x49\xc1\x61\xa6\x24\x17\x2a\xf0\xbe\x2e\xdb\x17\x7f\xa0\x3c\x7d\x4b\xf3\xba\xdb\xc3\xed\x06\xee\xdb\x5e\xd7\xdd\x42\x5c\x47\xb2\xb3\x68\x75\x8c\xf2\xe1\x4f\x00\x00\x00\xff\xff\x4e\x9b\x8d\xdf\x17\x11\x00\x00") - -func jsonschemaDraft04JSONBytes() ([]byte, error) { - return bindataRead( - _jsonschemaDraft04JSON, - "jsonschema-draft-04.json", - ) -} - -func jsonschemaDraft04JSON() (*asset, error) { - bytes, err := jsonschemaDraft04JSONBytes() - if err != nil { - return nil, err - } - - info := bindataFileInfo{name: "jsonschema-draft-04.json", size: 4375, mode: os.FileMode(420), modTime: time.Unix(1482389892, 0)} - a := &asset{bytes: bytes, info: info} - return a, nil -} - -var _v2SchemaJSON = []byte("\x1f\x8b\x08\x00\x00\x09\x6e\x88\x00\xff\xec\x5d\x4f\x93\xdb\x36\xb2\xbf\xfb\x53\xa0\x14\x57\xd9\xae\xd8\x92\xe3\xf7\x2e\xcf\x97\xd4\xbc\xd8\x49\x66\x37\x5e\x4f\x79\x26\xbb\x87\x78\x5c\x05\x91\x2d\x09\x09\x09\x30\x00\x38\x33\x5a\xef\x7c\xf7\x2d\xf0\x9f\x08\x02\x20\x41\x8a\xd2\xc8\x0e\x0f\xa9\x78\x28\xa0\xd1\xdd\x68\x34\x7e\xdd\xf8\xf7\xf9\x11\x42\x33\x49\x64\x04\xb3\xd7\x68\x76\x86\xfe\x76\xf9\xfe\x1f\xe8\x32\xd8\x40\x8c\xd1\x8a\x71\x74\x79\x8b\xd7\x6b\xe0\xe8\xd5\xfc\x25\x3a\xbb\x38\x9f\xcf\x9e\xab\x0a\x24\x54\xa5\x37\x52\x26\xaf\x17\x0b\x91\x17\x99\x13\xb6\xb8\x79\xb5\x10\x59\xdd\xf9\xef\x82\xd1\x6f\xf2\xc2\x8f\xf3\x4f\xb5\x1a\xea\xc7\x17\x45\x41\xc6\xd7\x8b\x90\xe3\x95\x7c\xf1\xf2\x7f\x8b\xca\x45\x3d\xb9\x4d\x32\xa6\xd8\xf2\x77\x08\x64\xfe\x8d\xc3\x9f\x29\xe1\xa0\x9a\xff\xed\x11\x42\x08\xcd\x8a\xd6\xb3\x9f\x15\x67\x74\xc5\xca\x7f\x27\x58\x6e\xc4\xec\x11\x42\xd7\x59\x5d\x1c\x86\x44\x12\x46\x71\x74\xc1\x59\x02\x5c\x12\x10\xb3\xd7\x68\x85\x23\x01\x59\x81\x04\x4b\x09\x9c\x6a\xbf\x7e\xce\x49\x7d\xba\x7b\x51\xfd\xa1\x44\xe2\xb0\x52\xac\x7d\xb3\x08\x61\x45\x68\x46\x56\x2c\x6e\x80\x86\x8c\xbf\xbd\x93\x40\x05\x61\x74\x96\x95\xbe\x7f\x84\xd0\x7d\x4e\xde\x42\xb7\xe4\xbe\x46\xbb\x14\x5b\x48\x4e\xe8\xba\x90\x05\xa1\x19\xd0\x34\xae\xc4\xce\xbe\xbc\x9a\xbf\x9c\x15\x7f\x5d\x57\xc5\x42\x10\x01\x27\x89\xe2\x48\x51\xb9\xda\x40\xd5\x87\x37\xc0\x15\x5f\x88\xad\x90\xdc\x10\x81\x42\x16\xa4\x31\x50\x39\x2f\x38\xad\xab\xb0\x53\xd8\xac\x94\x56\x6f\xc3\x84\xf4\x11\xa4\x50\xb3\xfa\xe9\xd3\x6f\x9f\x3e\xdf\x2f\xd0\xeb\x8f\x1f\x3f\x7e\xbc\xfe\xf6\xe9\xf7\xaf\x5f\x7f\xfc\x18\x7e\xfb\xec\xfb\xc7\xb3\x36\x79\x54\x43\xe8\x29\xc5\x31\x20\xc6\x11\x49\x9e\xe5\x12\x41\x66\xa0\xe8\xed\x1d\x8e\x93\x08\x5e\xa3\x27\x3b\xc3\x7c\xa2\x73\xba\xc4\x02\x2e\xb0\xdc\xf4\xe5\x76\xd1\xca\x96\xa2\x8a\x94\xcd\x21\xc9\x6c\xec\x2c\x70\x42\x9e\x34\x74\x9d\x19\x7c\xcd\x20\x9c\xea\x2e\x0a\xfe\x42\x84\xd4\x29\x04\x8c\x8a\xb4\x41\xa2\xc1\xdc\x19\x8a\x88\x90\x4a\x49\xef\xce\xdf\xbd\x45\x4a\x52\x81\x70\x10\x40\x22\x21\x44\xcb\x6d\xc5\xec\x4e\x3c\x1c\x45\xef\x57\x9a\xb5\x7d\xae\xfe\xe5\xe4\x31\x86\x90\xe0\xab\x6d\x02\x3b\x2e\xcb\x11\x90\xd9\xa8\xc6\x77\xc2\x59\x98\x06\xfd\xf9\x2e\x78\x45\x01\xa6\xa8\xa0\x71\x5c\xbe\x33\xa7\xd2\xd9\x5f\x95\xef\xd9\xd5\xac\xfd\xdc\x5d\xbf\x5e\xb8\xd1\x3e\xc7\x31\x48\xe0\x5e\x4c\x14\x65\xdf\xb8\xa8\x71\x10\x09\xa3\xc2\xc7\x02\xcb\xa2\x4e\x5a\x02\x82\x94\x13\xb9\xf5\x30\xe6\xb2\xa4\xb5\xfe\x9b\x3e\x7a\xb2\x55\xd2\xa8\x4a\xbc\x16\xb6\x71\x8e\x39\xc7\xdb\x9d\xe1\x10\x09\x71\xbd\x9c\xb3\x41\x89\xd7\xa5\x89\xdc\x57\xb5\x53\x4a\xfe\x4c\xe1\xbc\xa0\x21\x79\x0a\x1a\x0f\x70\xa7\x5c\x08\x8e\xde\xb0\xc0\x43\x24\xad\x74\x63\x0e\xb1\xd9\x90\xe1\xb0\x2d\x13\xa7\x6d\x78\xfd\x04\x14\x38\x8e\x90\xaa\xce\x63\xac\x3e\x23\xbc\x64\xa9\xb4\xf8\x03\x63\xde\xcd\xbe\x16\x13\x4a\x55\xac\x82\x12\xc6\xac\xd4\x35\xf7\x22\xd4\x3a\xff\x22\x73\x0e\x6e\x51\xa0\x75\x1e\xae\x8f\xe8\x5d\xc7\x59\xe6\xe4\x9a\x18\x8d\xd6\x1c\x53\x84\x4d\xb7\x67\x28\x37\x09\x84\x69\x88\x12\x0e\x01\x11\x80\x32\xa2\xf5\xb9\xaa\xc6\xd9\x73\x53\xab\xfb\xb4\x2e\x20\xc6\x54\x92\xa0\x9a\xf3\x69\x1a\x2f\x81\x77\x37\xae\x53\x1a\xce\x40\xc4\xa8\x82\x1c\xb5\xef\xda\x24\x7d\xb9\x61\x69\x14\xa2\x25\xa0\x90\xac\x56\xc0\x81\x4a\xb4\xe2\x2c\xce\x4a\x64\x7a\x9a\x23\xf4\x13\x91\x3f\xa7\x4b\xf4\x63\x84\x6f\x18\x87\x10\xbd\xc3\xfc\x8f\x90\xdd\x52\x44\x04\xc2\x51\xc4\x6e\x21\x74\x48\x21\x81\xc7\xe2\xfd\xea\x12\xf8\x0d\x09\xf6\xe9\x47\x35\xaf\x67\xc4\x14\xf7\x22\x27\x97\xe1\xe2\x76\x2d\x06\x8c\x4a\x1c\x48\x3f\x73\x2d\x0b\x5b\x29\x45\x24\x00\x2a\x0c\x11\xec\x94\xca\xc2\xa6\xc1\x37\x21\x43\x83\x3b\x5f\x97\xf1\x43\x5e\x53\x73\x19\xa5\x36\xd8\x2d\x05\x2e\x34\x0b\xeb\x39\xfc\x1d\x63\x51\x01\xbd\x3d\xbb\x90\x84\x40\x25\x59\x6d\x09\x5d\xa3\x1c\x37\xe6\x5c\x16\x9a\x40\x09\x70\xc1\xe8\x82\xf1\x35\xa6\xe4\xdf\x99\x5c\x8e\x9e\x4d\x79\xb4\x27\x2f\xbf\x7e\xf8\x05\x25\x8c\x50\xa9\x98\x29\x90\x62\x60\xea\x75\xae\x13\xca\xbf\x2b\x1a\x29\x27\x76\xd6\x20\xc6\x64\x5f\xe6\x32\x1a\x08\x87\x21\x07\x21\xbc\xb4\xe4\xe0\x32\x67\xa6\xcd\xf3\x1e\xcd\xd9\x6b\xb6\x6f\x8e\x27\xa7\xed\xdb\xe7\xbc\xcc\x1a\x07\xce\x6f\x87\x33\xf0\xba\x51\x17\x22\x66\x78\x79\x8e\xce\xe5\x13\x81\x80\x06\x2c\xe5\x78\x0d\xa1\xb2\xb8\x54\xa8\x79\x09\xbd\xbf\x3c\x47\x01\x8b\x13\x2c\xc9\x32\xaa\xaa\x1d\xd5\xee\xab\x36\xbd\x6c\xfd\x54\x6c\xc8\x08\x01\x3c\xbd\xe7\x07\x88\xb0\x24\x37\x79\x90\x28\x4a\x1d\x10\x1a\x92\x1b\x12\xa6\x38\x42\x40\xc3\x4c\x43\x62\x8e\xae\x36\xb0\x45\x71\x2a\xa4\x9a\x23\x79\x59\xb1\xa8\xf2\xa4\x0c\x60\x9f\xcc\x8d\x40\xf5\x80\xca\xa8\x99\xc3\xa7\x85\x1f\x31\x25\xa9\x82\xc5\x6d\xbd\xd8\x36\x76\x7c\x02\x28\x97\xf6\x1d\x74\x3b\x11\x7e\x91\xae\x32\xf8\x6c\xf4\xe6\x7b\x9a\xa5\x1f\x62\xc6\x21\xcf\x9a\xe5\xed\x8b\x02\xf3\x2c\x33\x33\xdf\x00\xca\xc9\x09\xb4\x04\xf5\xa5\x08\xd7\xc3\x02\x18\x66\xf1\xab\x1e\x83\x37\x4c\xcd\x12\xc1\x1d\x50\xf6\xaa\xbd\xfe\xe2\x73\x48\x38\x08\xa0\x32\x9b\x18\x44\x86\x0b\x6a\xc1\xaa\x26\x96\x2d\x96\x3c\xa0\x54\x65\x73\x87\x15\xca\x15\xe5\xf5\x94\x46\x9f\x33\x1a\x0c\x9a\xb1\x5a\xd9\x6a\x95\xcd\xcb\x7e\xec\x9a\xc5\x94\x3b\x37\x26\x31\xd7\xfc\xe4\x1f\x13\x8c\x31\x75\x9c\xba\xf7\x87\x3c\xa1\xb7\x4f\x17\x1b\x09\x82\x98\xc4\x70\x95\xd3\xe8\x4c\x48\x5a\xa6\xd6\x2a\x3d\x56\x42\x80\x9f\xaf\xae\x2e\x50\x0c\x42\xe0\x35\x34\x3c\x8a\x62\x03\x37\xba\xb2\x27\x04\xda\x25\x8d\x06\xe2\xa0\x13\x8a\xf3\xf5\xec\x10\x72\x67\x88\x90\x3d\x4b\x64\xeb\xaa\xda\x8f\xf7\x5a\x75\x47\x9a\xa8\x51\x70\x26\xd2\x38\xc6\x7c\xbb\x57\xfc\xbd\xe4\x04\x56\xa8\xa0\x54\x9a\x45\xd5\xf7\x0f\x16\xfc\x57\x1c\x3c\xdf\x23\xba\x77\x38\xda\x16\x4b\x31\x53\x6a\x4d\x9a\x15\x63\xe7\xe1\x18\x69\x9f\x22\xe0\x24\xbb\x94\x4b\x97\xee\x2d\xf9\x70\x87\x72\x7b\xe6\xc4\x33\x2a\x66\x5e\x1c\x35\x72\xe3\x2d\xda\x73\xe4\xc7\x51\x6d\xa4\xa1\x2a\x4f\xde\x94\xcb\xb2\x3e\x31\x48\xae\x82\xce\xc9\xc8\x65\xcd\xc3\xb7\x34\xb6\x2b\xdf\x58\x65\x78\x6e\x73\xac\x5e\x24\x0d\x3f\xdc\x70\x23\xc6\xda\x52\x0b\x2d\x63\x7d\xa9\x49\x2d\x54\x48\x28\xc0\x12\x9c\xe3\x63\xc9\x58\x04\x98\x36\x07\xc8\x0a\xa7\x91\xd4\xf0\xbc\xc1\xa8\xb9\x70\xd0\xc6\xa9\xb6\x78\x80\x5a\xa3\xb4\x2c\xf4\x18\x0b\x8a\x9d\xd0\xb4\x55\x10\xee\x0d\xc5\xd6\xe0\x99\x93\xdc\xa1\x04\xbb\xf1\xa7\x23\xd1\xd1\x97\x8c\x87\x13\x0a\x21\x02\xe9\x99\x25\xed\x20\xc5\x92\x66\x3c\x32\x9c\xd6\x06\xb0\x31\x5c\x86\x29\x0a\xcb\x60\x33\x12\xa5\x91\xfc\x96\x75\xd0\x59\xd7\x13\xbd\xd3\x23\x79\xdd\x2a\x90\xa6\x38\x06\x91\x39\x7f\x20\x72\x03\x1c\x2d\x01\x61\xba\x45\x37\x38\x22\x61\x8e\x71\x85\xc4\x32\x15\x28\x60\x61\x16\xb8\x3d\x29\xdc\x4d\x3d\x2f\x12\x13\x7d\xc8\x7e\x37\xee\xa8\x7f\xfa\xdb\xcb\x17\xff\x77\xfd\xf9\x7f\xee\x9f\x3d\xfe\xcf\xa7\xa7\x45\xfb\xcf\x1e\xf7\xf3\xe0\xff\xc4\x51\x0a\x8e\x4c\xcb\x01\xdc\x0a\x65\xb2\x01\x83\xed\x3d\xe4\xa9\xa3\x4e\x2d\x59\xc5\xe8\x2f\x48\x7d\x5a\x6e\x37\xbf\x5c\x9f\x35\x13\x64\x14\xfa\xef\x0b\x68\xa6\x0d\xb4\x8e\xf1\xa8\xff\xbb\x60\xf4\x03\x64\xab\x5b\x81\x65\x51\xe6\xda\xca\xfa\xf0\xb0\xac\x3e\x9c\xca\x26\x0e\x1d\xdb\x57\x5b\xbb\xb4\x9a\xa6\xb6\x9b\x1a\x6b\xd1\x9a\x9e\x7e\x33\x9a\xec\x41\x69\x45\x22\xb8\xb4\x51\xeb\x04\x77\xca\x6f\x7b\x7b\xc8\xb2\xb0\x95\x92\x25\x5b\xd0\x42\xaa\x2a\xdd\x32\x78\x4f\x0c\xab\x68\x46\x6c\xea\x6d\xf4\x5c\x5e\xde\xc4\xac\xa5\xf9\xd1\x00\x9f\x7d\x98\x65\x24\xbd\xc7\x97\xd4\xb3\x3a\xa8\x2b\xa0\x34\x76\xf9\x65\x5f\x2d\x25\x95\x1b\xcf\xd6\xf4\x9b\x5f\x09\x95\xb0\x36\x3f\xdb\xd0\x39\x2a\x93\x1c\x9d\x03\xa2\x4a\xca\xf5\xf6\x10\xb6\x94\x89\x0b\x6a\x70\x12\x13\x49\x6e\x40\xe4\x29\x12\x2b\xbd\x80\x45\x11\x04\xaa\xc2\x8f\x56\x9e\x5c\x6b\xec\x8d\x5a\x0e\x14\x59\x06\x2b\x1e\x24\xcb\xc2\x56\x4a\x31\xbe\x23\x71\x1a\xfb\x51\x2a\x0b\x3b\x1c\x48\x10\xa5\x82\xdc\xc0\xbb\x3e\x24\x8d\x5a\x76\x2e\x09\xed\xc1\x65\x51\xb8\x83\xcb\x3e\x24\x8d\x5a\x2e\x5d\xfe\x02\x74\x2d\x3d\xf1\xef\xae\xb8\x4b\xe6\x5e\xd4\xaa\xe2\x2e\x5c\x5e\xec\x0e\xf5\x5b\x0c\xcb\x0a\xbb\xa4\x3c\xf7\x1f\x2a\x55\x69\x97\x8c\x7d\x68\x95\xa5\xad\xb4\xf4\x9c\xa5\x07\xb9\x7a\x05\xbb\xad\x50\x6f\xfb\xa0\x4e\x9b\x48\x23\x49\x92\x28\x87\x19\x3e\x32\xee\xca\x3b\x46\x7e\x7f\x18\x64\xcc\xcc\x0f\x34\xe9\x36\x8b\xb7\x6c\xa8\xa5\x5b\x54\x4c\x54\x5b\x15\x3a\xf1\x6c\x2d\xfe\x96\xc8\x0d\xba\x7b\x81\x88\xc8\x23\xab\xee\x7d\x3b\x92\xa7\x60\x29\xe3\xdc\xff\xb8\x64\xe1\xf6\xa2\x5a\x59\xdc\x6f\xeb\x45\x7d\x6a\xd1\x76\x1e\xea\xb8\xf1\xfa\x14\xd3\x36\x63\xe5\xd7\xf3\xe4\xbe\x25\xbd\x5e\x05\xeb\x73\x74\xb5\x21\x2a\x2e\x4e\xa3\x30\xdf\xbf\x43\x28\x2a\xd1\xa5\x2a\x9d\x8a\xfd\x76\xd8\x8d\xbc\x67\x65\xc7\xb8\x03\x45\xec\xa3\xb0\x37\x8a\x70\x4c\x68\x91\x51\x8e\x58\x80\xed\x4a\xf3\x81\x62\xca\x96\xbb\xf1\x52\xcd\x80\xfb\xe4\x4a\x5d\x6c\xdf\x6e\x20\x4b\x80\x30\x8e\x28\x93\xf9\xe9\x8d\x8a\x6d\xd5\x59\x65\x7b\xaa\x44\x9e\xc0\xc2\xd1\x7c\x40\x26\xd6\x1a\xce\xf9\xc5\x69\x7b\x6c\xec\xc8\x71\x7b\xe5\x21\x2e\xd3\xe5\x65\x93\x91\x53\x0b\x7b\x3a\xc7\xfa\x17\x6a\x01\xa7\x33\xd0\xf4\x40\x0f\x39\x87\xda\xe4\x54\x87\x3a\xd5\xe3\xc7\xa6\x8e\x20\xd4\x11\xb2\x4e\xb1\xe9\x14\x9b\x4e\xb1\xe9\x14\x9b\xfe\x15\x63\xd3\x47\xf5\xff\x97\x38\xe9\xcf\x14\xf8\x76\x82\x49\x13\x4c\xaa\x7d\xcd\x6c\x62\x42\x49\x87\x43\x49\x19\x33\x6f\xe3\x44\x6e\x9b\xab\x8a\x3e\x86\xaa\x99\x52\x1b\x5b\x59\x33\x02\x09\xa0\x21\xa1\x6b\x84\x6b\x66\xbb\xdc\x16\x0c\xd3\x68\xab\xec\x36\x4b\xd8\x60\x8a\x40\x31\x85\x6e\x14\x57\x13\xc2\xfb\x92\x10\xde\xbf\x88\xdc\xbc\x53\x5e\x7f\x82\x7a\x13\xd4\x9b\xa0\xde\x04\xf5\x90\x01\xf5\x94\xcb\x7b\x83\x25\x9e\xd0\xde\x84\xf6\x6a\x5f\x4b\xb3\x98\x00\xdf\x04\xf8\x6c\xbc\x7f\x19\x80\xaf\xf1\x71\x45\x22\x98\x40\xe0\x04\x02\x27\x10\xd8\x29\xf5\x04\x02\xff\x4a\x20\x30\xc1\x72\xf3\x65\x02\x40\xd7\xc1\xd1\xe2\x6b\xf1\xa9\x7b\xfb\xe4\x20\xc0\x68\x9d\xd4\xb4\xd3\x96\xb5\xa6\xd1\x41\x20\xe6\x89\xc3\x48\x65\x58\x13\x84\x9c\x56\x56\x3b\x0c\xe0\x6b\x83\x5c\x13\xd2\x9a\x90\xd6\x84\xb4\x26\xa4\x85\x0c\xa4\x45\x19\xfd\xff\x63\x6c\x52\xb5\x1f\x1e\x19\x74\x3a\xcd\xb9\x69\xce\xa6\x3a\x0f\x7a\x2d\x19\xc7\x81\x14\x5d\xcb\xd5\x03\xc9\x39\xd0\xb0\xd1\xb3\xcd\xfb\x7a\x2d\x5d\x3a\x48\xe1\xfa\x2e\xe6\x81\x42\x18\x86\xd6\xc1\xbe\xb1\x23\xd3\xf7\x34\xed\x19\x0a\x0b\xc4\x48\x44\xfd\x22\x50\xb6\x42\x58\xbb\xe5\x3d\xa7\x73\xd4\x8b\xc4\x8c\x70\x61\xec\x73\xee\xc3\x81\x8b\xf5\xe2\xd7\x52\x3e\xcf\xeb\xeb\x17\x3b\x71\x16\xda\x7d\xb8\xde\xf0\x7a\x8f\x06\x2d\xa7\x40\x7b\xc1\x9d\x41\x4d\xb6\x61\xa2\x4e\x9f\x3d\xa0\xc5\xae\xe3\x1c\x1d\x40\x6c\x48\x8b\x63\xa0\xb5\x01\xed\x8e\x02\xe9\x86\xc8\x3b\x06\xee\xdb\x4b\xde\xbd\xc0\xa1\x6f\xcb\xda\xfc\xc2\x44\x16\x87\x9c\x17\x31\xd3\x30\x20\x39\x42\xcb\x6f\xf2\xf1\xf4\x72\x10\xf8\x1c\xa0\xf3\xbd\x10\xea\x21\x35\x7d\xe8\x86\xdb\x15\xed\x81\x81\x07\x28\xbb\x13\x28\xc7\xf8\xce\x7d\x8d\xc2\x31\xb4\x7e\x94\xd6\xdb\x55\xef\x4a\xfb\xed\xc3\x40\x3e\xeb\x9f\xe9\x99\x0f\xdf\x08\x65\x88\x27\x73\x86\x31\x9d\x47\xdf\x55\x19\xba\x3d\xee\x15\x0a\xcd\x8c\xaa\x5e\xb9\xf6\x57\x33\x73\x5a\xa1\x89\x7b\x3b\xa0\xb2\xa4\xc2\xf6\xc1\x53\xb5\x00\xca\x23\xe5\xf4\x60\x6a\xb4\x2d\x74\xea\x4e\xed\x3b\xe3\x47\xfb\xed\x82\x3d\x19\xd4\x3b\x6b\xaf\xae\x2b\x2f\x57\xb3\x82\x68\xcb\xed\x88\x2e\xe1\x5c\xd7\x26\xfa\x0a\x65\xe7\xce\x11\x33\xb4\xdd\x66\xe3\x37\xf6\xfa\x70\xd6\x4f\xa1\x21\x51\xd8\x3c\x26\x14\x4b\xc6\x87\x44\x27\x1c\x70\xf8\x9e\x46\xce\xab\x21\x07\x5f\xc1\x76\x17\x1b\x77\xb4\xda\x75\xa0\x0a\x3a\x30\xe1\xf8\x97\x32\x16\x2b\x00\x75\x85\xee\x62\x46\xef\xd3\x85\xb5\x6b\x60\xbe\xf2\x30\x7a\x8c\x0b\x4b\xa6\xd0\xf9\x64\x42\xe7\x07\x41\x41\xe3\x2c\x5d\xf9\x6d\xe9\x39\x98\x3b\x3b\x5d\x67\xd4\x5c\xed\xf2\xf0\x48\x7b\xbd\x2d\x31\xdd\x3f\x34\xad\x44\x76\x51\x9a\x56\x22\xa7\x95\xc8\x69\x25\xf2\xe1\x56\x22\x1f\x00\x32\x6a\x73\x92\xed\xe1\xc6\x7d\x9f\x49\x2c\x69\x7e\xc8\x31\x4c\x0c\xb4\xf2\x54\x3b\x79\x3b\x9e\x4d\xb4\xd1\x18\x3e\x5f\x9a\x93\xa2\x11\xc3\xda\x27\x0b\xaf\x37\x2e\x5c\x37\xfb\xeb\x9a\xd6\xc3\xac\xc3\xcc\xf8\x1e\x5b\x9d\xac\x22\x64\xb7\xed\x26\xb8\xf3\xb9\x3c\xbb\x1f\xe2\xb0\x22\x77\x43\x6a\x62\x29\x39\x59\xa6\xe6\xe5\xcd\x7b\x83\xc0\x5b\x8e\x93\x64\xac\xeb\xca\x4f\x65\xac\x4a\xbc\x1e\xcd\x82\xfa\x3c\x70\x36\xb6\xb5\xed\x79\xef\xec\x68\x00\xff\x54\xfa\xb5\xe3\xf1\xdb\xe1\xbe\xce\x76\x17\xaf\x57\xb6\x6b\x89\x05\x09\xce\x52\xb9\x01\x2a\x49\xbe\xd9\xf4\xd2\xb8\x7a\xbf\x91\x02\xf3\x22\x8c\x13\xf2\x77\xd8\x8e\x43\x8b\xe1\x54\x6e\x5e\x9d\xc7\x49\x44\x02\x22\xc7\xa4\x79\x81\x85\xb8\x65\x3c\x1c\x93\xe6\x59\xa2\xf8\x1c\x51\x95\x05\xd9\x20\x00\x21\x7e\x60\x21\x58\xa9\x56\xff\xbe\xb6\x5a\x5e\x5b\x3f\x1f\xd6\xd3\x3c\xc4\x4d\xba\x99\xb4\x63\x6e\x7d\x3e\x3d\x57\xd2\x18\x5f\x47\xe8\xc3\x06\x8a\x68\x6c\x7f\x3b\x72\x0f\xe7\xe2\x77\x77\xf1\xd0\x99\xab\xdf\x2e\xfe\xd6\xbb\xcd\x1a\xb9\x90\xd1\xaf\xf2\x38\x3d\xdb\x74\xf8\xeb\xe3\xda\xe8\x2a\x62\xb7\xda\x1b\x07\xa9\xdc\x30\x5e\xbc\x68\xfb\x6b\x9f\x97\xf1\xc6\xb1\xd8\x5c\x29\x1e\x49\x30\xc5\xf7\xde\xad\x91\x42\xf9\xdd\xed\x89\x80\x25\xbe\x37\xd7\xe7\x32\x5c\xe6\x35\xac\xd4\x0c\x2d\xf7\x90\xc4\xe3\xf5\xe3\x2f\x7f\x54\x18\x88\xe3\x61\x47\x85\x64\x7f\xc0\xd7\x3f\x1a\x92\x42\xe9\xc7\x1e\x0d\x95\x76\xa7\x51\xa0\x8f\x02\x1b\x46\x9e\x06\x42\xd1\xf2\x01\x07\x02\xde\xe9\x7d\x1a\x0b\xa7\x32\x16\xcc\xc0\xee\xc4\x90\xd2\x5f\x6f\x98\x54\x5d\xf2\x95\xe1\xa7\x69\x10\x3a\x06\xe1\x65\xb3\x17\x47\x58\x78\xd0\x45\xd6\x5b\xd5\x5f\x25\x1d\x71\x49\xa6\x7a\x64\xda\xd0\x6f\xc7\x3a\x4c\xe3\x09\xc0\x6e\x96\x2c\xa7\xa7\x77\x34\x10\x05\x08\x21\x44\x92\x65\x77\xdf\x20\x5c\xbc\xe7\x97\x3f\xf4\x1a\x45\xd6\xe7\x27\x4a\xde\x74\x27\x66\x11\x7d\x70\xba\xd3\x78\xf9\x1e\x0d\xca\xc8\x39\xde\x7c\xb3\xa6\xe1\xbc\xd7\xc1\x6a\x6f\xb3\x0e\x52\xbe\xe4\x98\x8a\x15\x70\x94\x70\x26\x59\xc0\xa2\xf2\x1c\xfb\xd9\xc5\xf9\xbc\xd5\x92\x9c\xa3\xdf\xe6\x1e\xb3\x0d\x49\xba\x87\x50\x5f\x84\xfe\xe9\xd6\xf8\xbb\xe6\xf0\x7a\xeb\xa6\x65\x3b\x86\x8b\x79\x93\xf5\x59\x20\x6e\xb4\xa7\x44\xf4\x3f\xa5\xfe\x67\x42\x12\xdb\xd3\xe7\xbb\xa5\xa3\x8c\x5c\x2b\x97\xbb\xbb\x7f\x8e\xc5\x6e\xed\x43\x5c\xbf\x74\xc8\x8f\xff\xe6\xd6\xbe\x91\xb6\xf5\x95\xe4\xed\x93\xc4\xa8\x5b\xf9\x76\x4d\x35\xb7\xd8\x8c\xb6\x7d\xaf\x72\xe0\xb6\xbd\x01\x63\x9e\x76\xab\x1a\x32\x76\xe4\x8c\x76\xc2\xad\x6c\xa2\x65\xf7\xcf\xf8\xa7\xda\x2a\xb9\x8c\x3d\x3c\xa3\x9d\x64\x33\xe5\x1a\xb5\x2d\xfb\x86\xa2\x5a\x7f\x19\x5b\x7f\xc6\x3f\xd1\x53\xd3\xe2\x41\x5b\xd3\x4f\xf0\xec\xb0\x42\x73\x43\xd2\x68\x27\xd3\x6a\x6a\x34\xf6\x4e\x1e\x52\x8b\x87\x6c\xcc\xae\x44\xfb\x9e\xa7\x51\x4f\x9d\x55\x03\x81\x8e\x67\xfc\xb4\x69\xf0\x3a\x18\xf2\x40\xd0\xf6\xa8\x34\xe3\xc9\x98\xaf\xf6\xda\x24\xd3\xeb\x60\xb9\x0e\xd3\x1f\xa9\xff\xee\x1f\xfd\x37\x00\x00\xff\xff\x69\x5d\x0a\x6a\x39\x9d\x00\x00") - -func v2SchemaJSONBytes() ([]byte, error) { - return bindataRead( - _v2SchemaJSON, - "v2/schema.json", - ) -} - -func v2SchemaJSON() (*asset, error) { - bytes, err := v2SchemaJSONBytes() - if err != nil { - return nil, err - } - - info := bindataFileInfo{name: "v2/schema.json", size: 40249, mode: os.FileMode(420), modTime: time.Unix(1482389892, 0)} - a := &asset{bytes: bytes, info: info} - return a, nil -} - -// Asset loads and returns the asset for the given name. -// It returns an error if the asset could not be found or -// could not be loaded. -func Asset(name string) ([]byte, error) { - cannonicalName := strings.Replace(name, "\\", "/", -1) - if f, ok := _bindata[cannonicalName]; ok { - a, err := f() - if err != nil { - return nil, fmt.Errorf("Asset %s can't read by error: %v", name, err) - } - return a.bytes, nil - } - return nil, fmt.Errorf("Asset %s not found", name) -} - -// MustAsset is like Asset but panics when Asset would return an error. -// It simplifies safe initialization of global variables. -func MustAsset(name string) []byte { - a, err := Asset(name) - if err != nil { - panic("asset: Asset(" + name + "): " + err.Error()) - } - - return a -} - -// AssetInfo loads and returns the asset info for the given name. -// It returns an error if the asset could not be found or -// could not be loaded. -func AssetInfo(name string) (os.FileInfo, error) { - cannonicalName := strings.Replace(name, "\\", "/", -1) - if f, ok := _bindata[cannonicalName]; ok { - a, err := f() - if err != nil { - return nil, fmt.Errorf("AssetInfo %s can't read by error: %v", name, err) - } - return a.info, nil - } - return nil, fmt.Errorf("AssetInfo %s not found", name) -} - -// AssetNames returns the names of the assets. -func AssetNames() []string { - names := make([]string, 0, len(_bindata)) - for name := range _bindata { - names = append(names, name) - } - return names -} - -// _bindata is a table, holding each asset generator, mapped to its name. -var _bindata = map[string]func() (*asset, error){ - "jsonschema-draft-04.json": jsonschemaDraft04JSON, - "v2/schema.json": v2SchemaJSON, -} - -// AssetDir returns the file names below a certain -// directory embedded in the file by go-bindata. -// For example if you run go-bindata on data/... and data contains the -// following hierarchy: -// data/ -// foo.txt -// img/ -// a.png -// b.png -// then AssetDir("data") would return []string{"foo.txt", "img"} -// AssetDir("data/img") would return []string{"a.png", "b.png"} -// AssetDir("foo.txt") and AssetDir("notexist") would return an error -// AssetDir("") will return []string{"data"}. -func AssetDir(name string) ([]string, error) { - node := _bintree - if len(name) != 0 { - cannonicalName := strings.Replace(name, "\\", "/", -1) - pathList := strings.Split(cannonicalName, "/") - for _, p := range pathList { - node = node.Children[p] - if node == nil { - return nil, fmt.Errorf("Asset %s not found", name) - } - } - } - if node.Func != nil { - return nil, fmt.Errorf("Asset %s not found", name) - } - rv := make([]string, 0, len(node.Children)) - for childName := range node.Children { - rv = append(rv, childName) - } - return rv, nil -} - -type bintree struct { - Func func() (*asset, error) - Children map[string]*bintree -} -var _bintree = &bintree{nil, map[string]*bintree{ - "jsonschema-draft-04.json": &bintree{jsonschemaDraft04JSON, map[string]*bintree{}}, - "v2": &bintree{nil, map[string]*bintree{ - "schema.json": &bintree{v2SchemaJSON, map[string]*bintree{}}, - }}, -}} - -// RestoreAsset restores an asset under the given directory -func RestoreAsset(dir, name string) error { - data, err := Asset(name) - if err != nil { - return err - } - info, err := AssetInfo(name) - if err != nil { - return err - } - err = os.MkdirAll(_filePath(dir, filepath.Dir(name)), os.FileMode(0755)) - if err != nil { - return err - } - err = ioutil.WriteFile(_filePath(dir, name), data, info.Mode()) - if err != nil { - return err - } - err = os.Chtimes(_filePath(dir, name), info.ModTime(), info.ModTime()) - if err != nil { - return err - } - return nil -} - -// RestoreAssets restores an asset under the given directory recursively -func RestoreAssets(dir, name string) error { - children, err := AssetDir(name) - // File - if err != nil { - return RestoreAsset(dir, name) - } - // Dir - for _, child := range children { - err = RestoreAssets(dir, filepath.Join(name, child)) - if err != nil { - return err - } - } - return nil -} - -func _filePath(dir, name string) string { - cannonicalName := strings.Replace(name, "\\", "/", -1) - return filepath.Join(append([]string{dir}, strings.Split(cannonicalName, "/")...)...) -} - diff --git a/vendor/github.com/go-openapi/spec/contact_info.go b/vendor/github.com/go-openapi/spec/contact_info.go deleted file mode 100644 index f285970a..00000000 --- a/vendor/github.com/go-openapi/spec/contact_info.go +++ /dev/null @@ -1,24 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -// ContactInfo contact information for the exposed API. -// -// For more information: http://goo.gl/8us55a#contactObject -type ContactInfo struct { - Name string `json:"name,omitempty"` - URL string `json:"url,omitempty"` - Email string `json:"email,omitempty"` -} diff --git a/vendor/github.com/go-openapi/spec/expander.go b/vendor/github.com/go-openapi/spec/expander.go deleted file mode 100644 index b4429a21..00000000 --- a/vendor/github.com/go-openapi/spec/expander.go +++ /dev/null @@ -1,900 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "fmt" - "log" - "net/url" - "os" - "path/filepath" - "reflect" - "strings" - "sync" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -var ( - // Debug enables logging when SWAGGER_DEBUG env var is not empty - Debug = os.Getenv("SWAGGER_DEBUG") != "" -) - -// ExpandOptions provides options for expand. -type ExpandOptions struct { - RelativeBase string - SkipSchemas bool - ContinueOnError bool -} - -// ResolutionCache a cache for resolving urls -type ResolutionCache interface { - Get(string) (interface{}, bool) - Set(string, interface{}) -} - -type simpleCache struct { - lock sync.Mutex - store map[string]interface{} -} - -var resCache ResolutionCache - -func init() { - resCache = initResolutionCache() -} - -func initResolutionCache() ResolutionCache { - return &simpleCache{store: map[string]interface{}{ - "http://swagger.io/v2/schema.json": MustLoadSwagger20Schema(), - "http://json-schema.org/draft-04/schema": MustLoadJSONSchemaDraft04(), - }} -} - -func (s *simpleCache) Get(uri string) (interface{}, bool) { - debugLog("getting %q from resolution cache", uri) - s.lock.Lock() - v, ok := s.store[uri] - debugLog("got %q from resolution cache: %t", uri, ok) - - s.lock.Unlock() - return v, ok -} - -func (s *simpleCache) Set(uri string, data interface{}) { - s.lock.Lock() - s.store[uri] = data - s.lock.Unlock() -} - -// ResolveRefWithBase resolves a reference against a context root with preservation of base path -func ResolveRefWithBase(root interface{}, ref *Ref, opts *ExpandOptions) (*Schema, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(Schema) - if err := resolver.Resolve(ref, result); err != nil { - return nil, err - } - return result, nil -} - -// ResolveRef resolves a reference against a context root -func ResolveRef(root interface{}, ref *Ref) (*Schema, error) { - return ResolveRefWithBase(root, ref, nil) -} - -// ResolveParameter resolves a paramter reference against a context root -func ResolveParameter(root interface{}, ref Ref) (*Parameter, error) { - return ResolveParameterWithBase(root, ref, nil) -} - -// ResolveParameterWithBase resolves a paramter reference against a context root and base path -func ResolveParameterWithBase(root interface{}, ref Ref, opts *ExpandOptions) (*Parameter, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(Parameter) - if err := resolver.Resolve(&ref, result); err != nil { - return nil, err - } - return result, nil -} - -// ResolveResponse resolves response a reference against a context root -func ResolveResponse(root interface{}, ref Ref) (*Response, error) { - return ResolveResponseWithBase(root, ref, nil) -} - -// ResolveResponseWithBase resolves response a reference against a context root and base path -func ResolveResponseWithBase(root interface{}, ref Ref, opts *ExpandOptions) (*Response, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(Response) - if err := resolver.Resolve(&ref, result); err != nil { - return nil, err - } - return result, nil -} - -// ResolveItems resolves header and parameter items reference against a context root and base path -func ResolveItems(root interface{}, ref Ref, opts *ExpandOptions) (*Items, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(Items) - if err := resolver.Resolve(&ref, result); err != nil { - return nil, err - } - return result, nil -} - -// ResolvePathItem resolves response a path item against a context root and base path -func ResolvePathItem(root interface{}, ref Ref, opts *ExpandOptions) (*PathItem, error) { - resolver, err := defaultSchemaLoader(root, nil, opts, nil) - if err != nil { - return nil, err - } - - result := new(PathItem) - if err := resolver.Resolve(&ref, result); err != nil { - return nil, err - } - return result, nil -} - -type schemaLoader struct { - loadingRef *Ref - startingRef *Ref - currentRef *Ref - root interface{} - options *ExpandOptions - cache ResolutionCache - loadDoc func(string) (json.RawMessage, error) -} - -var idPtr, _ = jsonpointer.New("/id") -var refPtr, _ = jsonpointer.New("/$ref") - -// PathLoader function to use when loading remote refs -var PathLoader func(string) (json.RawMessage, error) - -func init() { - PathLoader = func(path string) (json.RawMessage, error) { - data, err := swag.LoadFromFileOrHTTP(path) - if err != nil { - return nil, err - } - return json.RawMessage(data), nil - } -} - -func defaultSchemaLoader( - root interface{}, - ref *Ref, - expandOptions *ExpandOptions, - cache ResolutionCache) (*schemaLoader, error) { - - if cache == nil { - cache = resCache - } - if expandOptions == nil { - expandOptions = &ExpandOptions{} - } - - var ptr *jsonpointer.Pointer - if ref != nil { - ptr = ref.GetPointer() - } - - currentRef := nextRef(root, ref, ptr) - - return &schemaLoader{ - loadingRef: ref, - startingRef: ref, - currentRef: currentRef, - root: root, - options: expandOptions, - cache: cache, - loadDoc: func(path string) (json.RawMessage, error) { - debugLog("fetching document at %q", path) - return PathLoader(path) - }, - }, nil -} - -func idFromNode(node interface{}) (*Ref, error) { - if idValue, _, err := idPtr.Get(node); err == nil { - if refStr, ok := idValue.(string); ok && refStr != "" { - idRef, err := NewRef(refStr) - if err != nil { - return nil, err - } - return &idRef, nil - } - } - return nil, nil -} - -func nextRef(startingNode interface{}, startingRef *Ref, ptr *jsonpointer.Pointer) *Ref { - if startingRef == nil { - return nil - } - - if ptr == nil { - return startingRef - } - - ret := startingRef - var idRef *Ref - node := startingNode - - for _, tok := range ptr.DecodedTokens() { - node, _, _ = jsonpointer.GetForToken(node, tok) - if node == nil { - break - } - - idRef, _ = idFromNode(node) - if idRef != nil { - nw, err := ret.Inherits(*idRef) - if err != nil { - break - } - ret = nw - } - - refRef, _, _ := refPtr.Get(node) - if refRef != nil { - var rf Ref - switch value := refRef.(type) { - case string: - rf, _ = NewRef(value) - } - nw, err := ret.Inherits(rf) - if err != nil { - break - } - nwURL := nw.GetURL() - if nwURL.Scheme == "file" || (nwURL.Scheme == "" && nwURL.Host == "") { - nwpt := filepath.ToSlash(nwURL.Path) - if filepath.IsAbs(nwpt) { - _, err := os.Stat(nwpt) - if err != nil { - nwURL.Path = filepath.Join(".", nwpt) - } - } - } - - ret = nw - } - - } - - return ret -} - -func debugLog(msg string, args ...interface{}) { - if Debug { - log.Printf(msg, args...) - } -} - -func normalizeFileRef(ref *Ref, relativeBase string) *Ref { - refURL := ref.GetURL() - debugLog("normalizing %s against %s (%s)", ref.String(), relativeBase, refURL.String()) - if strings.HasPrefix(refURL.String(), "#") { - return ref - } - - if refURL.Scheme == "file" || (refURL.Scheme == "" && refURL.Host == "") { - filePath := refURL.Path - debugLog("normalizing file path: %s", filePath) - - if !filepath.IsAbs(filepath.FromSlash(filePath)) && len(relativeBase) != 0 { - debugLog("joining %s with %s", relativeBase, filePath) - if fi, err := os.Stat(filepath.FromSlash(relativeBase)); err == nil { - if !fi.IsDir() { - relativeBase = filepath.Dir(filepath.FromSlash(relativeBase)) - } - } - filePath = filepath.Join(filepath.FromSlash(relativeBase), filepath.FromSlash(filePath)) - } - if !filepath.IsAbs(filepath.FromSlash(filePath)) { - pwd, err := os.Getwd() - if err == nil { - debugLog("joining cwd %s with %s", pwd, filePath) - filePath = filepath.Join(pwd, filepath.FromSlash(filePath)) - } - } - - debugLog("cleaning %s", filePath) - filePath = filepath.Clean(filepath.FromSlash(filePath)) - _, err := os.Stat(filepath.FromSlash(filePath)) - if err == nil { - debugLog("rewriting url %s to scheme \"\" path %s", refURL.String(), filePath) - slp := filepath.FromSlash(filePath) - if filepath.IsAbs(slp) && filepath.Separator == '\\' && len(slp) > 1 && slp[1] == ':' && ('a' <= slp[0] && slp[0] <= 'z' || 'A' <= slp[0] && slp[0] <= 'Z') { - slp = slp[2:] - } - refURL.Scheme = "" - refURL.Path = filepath.ToSlash(slp) - debugLog("new url with joined filepath: %s", refURL.String()) - *ref = MustCreateRef(refURL.String()) - } - } - - debugLog("refurl: %s", ref.GetURL().String()) - return ref -} - -func (r *schemaLoader) resolveRef(currentRef, ref *Ref, node, target interface{}) error { - - tgt := reflect.ValueOf(target) - if tgt.Kind() != reflect.Ptr { - return fmt.Errorf("resolve ref: target needs to be a pointer") - } - - oldRef := currentRef - - if currentRef != nil { - debugLog("resolve ref current %s new %s", currentRef.String(), ref.String()) - nextRef := nextRef(node, ref, currentRef.GetPointer()) - if nextRef == nil || nextRef.GetURL() == nil { - return nil - } - var err error - currentRef, err = currentRef.Inherits(*nextRef) - debugLog("resolved ref current %s", currentRef.String()) - if err != nil { - return err - } - } - - if currentRef == nil { - currentRef = ref - } - - refURL := currentRef.GetURL() - if refURL == nil { - return nil - } - if currentRef.IsRoot() { - nv := reflect.ValueOf(node) - reflect.Indirect(tgt).Set(reflect.Indirect(nv)) - return nil - } - - if strings.HasPrefix(refURL.String(), "#") { - res, _, err := ref.GetPointer().Get(node) - if err != nil { - res, _, err = ref.GetPointer().Get(r.root) - if err != nil { - return err - } - } - rv := reflect.Indirect(reflect.ValueOf(res)) - tgtType := reflect.Indirect(tgt).Type() - if rv.Type().AssignableTo(tgtType) { - reflect.Indirect(tgt).Set(reflect.Indirect(reflect.ValueOf(res))) - } else { - if err := swag.DynamicJSONToStruct(rv.Interface(), target); err != nil { - return err - } - } - - return nil - } - - relativeBase := "" - if r.options != nil && r.options.RelativeBase != "" { - relativeBase = r.options.RelativeBase - } - normalizeFileRef(currentRef, relativeBase) - debugLog("current ref normalized file: %s", currentRef.String()) - normalizeFileRef(ref, relativeBase) - debugLog("ref normalized file: %s", currentRef.String()) - - data, _, _, err := r.load(currentRef.GetURL()) - if err != nil { - return err - } - - if ((oldRef == nil && currentRef != nil) || - (oldRef != nil && currentRef == nil) || - oldRef.String() != currentRef.String()) && - ((oldRef == nil && ref != nil) || - (oldRef != nil && ref == nil) || - (oldRef.String() != ref.String())) { - - return r.resolveRef(currentRef, ref, data, target) - } - - var res interface{} - if currentRef.String() != "" { - res, _, err = currentRef.GetPointer().Get(data) - if err != nil { - if strings.HasPrefix(ref.String(), "#") { - if r.loadingRef != nil { - rr, er := r.loadingRef.Inherits(*ref) - if er != nil { - return er - } - refURL = rr.GetURL() - - data, _, _, err = r.load(refURL) - if err != nil { - return err - } - } else { - data = r.root - } - } - - res, _, err = ref.GetPointer().Get(data) - if err != nil { - return err - } - } - } else { - res = data - } - - if err := swag.DynamicJSONToStruct(res, target); err != nil { - return err - } - - r.currentRef = currentRef - - return nil -} - -func (r *schemaLoader) load(refURL *url.URL) (interface{}, url.URL, bool, error) { - debugLog("loading schema from url: %s", refURL) - toFetch := *refURL - toFetch.Fragment = "" - - data, fromCache := r.cache.Get(toFetch.String()) - if !fromCache { - b, err := r.loadDoc(toFetch.String()) - if err != nil { - return nil, url.URL{}, false, err - } - - if err := json.Unmarshal(b, &data); err != nil { - return nil, url.URL{}, false, err - } - r.cache.Set(toFetch.String(), data) - } - - return data, toFetch, fromCache, nil -} - -func (r *schemaLoader) Resolve(ref *Ref, target interface{}) error { - return r.resolveRef(r.currentRef, ref, r.root, target) -} - -func (r *schemaLoader) reset() { - ref := r.startingRef - - var ptr *jsonpointer.Pointer - if ref != nil { - ptr = ref.GetPointer() - } - - r.currentRef = nextRef(r.root, ref, ptr) -} - -// ExpandSpec expands the references in a swagger spec -func ExpandSpec(spec *Swagger, options *ExpandOptions) error { - resolver, err := defaultSchemaLoader(spec, nil, options, nil) - // Just in case this ever returns an error. - if shouldStopOnError(err, resolver.options) { - return err - } - - if options == nil || !options.SkipSchemas { - for key, definition := range spec.Definitions { - var def *Schema - var err error - if def, err = expandSchema(definition, []string{"#/definitions/" + key}, resolver); shouldStopOnError(err, resolver.options) { - return err - } - resolver.reset() - spec.Definitions[key] = *def - } - } - - for key, parameter := range spec.Parameters { - if err := expandParameter(¶meter, resolver); shouldStopOnError(err, resolver.options) { - return err - } - spec.Parameters[key] = parameter - } - - for key, response := range spec.Responses { - if err := expandResponse(&response, resolver); shouldStopOnError(err, resolver.options) { - return err - } - spec.Responses[key] = response - } - - if spec.Paths != nil { - for key, path := range spec.Paths.Paths { - if err := expandPathItem(&path, resolver); shouldStopOnError(err, resolver.options) { - return err - } - spec.Paths.Paths[key] = path - } - } - - return nil -} - -func shouldStopOnError(err error, opts *ExpandOptions) bool { - if err != nil && !opts.ContinueOnError { - return true - } - - if err != nil { - log.Println(err) - } - - return false -} - -// ExpandSchema expands the refs in the schema object -func ExpandSchema(schema *Schema, root interface{}, cache ResolutionCache) error { - return ExpandSchemaWithBasePath(schema, root, cache, nil) -} - -// ExpandSchemaWithBasePath expands the refs in the schema object, base path configured through expand options -func ExpandSchemaWithBasePath(schema *Schema, root interface{}, cache ResolutionCache, opts *ExpandOptions) error { - if schema == nil { - return nil - } - if root == nil { - root = schema - } - - nrr, _ := NewRef(schema.ID) - var rrr *Ref - if nrr.String() != "" { - switch rt := root.(type) { - case *Schema: - rid, _ := NewRef(rt.ID) - rrr, _ = rid.Inherits(nrr) - case *Swagger: - rid, _ := NewRef(rt.ID) - rrr, _ = rid.Inherits(nrr) - } - } - - resolver, err := defaultSchemaLoader(root, rrr, opts, cache) - if err != nil { - return err - } - - refs := []string{""} - if rrr != nil { - refs[0] = rrr.String() - } - var s *Schema - if s, err = expandSchema(*schema, refs, resolver); err != nil { - return err - } - *schema = *s - return nil -} - -func expandItems(target Schema, parentRefs []string, resolver *schemaLoader) (*Schema, error) { - if target.Items != nil { - if target.Items.Schema != nil { - t, err := expandSchema(*target.Items.Schema, parentRefs, resolver) - if err != nil { - if target.Items.Schema.ID == "" { - target.Items.Schema.ID = target.ID - if err != nil { - t, err = expandSchema(*target.Items.Schema, parentRefs, resolver) - if err != nil { - return nil, err - } - } - } - } - *target.Items.Schema = *t - } - for i := range target.Items.Schemas { - t, err := expandSchema(target.Items.Schemas[i], parentRefs, resolver) - if err != nil { - return nil, err - } - target.Items.Schemas[i] = *t - } - } - return &target, nil -} - -func expandSchema(target Schema, parentRefs []string, resolver *schemaLoader) (*Schema, error) { - if target.Ref.String() == "" && target.Ref.IsRoot() { - debugLog("skipping expand schema for no ref and root: %v", resolver.root) - - return resolver.root.(*Schema), nil - } - - // t is the new expanded schema - var t *Schema - - for target.Ref.String() != "" { - if swag.ContainsStringsCI(parentRefs, target.Ref.String()) { - return &target, nil - } - - if err := resolver.Resolve(&target.Ref, &t); shouldStopOnError(err, resolver.options) { - return &target, err - } - - if swag.ContainsStringsCI(parentRefs, target.Ref.String()) { - debugLog("ref already exists in parent") - return &target, nil - } - parentRefs = append(parentRefs, target.Ref.String()) - if t != nil { - target = *t - } - } - - t, err := expandItems(target, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - target = *t - } - - for i := range target.AllOf { - t, err := expandSchema(target.AllOf[i], parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - target.AllOf[i] = *t - } - } - for i := range target.AnyOf { - t, err := expandSchema(target.AnyOf[i], parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - target.AnyOf[i] = *t - } - for i := range target.OneOf { - t, err := expandSchema(target.OneOf[i], parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - target.OneOf[i] = *t - } - } - if target.Not != nil { - t, err := expandSchema(*target.Not, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - *target.Not = *t - } - } - for k := range target.Properties { - t, err := expandSchema(target.Properties[k], parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - target.Properties[k] = *t - } - } - if target.AdditionalProperties != nil && target.AdditionalProperties.Schema != nil { - t, err := expandSchema(*target.AdditionalProperties.Schema, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - *target.AdditionalProperties.Schema = *t - } - } - for k := range target.PatternProperties { - t, err := expandSchema(target.PatternProperties[k], parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - target.PatternProperties[k] = *t - } - } - for k := range target.Dependencies { - if target.Dependencies[k].Schema != nil { - t, err := expandSchema(*target.Dependencies[k].Schema, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - *target.Dependencies[k].Schema = *t - } - } - } - if target.AdditionalItems != nil && target.AdditionalItems.Schema != nil { - t, err := expandSchema(*target.AdditionalItems.Schema, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - *target.AdditionalItems.Schema = *t - } - } - for k := range target.Definitions { - t, err := expandSchema(target.Definitions[k], parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return &target, err - } - if t != nil { - target.Definitions[k] = *t - } - } - return &target, nil -} - -func expandPathItem(pathItem *PathItem, resolver *schemaLoader) error { - if pathItem == nil { - return nil - } - - if pathItem.Ref.String() != "" { - if err := resolver.Resolve(&pathItem.Ref, &pathItem); err != nil { - return err - } - resolver.reset() - pathItem.Ref = Ref{} - } - - for idx := range pathItem.Parameters { - if err := expandParameter(&(pathItem.Parameters[idx]), resolver); shouldStopOnError(err, resolver.options) { - return err - } - } - if err := expandOperation(pathItem.Get, resolver); shouldStopOnError(err, resolver.options) { - return err - } - if err := expandOperation(pathItem.Head, resolver); shouldStopOnError(err, resolver.options) { - return err - } - if err := expandOperation(pathItem.Options, resolver); shouldStopOnError(err, resolver.options) { - return err - } - if err := expandOperation(pathItem.Put, resolver); shouldStopOnError(err, resolver.options) { - return err - } - if err := expandOperation(pathItem.Post, resolver); shouldStopOnError(err, resolver.options) { - return err - } - if err := expandOperation(pathItem.Patch, resolver); shouldStopOnError(err, resolver.options) { - return err - } - if err := expandOperation(pathItem.Delete, resolver); shouldStopOnError(err, resolver.options) { - return err - } - return nil -} - -func expandOperation(op *Operation, resolver *schemaLoader) error { - if op == nil { - return nil - } - - for i, param := range op.Parameters { - if err := expandParameter(¶m, resolver); shouldStopOnError(err, resolver.options) { - return err - } - op.Parameters[i] = param - } - - if op.Responses != nil { - responses := op.Responses - if err := expandResponse(responses.Default, resolver); shouldStopOnError(err, resolver.options) { - return err - } - for code, response := range responses.StatusCodeResponses { - if err := expandResponse(&response, resolver); shouldStopOnError(err, resolver.options) { - return err - } - responses.StatusCodeResponses[code] = response - } - } - return nil -} - -func expandResponse(response *Response, resolver *schemaLoader) error { - if response == nil { - return nil - } - - var parentRefs []string - - if response.Ref.String() != "" { - parentRefs = append(parentRefs, response.Ref.String()) - if err := resolver.Resolve(&response.Ref, response); shouldStopOnError(err, resolver.options) { - return err - } - resolver.reset() - response.Ref = Ref{} - } - - if !resolver.options.SkipSchemas && response.Schema != nil { - parentRefs = append(parentRefs, response.Schema.Ref.String()) - debugLog("response ref: %s", response.Schema.Ref) - if err := resolver.Resolve(&response.Schema.Ref, &response.Schema); shouldStopOnError(err, resolver.options) { - return err - } - s, err := expandSchema(*response.Schema, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return err - } - resolver.reset() - *response.Schema = *s - } - return nil -} - -func expandParameter(parameter *Parameter, resolver *schemaLoader) error { - if parameter == nil { - return nil - } - - var parentRefs []string - - if parameter.Ref.String() != "" { - parentRefs = append(parentRefs, parameter.Ref.String()) - if err := resolver.Resolve(¶meter.Ref, parameter); shouldStopOnError(err, resolver.options) { - return err - } - resolver.reset() - parameter.Ref = Ref{} - } - if !resolver.options.SkipSchemas && parameter.Schema != nil { - parentRefs = append(parentRefs, parameter.Schema.Ref.String()) - if err := resolver.Resolve(¶meter.Schema.Ref, ¶meter.Schema); shouldStopOnError(err, resolver.options) { - return err - } - s, err := expandSchema(*parameter.Schema, parentRefs, resolver) - if shouldStopOnError(err, resolver.options) { - return err - } - resolver.reset() - *parameter.Schema = *s - } - return nil -} diff --git a/vendor/github.com/go-openapi/spec/external_docs.go b/vendor/github.com/go-openapi/spec/external_docs.go deleted file mode 100644 index 88add91b..00000000 --- a/vendor/github.com/go-openapi/spec/external_docs.go +++ /dev/null @@ -1,24 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -// ExternalDocumentation allows referencing an external resource for -// extended documentation. -// -// For more information: http://goo.gl/8us55a#externalDocumentationObject -type ExternalDocumentation struct { - Description string `json:"description,omitempty"` - URL string `json:"url,omitempty"` -} diff --git a/vendor/github.com/go-openapi/spec/header.go b/vendor/github.com/go-openapi/spec/header.go deleted file mode 100644 index 85c4d454..00000000 --- a/vendor/github.com/go-openapi/spec/header.go +++ /dev/null @@ -1,195 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "strings" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -type HeaderProps struct { - Description string `json:"description,omitempty"` -} - -// Header describes a header for a response of the API -// -// For more information: http://goo.gl/8us55a#headerObject -type Header struct { - CommonValidations - SimpleSchema - VendorExtensible - HeaderProps -} - -// ResponseHeader creates a new header instance for use in a response -func ResponseHeader() *Header { - return new(Header) -} - -// WithDescription sets the description on this response, allows for chaining -func (h *Header) WithDescription(description string) *Header { - h.Description = description - return h -} - -// Typed a fluent builder method for the type of parameter -func (h *Header) Typed(tpe, format string) *Header { - h.Type = tpe - h.Format = format - return h -} - -// CollectionOf a fluent builder method for an array item -func (h *Header) CollectionOf(items *Items, format string) *Header { - h.Type = "array" - h.Items = items - h.CollectionFormat = format - return h -} - -// WithDefault sets the default value on this item -func (h *Header) WithDefault(defaultValue interface{}) *Header { - h.Default = defaultValue - return h -} - -// WithMaxLength sets a max length value -func (h *Header) WithMaxLength(max int64) *Header { - h.MaxLength = &max - return h -} - -// WithMinLength sets a min length value -func (h *Header) WithMinLength(min int64) *Header { - h.MinLength = &min - return h -} - -// WithPattern sets a pattern value -func (h *Header) WithPattern(pattern string) *Header { - h.Pattern = pattern - return h -} - -// WithMultipleOf sets a multiple of value -func (h *Header) WithMultipleOf(number float64) *Header { - h.MultipleOf = &number - return h -} - -// WithMaximum sets a maximum number value -func (h *Header) WithMaximum(max float64, exclusive bool) *Header { - h.Maximum = &max - h.ExclusiveMaximum = exclusive - return h -} - -// WithMinimum sets a minimum number value -func (h *Header) WithMinimum(min float64, exclusive bool) *Header { - h.Minimum = &min - h.ExclusiveMinimum = exclusive - return h -} - -// WithEnum sets a the enum values (replace) -func (h *Header) WithEnum(values ...interface{}) *Header { - h.Enum = append([]interface{}{}, values...) - return h -} - -// WithMaxItems sets the max items -func (h *Header) WithMaxItems(size int64) *Header { - h.MaxItems = &size - return h -} - -// WithMinItems sets the min items -func (h *Header) WithMinItems(size int64) *Header { - h.MinItems = &size - return h -} - -// UniqueValues dictates that this array can only have unique items -func (h *Header) UniqueValues() *Header { - h.UniqueItems = true - return h -} - -// AllowDuplicates this array can have duplicates -func (h *Header) AllowDuplicates() *Header { - h.UniqueItems = false - return h -} - -// MarshalJSON marshal this to JSON -func (h Header) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(h.CommonValidations) - if err != nil { - return nil, err - } - b2, err := json.Marshal(h.SimpleSchema) - if err != nil { - return nil, err - } - b3, err := json.Marshal(h.HeaderProps) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b1, b2, b3), nil -} - -// UnmarshalJSON marshal this from JSON -func (h *Header) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &h.CommonValidations); err != nil { - return err - } - if err := json.Unmarshal(data, &h.SimpleSchema); err != nil { - return err - } - if err := json.Unmarshal(data, &h.VendorExtensible); err != nil { - return err - } - if err := json.Unmarshal(data, &h.HeaderProps); err != nil { - return err - } - return nil -} - -// JSONLookup look up a value by the json property name -func (p Header) JSONLookup(token string) (interface{}, error) { - if ex, ok := p.Extensions[token]; ok { - return &ex, nil - } - - r, _, err := jsonpointer.GetForToken(p.CommonValidations, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.SimpleSchema, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.HeaderProps, token) - return r, err -} diff --git a/vendor/github.com/go-openapi/spec/info.go b/vendor/github.com/go-openapi/spec/info.go deleted file mode 100644 index fb8b7c4a..00000000 --- a/vendor/github.com/go-openapi/spec/info.go +++ /dev/null @@ -1,168 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "strings" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -// Extensions vendor specific extensions -type Extensions map[string]interface{} - -// Add adds a value to these extensions -func (e Extensions) Add(key string, value interface{}) { - realKey := strings.ToLower(key) - e[realKey] = value -} - -// GetString gets a string value from the extensions -func (e Extensions) GetString(key string) (string, bool) { - if v, ok := e[strings.ToLower(key)]; ok { - str, ok := v.(string) - return str, ok - } - return "", false -} - -// GetBool gets a string value from the extensions -func (e Extensions) GetBool(key string) (bool, bool) { - if v, ok := e[strings.ToLower(key)]; ok { - str, ok := v.(bool) - return str, ok - } - return false, false -} - -// GetStringSlice gets a string value from the extensions -func (e Extensions) GetStringSlice(key string) ([]string, bool) { - if v, ok := e[strings.ToLower(key)]; ok { - arr, ok := v.([]interface{}) - if !ok { - return nil, false - } - var strs []string - for _, iface := range arr { - str, ok := iface.(string) - if !ok { - return nil, false - } - strs = append(strs, str) - } - return strs, ok - } - return nil, false -} - -// VendorExtensible composition block. -type VendorExtensible struct { - Extensions Extensions -} - -// AddExtension adds an extension to this extensible object -func (v *VendorExtensible) AddExtension(key string, value interface{}) { - if value == nil { - return - } - if v.Extensions == nil { - v.Extensions = make(map[string]interface{}) - } - v.Extensions.Add(key, value) -} - -// MarshalJSON marshals the extensions to json -func (v VendorExtensible) MarshalJSON() ([]byte, error) { - toser := make(map[string]interface{}) - for k, v := range v.Extensions { - lk := strings.ToLower(k) - if strings.HasPrefix(lk, "x-") { - toser[k] = v - } - } - return json.Marshal(toser) -} - -// UnmarshalJSON for this extensible object -func (v *VendorExtensible) UnmarshalJSON(data []byte) error { - var d map[string]interface{} - if err := json.Unmarshal(data, &d); err != nil { - return err - } - for k, vv := range d { - lk := strings.ToLower(k) - if strings.HasPrefix(lk, "x-") { - if v.Extensions == nil { - v.Extensions = map[string]interface{}{} - } - v.Extensions[k] = vv - } - } - return nil -} - -// InfoProps the properties for an info definition -type InfoProps struct { - Description string `json:"description,omitempty"` - Title string `json:"title,omitempty"` - TermsOfService string `json:"termsOfService,omitempty"` - Contact *ContactInfo `json:"contact,omitempty"` - License *License `json:"license,omitempty"` - Version string `json:"version,omitempty"` -} - -// Info object provides metadata about the API. -// The metadata can be used by the clients if needed, and can be presented in the Swagger-UI for convenience. -// -// For more information: http://goo.gl/8us55a#infoObject -type Info struct { - VendorExtensible - InfoProps -} - -// JSONLookup look up a value by the json property name -func (i Info) JSONLookup(token string) (interface{}, error) { - if ex, ok := i.Extensions[token]; ok { - return &ex, nil - } - r, _, err := jsonpointer.GetForToken(i.InfoProps, token) - return r, err -} - -// MarshalJSON marshal this to JSON -func (i Info) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(i.InfoProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(i.VendorExtensible) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b1, b2), nil -} - -// UnmarshalJSON marshal this from JSON -func (i *Info) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &i.InfoProps); err != nil { - return err - } - if err := json.Unmarshal(data, &i.VendorExtensible); err != nil { - return err - } - return nil -} diff --git a/vendor/github.com/go-openapi/spec/items.go b/vendor/github.com/go-openapi/spec/items.go deleted file mode 100644 index 46944fb6..00000000 --- a/vendor/github.com/go-openapi/spec/items.go +++ /dev/null @@ -1,219 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "strings" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -type SimpleSchema struct { - Type string `json:"type,omitempty"` - Format string `json:"format,omitempty"` - Items *Items `json:"items,omitempty"` - CollectionFormat string `json:"collectionFormat,omitempty"` - Default interface{} `json:"default,omitempty"` -} - -func (s *SimpleSchema) TypeName() string { - if s.Format != "" { - return s.Format - } - return s.Type -} - -func (s *SimpleSchema) ItemsTypeName() string { - if s.Items == nil { - return "" - } - return s.Items.TypeName() -} - -type CommonValidations struct { - Maximum *float64 `json:"maximum,omitempty"` - ExclusiveMaximum bool `json:"exclusiveMaximum,omitempty"` - Minimum *float64 `json:"minimum,omitempty"` - ExclusiveMinimum bool `json:"exclusiveMinimum,omitempty"` - MaxLength *int64 `json:"maxLength,omitempty"` - MinLength *int64 `json:"minLength,omitempty"` - Pattern string `json:"pattern,omitempty"` - MaxItems *int64 `json:"maxItems,omitempty"` - MinItems *int64 `json:"minItems,omitempty"` - UniqueItems bool `json:"uniqueItems,omitempty"` - MultipleOf *float64 `json:"multipleOf,omitempty"` - Enum []interface{} `json:"enum,omitempty"` -} - -// Items a limited subset of JSON-Schema's items object. -// It is used by parameter definitions that are not located in "body". -// -// For more information: http://goo.gl/8us55a#items-object -type Items struct { - Refable - CommonValidations - SimpleSchema - VendorExtensible -} - -// NewItems creates a new instance of items -func NewItems() *Items { - return &Items{} -} - -// Typed a fluent builder method for the type of item -func (i *Items) Typed(tpe, format string) *Items { - i.Type = tpe - i.Format = format - return i -} - -// CollectionOf a fluent builder method for an array item -func (i *Items) CollectionOf(items *Items, format string) *Items { - i.Type = "array" - i.Items = items - i.CollectionFormat = format - return i -} - -// WithDefault sets the default value on this item -func (i *Items) WithDefault(defaultValue interface{}) *Items { - i.Default = defaultValue - return i -} - -// WithMaxLength sets a max length value -func (i *Items) WithMaxLength(max int64) *Items { - i.MaxLength = &max - return i -} - -// WithMinLength sets a min length value -func (i *Items) WithMinLength(min int64) *Items { - i.MinLength = &min - return i -} - -// WithPattern sets a pattern value -func (i *Items) WithPattern(pattern string) *Items { - i.Pattern = pattern - return i -} - -// WithMultipleOf sets a multiple of value -func (i *Items) WithMultipleOf(number float64) *Items { - i.MultipleOf = &number - return i -} - -// WithMaximum sets a maximum number value -func (i *Items) WithMaximum(max float64, exclusive bool) *Items { - i.Maximum = &max - i.ExclusiveMaximum = exclusive - return i -} - -// WithMinimum sets a minimum number value -func (i *Items) WithMinimum(min float64, exclusive bool) *Items { - i.Minimum = &min - i.ExclusiveMinimum = exclusive - return i -} - -// WithEnum sets a the enum values (replace) -func (i *Items) WithEnum(values ...interface{}) *Items { - i.Enum = append([]interface{}{}, values...) - return i -} - -// WithMaxItems sets the max items -func (i *Items) WithMaxItems(size int64) *Items { - i.MaxItems = &size - return i -} - -// WithMinItems sets the min items -func (i *Items) WithMinItems(size int64) *Items { - i.MinItems = &size - return i -} - -// UniqueValues dictates that this array can only have unique items -func (i *Items) UniqueValues() *Items { - i.UniqueItems = true - return i -} - -// AllowDuplicates this array can have duplicates -func (i *Items) AllowDuplicates() *Items { - i.UniqueItems = false - return i -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (i *Items) UnmarshalJSON(data []byte) error { - var validations CommonValidations - if err := json.Unmarshal(data, &validations); err != nil { - return err - } - var ref Refable - if err := json.Unmarshal(data, &ref); err != nil { - return err - } - var simpleSchema SimpleSchema - if err := json.Unmarshal(data, &simpleSchema); err != nil { - return err - } - i.Refable = ref - i.CommonValidations = validations - i.SimpleSchema = simpleSchema - return nil -} - -// MarshalJSON converts this items object to JSON -func (i Items) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(i.CommonValidations) - if err != nil { - return nil, err - } - b2, err := json.Marshal(i.SimpleSchema) - if err != nil { - return nil, err - } - b3, err := json.Marshal(i.Refable) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b3, b1, b2), nil -} - -// JSONLookup look up a value by the json property name -func (p Items) JSONLookup(token string) (interface{}, error) { - if token == "$ref" { - return &p.Ref, nil - } - - r, _, err := jsonpointer.GetForToken(p.CommonValidations, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.SimpleSchema, token) - return r, err -} diff --git a/vendor/github.com/go-openapi/spec/license.go b/vendor/github.com/go-openapi/spec/license.go deleted file mode 100644 index f20961b4..00000000 --- a/vendor/github.com/go-openapi/spec/license.go +++ /dev/null @@ -1,23 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -// License information for the exposed API. -// -// For more information: http://goo.gl/8us55a#licenseObject -type License struct { - Name string `json:"name,omitempty"` - URL string `json:"url,omitempty"` -} diff --git a/vendor/github.com/go-openapi/spec/operation.go b/vendor/github.com/go-openapi/spec/operation.go deleted file mode 100644 index de1db6f0..00000000 --- a/vendor/github.com/go-openapi/spec/operation.go +++ /dev/null @@ -1,233 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -type OperationProps struct { - Description string `json:"description,omitempty"` - Consumes []string `json:"consumes,omitempty"` - Produces []string `json:"produces,omitempty"` - Schemes []string `json:"schemes,omitempty"` // the scheme, when present must be from [http, https, ws, wss] - Tags []string `json:"tags,omitempty"` - Summary string `json:"summary,omitempty"` - ExternalDocs *ExternalDocumentation `json:"externalDocs,omitempty"` - ID string `json:"operationId,omitempty"` - Deprecated bool `json:"deprecated,omitempty"` - Security []map[string][]string `json:"security,omitempty"` - Parameters []Parameter `json:"parameters,omitempty"` - Responses *Responses `json:"responses,omitempty"` -} - -// Operation describes a single API operation on a path. -// -// For more information: http://goo.gl/8us55a#operationObject -type Operation struct { - VendorExtensible - OperationProps -} - -// SuccessResponse gets a success response model -func (o *Operation) SuccessResponse() (*Response, int, bool) { - if o.Responses == nil { - return nil, 0, false - } - - for k, v := range o.Responses.StatusCodeResponses { - if k/100 == 2 { - return &v, k, true - } - } - - return o.Responses.Default, 0, false -} - -// JSONLookup look up a value by the json property name -func (o Operation) JSONLookup(token string) (interface{}, error) { - if ex, ok := o.Extensions[token]; ok { - return &ex, nil - } - r, _, err := jsonpointer.GetForToken(o.OperationProps, token) - return r, err -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (o *Operation) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &o.OperationProps); err != nil { - return err - } - if err := json.Unmarshal(data, &o.VendorExtensible); err != nil { - return err - } - return nil -} - -// MarshalJSON converts this items object to JSON -func (o Operation) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(o.OperationProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(o.VendorExtensible) - if err != nil { - return nil, err - } - concated := swag.ConcatJSON(b1, b2) - return concated, nil -} - -// NewOperation creates a new operation instance. -// It expects an ID as parameter but not passing an ID is also valid. -func NewOperation(id string) *Operation { - op := new(Operation) - op.ID = id - return op -} - -// WithID sets the ID property on this operation, allows for chaining. -func (o *Operation) WithID(id string) *Operation { - o.ID = id - return o -} - -// WithDescription sets the description on this operation, allows for chaining -func (o *Operation) WithDescription(description string) *Operation { - o.Description = description - return o -} - -// WithSummary sets the summary on this operation, allows for chaining -func (o *Operation) WithSummary(summary string) *Operation { - o.Summary = summary - return o -} - -// WithExternalDocs sets/removes the external docs for/from this operation. -// When you pass empty strings as params the external documents will be removed. -// When you pass non-empty string as one value then those values will be used on the external docs object. -// So when you pass a non-empty description, you should also pass the url and vice versa. -func (o *Operation) WithExternalDocs(description, url string) *Operation { - if description == "" && url == "" { - o.ExternalDocs = nil - return o - } - - if o.ExternalDocs == nil { - o.ExternalDocs = &ExternalDocumentation{} - } - o.ExternalDocs.Description = description - o.ExternalDocs.URL = url - return o -} - -// Deprecate marks the operation as deprecated -func (o *Operation) Deprecate() *Operation { - o.Deprecated = true - return o -} - -// Undeprecate marks the operation as not deprected -func (o *Operation) Undeprecate() *Operation { - o.Deprecated = false - return o -} - -// WithConsumes adds media types for incoming body values -func (o *Operation) WithConsumes(mediaTypes ...string) *Operation { - o.Consumes = append(o.Consumes, mediaTypes...) - return o -} - -// WithProduces adds media types for outgoing body values -func (o *Operation) WithProduces(mediaTypes ...string) *Operation { - o.Produces = append(o.Produces, mediaTypes...) - return o -} - -// WithTags adds tags for this operation -func (o *Operation) WithTags(tags ...string) *Operation { - o.Tags = append(o.Tags, tags...) - return o -} - -// AddParam adds a parameter to this operation, when a parameter for that location -// and with that name already exists it will be replaced -func (o *Operation) AddParam(param *Parameter) *Operation { - if param == nil { - return o - } - - for i, p := range o.Parameters { - if p.Name == param.Name && p.In == param.In { - params := append(o.Parameters[:i], *param) - params = append(params, o.Parameters[i+1:]...) - o.Parameters = params - return o - } - } - - o.Parameters = append(o.Parameters, *param) - return o -} - -// RemoveParam removes a parameter from the operation -func (o *Operation) RemoveParam(name, in string) *Operation { - for i, p := range o.Parameters { - if p.Name == name && p.In == name { - o.Parameters = append(o.Parameters[:i], o.Parameters[i+1:]...) - return o - } - } - return o -} - -// SecuredWith adds a security scope to this operation. -func (o *Operation) SecuredWith(name string, scopes ...string) *Operation { - o.Security = append(o.Security, map[string][]string{name: scopes}) - return o -} - -// WithDefaultResponse adds a default response to the operation. -// Passing a nil value will remove the response -func (o *Operation) WithDefaultResponse(response *Response) *Operation { - return o.RespondsWith(0, response) -} - -// RespondsWith adds a status code response to the operation. -// When the code is 0 the value of the response will be used as default response value. -// When the value of the response is nil it will be removed from the operation -func (o *Operation) RespondsWith(code int, response *Response) *Operation { - if o.Responses == nil { - o.Responses = new(Responses) - } - if code == 0 { - o.Responses.Default = response - return o - } - if response == nil { - delete(o.Responses.StatusCodeResponses, code) - return o - } - if o.Responses.StatusCodeResponses == nil { - o.Responses.StatusCodeResponses = make(map[int]Response) - } - o.Responses.StatusCodeResponses[code] = *response - return o -} diff --git a/vendor/github.com/go-openapi/spec/parameter.go b/vendor/github.com/go-openapi/spec/parameter.go deleted file mode 100644 index 71aee1e8..00000000 --- a/vendor/github.com/go-openapi/spec/parameter.go +++ /dev/null @@ -1,301 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "strings" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -// QueryParam creates a query parameter -func QueryParam(name string) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name, In: "query"}} -} - -// HeaderParam creates a header parameter, this is always required by default -func HeaderParam(name string) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name, In: "header", Required: true}} -} - -// PathParam creates a path parameter, this is always required -func PathParam(name string) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name, In: "path", Required: true}} -} - -// BodyParam creates a body parameter -func BodyParam(name string, schema *Schema) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name, In: "body", Schema: schema}, SimpleSchema: SimpleSchema{Type: "object"}} -} - -// FormDataParam creates a body parameter -func FormDataParam(name string) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name, In: "formData"}} -} - -// FileParam creates a body parameter -func FileParam(name string) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name, In: "formData"}, SimpleSchema: SimpleSchema{Type: "file"}} -} - -// SimpleArrayParam creates a param for a simple array (string, int, date etc) -func SimpleArrayParam(name, tpe, fmt string) *Parameter { - return &Parameter{ParamProps: ParamProps{Name: name}, SimpleSchema: SimpleSchema{Type: "array", CollectionFormat: "csv", Items: &Items{SimpleSchema: SimpleSchema{Type: "string", Format: fmt}}}} -} - -// ParamRef creates a parameter that's a json reference -func ParamRef(uri string) *Parameter { - p := new(Parameter) - p.Ref = MustCreateRef(uri) - return p -} - -type ParamProps struct { - Description string `json:"description,omitempty"` - Name string `json:"name,omitempty"` - In string `json:"in,omitempty"` - Required bool `json:"required,omitempty"` - Schema *Schema `json:"schema,omitempty"` // when in == "body" - AllowEmptyValue bool `json:"allowEmptyValue,omitempty"` // when in == "query" || "formData" -} - -// Parameter a unique parameter is defined by a combination of a [name](#parameterName) and [location](#parameterIn). -// -// There are five possible parameter types. -// * Path - Used together with [Path Templating](#pathTemplating), where the parameter value is actually part of the operation's URL. This does not include the host or base path of the API. For example, in `/items/{itemId}`, the path parameter is `itemId`. -// * Query - Parameters that are appended to the URL. For example, in `/items?id=###`, the query parameter is `id`. -// * Header - Custom headers that are expected as part of the request. -// * Body - The payload that's appended to the HTTP request. Since there can only be one payload, there can only be *one* body parameter. The name of the body parameter has no effect on the parameter itself and is used for documentation purposes only. Since Form parameters are also in the payload, body and form parameters cannot exist together for the same operation. -// * Form - Used to describe the payload of an HTTP request when either `application/x-www-form-urlencoded` or `multipart/form-data` are used as the content type of the request (in Swagger's definition, the [`consumes`](#operationConsumes) property of an operation). This is the only parameter type that can be used to send files, thus supporting the `file` type. Since form parameters are sent in the payload, they cannot be declared together with a body parameter for the same operation. Form parameters have a different format based on the content-type used (for further details, consult http://www.w3.org/TR/html401/interact/forms.html#h-17.13.4): -// * `application/x-www-form-urlencoded` - Similar to the format of Query parameters but as a payload. For example, `foo=1&bar=swagger` - both `foo` and `bar` are form parameters. This is normally used for simple parameters that are being transferred. -// * `multipart/form-data` - each parameter takes a section in the payload with an internal header. For example, for the header `Content-Disposition: form-data; name="submit-name"` the name of the parameter is `submit-name`. This type of form parameters is more commonly used for file transfers. -// -// For more information: http://goo.gl/8us55a#parameterObject -type Parameter struct { - Refable - CommonValidations - SimpleSchema - VendorExtensible - ParamProps -} - -// JSONLookup look up a value by the json property name -func (p Parameter) JSONLookup(token string) (interface{}, error) { - if ex, ok := p.Extensions[token]; ok { - return &ex, nil - } - if token == "$ref" { - return &p.Ref, nil - } - - r, _, err := jsonpointer.GetForToken(p.CommonValidations, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.SimpleSchema, token) - if err != nil && !strings.HasPrefix(err.Error(), "object has no field") { - return nil, err - } - if r != nil { - return r, nil - } - r, _, err = jsonpointer.GetForToken(p.ParamProps, token) - return r, err -} - -// WithDescription a fluent builder method for the description of the parameter -func (p *Parameter) WithDescription(description string) *Parameter { - p.Description = description - return p -} - -// Named a fluent builder method to override the name of the parameter -func (p *Parameter) Named(name string) *Parameter { - p.Name = name - return p -} - -// WithLocation a fluent builder method to override the location of the parameter -func (p *Parameter) WithLocation(in string) *Parameter { - p.In = in - return p -} - -// Typed a fluent builder method for the type of the parameter value -func (p *Parameter) Typed(tpe, format string) *Parameter { - p.Type = tpe - p.Format = format - return p -} - -// CollectionOf a fluent builder method for an array parameter -func (p *Parameter) CollectionOf(items *Items, format string) *Parameter { - p.Type = "array" - p.Items = items - p.CollectionFormat = format - return p -} - -// WithDefault sets the default value on this parameter -func (p *Parameter) WithDefault(defaultValue interface{}) *Parameter { - p.AsOptional() // with default implies optional - p.Default = defaultValue - return p -} - -// AllowsEmptyValues flags this parameter as being ok with empty values -func (p *Parameter) AllowsEmptyValues() *Parameter { - p.AllowEmptyValue = true - return p -} - -// NoEmptyValues flags this parameter as not liking empty values -func (p *Parameter) NoEmptyValues() *Parameter { - p.AllowEmptyValue = false - return p -} - -// AsOptional flags this parameter as optional -func (p *Parameter) AsOptional() *Parameter { - p.Required = false - return p -} - -// AsRequired flags this parameter as required -func (p *Parameter) AsRequired() *Parameter { - if p.Default != nil { // with a default required makes no sense - return p - } - p.Required = true - return p -} - -// WithMaxLength sets a max length value -func (p *Parameter) WithMaxLength(max int64) *Parameter { - p.MaxLength = &max - return p -} - -// WithMinLength sets a min length value -func (p *Parameter) WithMinLength(min int64) *Parameter { - p.MinLength = &min - return p -} - -// WithPattern sets a pattern value -func (p *Parameter) WithPattern(pattern string) *Parameter { - p.Pattern = pattern - return p -} - -// WithMultipleOf sets a multiple of value -func (p *Parameter) WithMultipleOf(number float64) *Parameter { - p.MultipleOf = &number - return p -} - -// WithMaximum sets a maximum number value -func (p *Parameter) WithMaximum(max float64, exclusive bool) *Parameter { - p.Maximum = &max - p.ExclusiveMaximum = exclusive - return p -} - -// WithMinimum sets a minimum number value -func (p *Parameter) WithMinimum(min float64, exclusive bool) *Parameter { - p.Minimum = &min - p.ExclusiveMinimum = exclusive - return p -} - -// WithEnum sets a the enum values (replace) -func (p *Parameter) WithEnum(values ...interface{}) *Parameter { - p.Enum = append([]interface{}{}, values...) - return p -} - -// WithMaxItems sets the max items -func (p *Parameter) WithMaxItems(size int64) *Parameter { - p.MaxItems = &size - return p -} - -// WithMinItems sets the min items -func (p *Parameter) WithMinItems(size int64) *Parameter { - p.MinItems = &size - return p -} - -// UniqueValues dictates that this array can only have unique items -func (p *Parameter) UniqueValues() *Parameter { - p.UniqueItems = true - return p -} - -// AllowDuplicates this array can have duplicates -func (p *Parameter) AllowDuplicates() *Parameter { - p.UniqueItems = false - return p -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (p *Parameter) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &p.CommonValidations); err != nil { - return err - } - if err := json.Unmarshal(data, &p.Refable); err != nil { - return err - } - if err := json.Unmarshal(data, &p.SimpleSchema); err != nil { - return err - } - if err := json.Unmarshal(data, &p.VendorExtensible); err != nil { - return err - } - if err := json.Unmarshal(data, &p.ParamProps); err != nil { - return err - } - return nil -} - -// MarshalJSON converts this items object to JSON -func (p Parameter) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(p.CommonValidations) - if err != nil { - return nil, err - } - b2, err := json.Marshal(p.SimpleSchema) - if err != nil { - return nil, err - } - b3, err := json.Marshal(p.Refable) - if err != nil { - return nil, err - } - b4, err := json.Marshal(p.VendorExtensible) - if err != nil { - return nil, err - } - b5, err := json.Marshal(p.ParamProps) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b3, b1, b2, b4, b5), nil -} diff --git a/vendor/github.com/go-openapi/spec/path_item.go b/vendor/github.com/go-openapi/spec/path_item.go deleted file mode 100644 index 9ab3ec53..00000000 --- a/vendor/github.com/go-openapi/spec/path_item.go +++ /dev/null @@ -1,90 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -// pathItemProps the path item specific properties -type PathItemProps struct { - Get *Operation `json:"get,omitempty"` - Put *Operation `json:"put,omitempty"` - Post *Operation `json:"post,omitempty"` - Delete *Operation `json:"delete,omitempty"` - Options *Operation `json:"options,omitempty"` - Head *Operation `json:"head,omitempty"` - Patch *Operation `json:"patch,omitempty"` - Parameters []Parameter `json:"parameters,omitempty"` -} - -// PathItem describes the operations available on a single path. -// A Path Item may be empty, due to [ACL constraints](http://goo.gl/8us55a#securityFiltering). -// The path itself is still exposed to the documentation viewer but they will -// not know which operations and parameters are available. -// -// For more information: http://goo.gl/8us55a#pathItemObject -type PathItem struct { - Refable - VendorExtensible - PathItemProps -} - -// JSONLookup look up a value by the json property name -func (p PathItem) JSONLookup(token string) (interface{}, error) { - if ex, ok := p.Extensions[token]; ok { - return &ex, nil - } - if token == "$ref" { - return &p.Ref, nil - } - r, _, err := jsonpointer.GetForToken(p.PathItemProps, token) - return r, err -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (p *PathItem) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &p.Refable); err != nil { - return err - } - if err := json.Unmarshal(data, &p.VendorExtensible); err != nil { - return err - } - if err := json.Unmarshal(data, &p.PathItemProps); err != nil { - return err - } - return nil -} - -// MarshalJSON converts this items object to JSON -func (p PathItem) MarshalJSON() ([]byte, error) { - b3, err := json.Marshal(p.Refable) - if err != nil { - return nil, err - } - b4, err := json.Marshal(p.VendorExtensible) - if err != nil { - return nil, err - } - b5, err := json.Marshal(p.PathItemProps) - if err != nil { - return nil, err - } - concated := swag.ConcatJSON(b3, b4, b5) - return concated, nil -} diff --git a/vendor/github.com/go-openapi/spec/paths.go b/vendor/github.com/go-openapi/spec/paths.go deleted file mode 100644 index 9dc82a29..00000000 --- a/vendor/github.com/go-openapi/spec/paths.go +++ /dev/null @@ -1,97 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "fmt" - "strings" - - "github.com/go-openapi/swag" -) - -// Paths holds the relative paths to the individual endpoints. -// The path is appended to the [`basePath`](http://goo.gl/8us55a#swaggerBasePath) in order -// to construct the full URL. -// The Paths may be empty, due to [ACL constraints](http://goo.gl/8us55a#securityFiltering). -// -// For more information: http://goo.gl/8us55a#pathsObject -type Paths struct { - VendorExtensible - Paths map[string]PathItem `json:"-"` // custom serializer to flatten this, each entry must start with "/" -} - -// JSONLookup look up a value by the json property name -func (p Paths) JSONLookup(token string) (interface{}, error) { - if pi, ok := p.Paths[token]; ok { - return &pi, nil - } - if ex, ok := p.Extensions[token]; ok { - return &ex, nil - } - return nil, fmt.Errorf("object has no field %q", token) -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (p *Paths) UnmarshalJSON(data []byte) error { - var res map[string]json.RawMessage - if err := json.Unmarshal(data, &res); err != nil { - return err - } - for k, v := range res { - if strings.HasPrefix(strings.ToLower(k), "x-") { - if p.Extensions == nil { - p.Extensions = make(map[string]interface{}) - } - var d interface{} - if err := json.Unmarshal(v, &d); err != nil { - return err - } - p.Extensions[k] = d - } - if strings.HasPrefix(k, "/") { - if p.Paths == nil { - p.Paths = make(map[string]PathItem) - } - var pi PathItem - if err := json.Unmarshal(v, &pi); err != nil { - return err - } - p.Paths[k] = pi - } - } - return nil -} - -// MarshalJSON converts this items object to JSON -func (p Paths) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(p.VendorExtensible) - if err != nil { - return nil, err - } - - pths := make(map[string]PathItem) - for k, v := range p.Paths { - if strings.HasPrefix(k, "/") { - pths[k] = v - } - } - b2, err := json.Marshal(pths) - if err != nil { - return nil, err - } - concated := swag.ConcatJSON(b1, b2) - return concated, nil -} diff --git a/vendor/github.com/go-openapi/spec/ref.go b/vendor/github.com/go-openapi/spec/ref.go deleted file mode 100644 index 4833b87e..00000000 --- a/vendor/github.com/go-openapi/spec/ref.go +++ /dev/null @@ -1,164 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "net/http" - "os" - "path/filepath" - - "github.com/go-openapi/jsonreference" -) - -// Refable is a struct for things that accept a $ref property -type Refable struct { - Ref Ref -} - -// MarshalJSON marshals the ref to json -func (r Refable) MarshalJSON() ([]byte, error) { - return r.Ref.MarshalJSON() -} - -// UnmarshalJSON unmarshalss the ref from json -func (r *Refable) UnmarshalJSON(d []byte) error { - return json.Unmarshal(d, &r.Ref) -} - -// Ref represents a json reference that is potentially resolved -type Ref struct { - jsonreference.Ref -} - -// RemoteURI gets the remote uri part of the ref -func (r *Ref) RemoteURI() string { - if r.String() == "" { - return r.String() - } - - u := *r.GetURL() - u.Fragment = "" - return u.String() -} - -// IsValidURI returns true when the url the ref points to can be found -func (r *Ref) IsValidURI(basepaths ...string) bool { - if r.String() == "" { - return true - } - - v := r.RemoteURI() - if v == "" { - return true - } - - if r.HasFullURL { - rr, err := http.Get(v) - if err != nil { - return false - } - - return rr.StatusCode/100 == 2 - } - - if !(r.HasFileScheme || r.HasFullFilePath || r.HasURLPathOnly) { - return false - } - - // check for local file - pth := v - if r.HasURLPathOnly { - base := "." - if len(basepaths) > 0 { - base = filepath.Dir(filepath.Join(basepaths...)) - } - p, e := filepath.Abs(filepath.ToSlash(filepath.Join(base, pth))) - if e != nil { - return false - } - pth = p - } - - fi, err := os.Stat(filepath.ToSlash(pth)) - if err != nil { - return false - } - - return !fi.IsDir() -} - -// Inherits creates a new reference from a parent and a child -// If the child cannot inherit from the parent, an error is returned -func (r *Ref) Inherits(child Ref) (*Ref, error) { - ref, err := r.Ref.Inherits(child.Ref) - if err != nil { - return nil, err - } - return &Ref{Ref: *ref}, nil -} - -// NewRef creates a new instance of a ref object -// returns an error when the reference uri is an invalid uri -func NewRef(refURI string) (Ref, error) { - ref, err := jsonreference.New(refURI) - if err != nil { - return Ref{}, err - } - return Ref{Ref: ref}, nil -} - -// MustCreateRef creates a ref object but panics when refURI is invalid. -// Use the NewRef method for a version that returns an error. -func MustCreateRef(refURI string) Ref { - return Ref{Ref: jsonreference.MustCreateRef(refURI)} -} - -// MarshalJSON marshals this ref into a JSON object -func (r Ref) MarshalJSON() ([]byte, error) { - str := r.String() - if str == "" { - if r.IsRoot() { - return []byte(`{"$ref":""}`), nil - } - return []byte("{}"), nil - } - v := map[string]interface{}{"$ref": str} - return json.Marshal(v) -} - -// UnmarshalJSON unmarshals this ref from a JSON object -func (r *Ref) UnmarshalJSON(d []byte) error { - var v map[string]interface{} - if err := json.Unmarshal(d, &v); err != nil { - return err - } - - if v == nil { - return nil - } - - if vv, ok := v["$ref"]; ok { - if str, ok := vv.(string); ok { - ref, err := jsonreference.New(str) - if err != nil { - return err - } - *r = Ref{Ref: ref} - } - } - - return nil -} diff --git a/vendor/github.com/go-openapi/spec/response.go b/vendor/github.com/go-openapi/spec/response.go deleted file mode 100644 index a32b039e..00000000 --- a/vendor/github.com/go-openapi/spec/response.go +++ /dev/null @@ -1,134 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -// ResponseProps properties specific to a response -type ResponseProps struct { - Description string `json:"description,omitempty"` - Schema *Schema `json:"schema,omitempty"` - Headers map[string]Header `json:"headers,omitempty"` - Examples map[string]interface{} `json:"examples,omitempty"` -} - -// Response describes a single response from an API Operation. -// -// For more information: http://goo.gl/8us55a#responseObject -type Response struct { - Refable - ResponseProps - VendorExtensible -} - -// JSONLookup look up a value by the json property name -func (p Response) JSONLookup(token string) (interface{}, error) { - if ex, ok := p.Extensions[token]; ok { - return &ex, nil - } - if token == "$ref" { - return &p.Ref, nil - } - r, _, err := jsonpointer.GetForToken(p.ResponseProps, token) - return r, err -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (r *Response) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &r.ResponseProps); err != nil { - return err - } - if err := json.Unmarshal(data, &r.Refable); err != nil { - return err - } - if err := json.Unmarshal(data, &r.VendorExtensible); err != nil { - return err - } - return nil -} - -// MarshalJSON converts this items object to JSON -func (r Response) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(r.ResponseProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(r.Refable) - if err != nil { - return nil, err - } - b3, err := json.Marshal(r.VendorExtensible) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b1, b2, b3), nil -} - -// NewResponse creates a new response instance -func NewResponse() *Response { - return new(Response) -} - -// ResponseRef creates a response as a json reference -func ResponseRef(url string) *Response { - resp := NewResponse() - resp.Ref = MustCreateRef(url) - return resp -} - -// WithDescription sets the description on this response, allows for chaining -func (r *Response) WithDescription(description string) *Response { - r.Description = description - return r -} - -// WithSchema sets the schema on this response, allows for chaining. -// Passing a nil argument removes the schema from this response -func (r *Response) WithSchema(schema *Schema) *Response { - r.Schema = schema - return r -} - -// AddHeader adds a header to this response -func (r *Response) AddHeader(name string, header *Header) *Response { - if header == nil { - return r.RemoveHeader(name) - } - if r.Headers == nil { - r.Headers = make(map[string]Header) - } - r.Headers[name] = *header - return r -} - -// RemoveHeader removes a header from this response -func (r *Response) RemoveHeader(name string) *Response { - delete(r.Headers, name) - return r -} - -// AddExample adds an example to this response -func (r *Response) AddExample(mediaType string, example interface{}) *Response { - if r.Examples == nil { - r.Examples = make(map[string]interface{}) - } - r.Examples[mediaType] = example - return r -} diff --git a/vendor/github.com/go-openapi/spec/responses.go b/vendor/github.com/go-openapi/spec/responses.go deleted file mode 100644 index 3ab06697..00000000 --- a/vendor/github.com/go-openapi/spec/responses.go +++ /dev/null @@ -1,122 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "fmt" - "reflect" - "strconv" - - "github.com/go-openapi/swag" -) - -// Responses is a container for the expected responses of an operation. -// The container maps a HTTP response code to the expected response. -// It is not expected from the documentation to necessarily cover all possible HTTP response codes, -// since they may not be known in advance. However, it is expected from the documentation to cover -// a successful operation response and any known errors. -// -// The `default` can be used a default response object for all HTTP codes that are not covered -// individually by the specification. -// -// The `Responses Object` MUST contain at least one response code, and it SHOULD be the response -// for a successful operation call. -// -// For more information: http://goo.gl/8us55a#responsesObject -type Responses struct { - VendorExtensible - ResponsesProps -} - -// JSONLookup implements an interface to customize json pointer lookup -func (r Responses) JSONLookup(token string) (interface{}, error) { - if token == "default" { - return r.Default, nil - } - if ex, ok := r.Extensions[token]; ok { - return &ex, nil - } - if i, err := strconv.Atoi(token); err == nil { - if scr, ok := r.StatusCodeResponses[i]; ok { - return scr, nil - } - } - return nil, fmt.Errorf("object has no field %q", token) -} - -// UnmarshalJSON hydrates this items instance with the data from JSON -func (r *Responses) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &r.ResponsesProps); err != nil { - return err - } - if err := json.Unmarshal(data, &r.VendorExtensible); err != nil { - return err - } - if reflect.DeepEqual(ResponsesProps{}, r.ResponsesProps) { - r.ResponsesProps = ResponsesProps{} - } - return nil -} - -// MarshalJSON converts this items object to JSON -func (r Responses) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(r.ResponsesProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(r.VendorExtensible) - if err != nil { - return nil, err - } - concated := swag.ConcatJSON(b1, b2) - return concated, nil -} - -type ResponsesProps struct { - Default *Response - StatusCodeResponses map[int]Response -} - -func (r ResponsesProps) MarshalJSON() ([]byte, error) { - toser := map[string]Response{} - if r.Default != nil { - toser["default"] = *r.Default - } - for k, v := range r.StatusCodeResponses { - toser[strconv.Itoa(k)] = v - } - return json.Marshal(toser) -} - -func (r *ResponsesProps) UnmarshalJSON(data []byte) error { - var res map[string]Response - if err := json.Unmarshal(data, &res); err != nil { - return nil - } - if v, ok := res["default"]; ok { - r.Default = &v - delete(res, "default") - } - for k, v := range res { - if nk, err := strconv.Atoi(k); err == nil { - if r.StatusCodeResponses == nil { - r.StatusCodeResponses = map[int]Response{} - } - r.StatusCodeResponses[nk] = v - } - } - return nil -} diff --git a/vendor/github.com/go-openapi/spec/schema.go b/vendor/github.com/go-openapi/spec/schema.go deleted file mode 100644 index 1cdcc163..00000000 --- a/vendor/github.com/go-openapi/spec/schema.go +++ /dev/null @@ -1,628 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "fmt" - "net/url" - "strings" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -// BooleanProperty creates a boolean property -func BooleanProperty() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"boolean"}}} -} - -// BoolProperty creates a boolean property -func BoolProperty() *Schema { return BooleanProperty() } - -// StringProperty creates a string property -func StringProperty() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"string"}}} -} - -// CharProperty creates a string property -func CharProperty() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"string"}}} -} - -// Float64Property creates a float64/double property -func Float64Property() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"number"}, Format: "double"}} -} - -// Float32Property creates a float32/float property -func Float32Property() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"number"}, Format: "float"}} -} - -// Int8Property creates an int8 property -func Int8Property() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"integer"}, Format: "int8"}} -} - -// Int16Property creates an int16 property -func Int16Property() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"integer"}, Format: "int16"}} -} - -// Int32Property creates an int32 property -func Int32Property() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"integer"}, Format: "int32"}} -} - -// Int64Property creates an int64 property -func Int64Property() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"integer"}, Format: "int64"}} -} - -// StrFmtProperty creates a property for the named string format -func StrFmtProperty(format string) *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"string"}, Format: format}} -} - -// DateProperty creates a date property -func DateProperty() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"string"}, Format: "date"}} -} - -// DateTimeProperty creates a date time property -func DateTimeProperty() *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"string"}, Format: "date-time"}} -} - -// MapProperty creates a map property -func MapProperty(property *Schema) *Schema { - return &Schema{SchemaProps: SchemaProps{Type: []string{"object"}, AdditionalProperties: &SchemaOrBool{Allows: true, Schema: property}}} -} - -// RefProperty creates a ref property -func RefProperty(name string) *Schema { - return &Schema{SchemaProps: SchemaProps{Ref: MustCreateRef(name)}} -} - -// RefSchema creates a ref property -func RefSchema(name string) *Schema { - return &Schema{SchemaProps: SchemaProps{Ref: MustCreateRef(name)}} -} - -// ArrayProperty creates an array property -func ArrayProperty(items *Schema) *Schema { - if items == nil { - return &Schema{SchemaProps: SchemaProps{Type: []string{"array"}}} - } - return &Schema{SchemaProps: SchemaProps{Items: &SchemaOrArray{Schema: items}, Type: []string{"array"}}} -} - -// ComposedSchema creates a schema with allOf -func ComposedSchema(schemas ...Schema) *Schema { - s := new(Schema) - s.AllOf = schemas - return s -} - -// SchemaURL represents a schema url -type SchemaURL string - -// MarshalJSON marshal this to JSON -func (r SchemaURL) MarshalJSON() ([]byte, error) { - if r == "" { - return []byte("{}"), nil - } - v := map[string]interface{}{"$schema": string(r)} - return json.Marshal(v) -} - -// UnmarshalJSON unmarshal this from JSON -func (r *SchemaURL) UnmarshalJSON(data []byte) error { - var v map[string]interface{} - if err := json.Unmarshal(data, &v); err != nil { - return err - } - if v == nil { - return nil - } - if vv, ok := v["$schema"]; ok { - if str, ok := vv.(string); ok { - u, err := url.Parse(str) - if err != nil { - return err - } - - *r = SchemaURL(u.String()) - } - } - return nil -} - -// type ExtraSchemaProps map[string]interface{} - -// // JSONSchema represents a structure that is a json schema draft 04 -// type JSONSchema struct { -// SchemaProps -// ExtraSchemaProps -// } - -// // MarshalJSON marshal this to JSON -// func (s JSONSchema) MarshalJSON() ([]byte, error) { -// b1, err := json.Marshal(s.SchemaProps) -// if err != nil { -// return nil, err -// } -// b2, err := s.Ref.MarshalJSON() -// if err != nil { -// return nil, err -// } -// b3, err := s.Schema.MarshalJSON() -// if err != nil { -// return nil, err -// } -// b4, err := json.Marshal(s.ExtraSchemaProps) -// if err != nil { -// return nil, err -// } -// return swag.ConcatJSON(b1, b2, b3, b4), nil -// } - -// // UnmarshalJSON marshal this from JSON -// func (s *JSONSchema) UnmarshalJSON(data []byte) error { -// var sch JSONSchema -// if err := json.Unmarshal(data, &sch.SchemaProps); err != nil { -// return err -// } -// if err := json.Unmarshal(data, &sch.Ref); err != nil { -// return err -// } -// if err := json.Unmarshal(data, &sch.Schema); err != nil { -// return err -// } -// if err := json.Unmarshal(data, &sch.ExtraSchemaProps); err != nil { -// return err -// } -// *s = sch -// return nil -// } - -type SchemaProps struct { - ID string `json:"id,omitempty"` - Ref Ref `json:"-"` - Schema SchemaURL `json:"-"` - Description string `json:"description,omitempty"` - Type StringOrArray `json:"type,omitempty"` - Format string `json:"format,omitempty"` - Title string `json:"title,omitempty"` - Default interface{} `json:"default,omitempty"` - Maximum *float64 `json:"maximum,omitempty"` - ExclusiveMaximum bool `json:"exclusiveMaximum,omitempty"` - Minimum *float64 `json:"minimum,omitempty"` - ExclusiveMinimum bool `json:"exclusiveMinimum,omitempty"` - MaxLength *int64 `json:"maxLength,omitempty"` - MinLength *int64 `json:"minLength,omitempty"` - Pattern string `json:"pattern,omitempty"` - MaxItems *int64 `json:"maxItems,omitempty"` - MinItems *int64 `json:"minItems,omitempty"` - UniqueItems bool `json:"uniqueItems,omitempty"` - MultipleOf *float64 `json:"multipleOf,omitempty"` - Enum []interface{} `json:"enum,omitempty"` - MaxProperties *int64 `json:"maxProperties,omitempty"` - MinProperties *int64 `json:"minProperties,omitempty"` - Required []string `json:"required,omitempty"` - Items *SchemaOrArray `json:"items,omitempty"` - AllOf []Schema `json:"allOf,omitempty"` - OneOf []Schema `json:"oneOf,omitempty"` - AnyOf []Schema `json:"anyOf,omitempty"` - Not *Schema `json:"not,omitempty"` - Properties map[string]Schema `json:"properties,omitempty"` - AdditionalProperties *SchemaOrBool `json:"additionalProperties,omitempty"` - PatternProperties map[string]Schema `json:"patternProperties,omitempty"` - Dependencies Dependencies `json:"dependencies,omitempty"` - AdditionalItems *SchemaOrBool `json:"additionalItems,omitempty"` - Definitions Definitions `json:"definitions,omitempty"` -} - -type SwaggerSchemaProps struct { - Discriminator string `json:"discriminator,omitempty"` - ReadOnly bool `json:"readOnly,omitempty"` - XML *XMLObject `json:"xml,omitempty"` - ExternalDocs *ExternalDocumentation `json:"externalDocs,omitempty"` - Example interface{} `json:"example,omitempty"` -} - -// Schema the schema object allows the definition of input and output data types. -// These types can be objects, but also primitives and arrays. -// This object is based on the [JSON Schema Specification Draft 4](http://json-schema.org/) -// and uses a predefined subset of it. -// On top of this subset, there are extensions provided by this specification to allow for more complete documentation. -// -// For more information: http://goo.gl/8us55a#schemaObject -type Schema struct { - VendorExtensible - SchemaProps - SwaggerSchemaProps - ExtraProps map[string]interface{} `json:"-"` -} - -// JSONLookup implements an interface to customize json pointer lookup -func (s Schema) JSONLookup(token string) (interface{}, error) { - if ex, ok := s.Extensions[token]; ok { - return &ex, nil - } - - if ex, ok := s.ExtraProps[token]; ok { - return &ex, nil - } - - r, _, err := jsonpointer.GetForToken(s.SchemaProps, token) - if r != nil || (err != nil && !strings.HasPrefix(err.Error(), "object has no field")) { - return r, err - } - r, _, err = jsonpointer.GetForToken(s.SwaggerSchemaProps, token) - return r, err -} - -// WithID sets the id for this schema, allows for chaining -func (s *Schema) WithID(id string) *Schema { - s.ID = id - return s -} - -// WithTitle sets the title for this schema, allows for chaining -func (s *Schema) WithTitle(title string) *Schema { - s.Title = title - return s -} - -// WithDescription sets the description for this schema, allows for chaining -func (s *Schema) WithDescription(description string) *Schema { - s.Description = description - return s -} - -// WithProperties sets the properties for this schema -func (s *Schema) WithProperties(schemas map[string]Schema) *Schema { - s.Properties = schemas - return s -} - -// SetProperty sets a property on this schema -func (s *Schema) SetProperty(name string, schema Schema) *Schema { - if s.Properties == nil { - s.Properties = make(map[string]Schema) - } - s.Properties[name] = schema - return s -} - -// WithAllOf sets the all of property -func (s *Schema) WithAllOf(schemas ...Schema) *Schema { - s.AllOf = schemas - return s -} - -// WithMaxProperties sets the max number of properties an object can have -func (s *Schema) WithMaxProperties(max int64) *Schema { - s.MaxProperties = &max - return s -} - -// WithMinProperties sets the min number of properties an object must have -func (s *Schema) WithMinProperties(min int64) *Schema { - s.MinProperties = &min - return s -} - -// Typed sets the type of this schema for a single value item -func (s *Schema) Typed(tpe, format string) *Schema { - s.Type = []string{tpe} - s.Format = format - return s -} - -// AddType adds a type with potential format to the types for this schema -func (s *Schema) AddType(tpe, format string) *Schema { - s.Type = append(s.Type, tpe) - if format != "" { - s.Format = format - } - return s -} - -// CollectionOf a fluent builder method for an array parameter -func (s *Schema) CollectionOf(items Schema) *Schema { - s.Type = []string{"array"} - s.Items = &SchemaOrArray{Schema: &items} - return s -} - -// WithDefault sets the default value on this parameter -func (s *Schema) WithDefault(defaultValue interface{}) *Schema { - s.Default = defaultValue - return s -} - -// WithRequired flags this parameter as required -func (s *Schema) WithRequired(items ...string) *Schema { - s.Required = items - return s -} - -// AddRequired adds field names to the required properties array -func (s *Schema) AddRequired(items ...string) *Schema { - s.Required = append(s.Required, items...) - return s -} - -// WithMaxLength sets a max length value -func (s *Schema) WithMaxLength(max int64) *Schema { - s.MaxLength = &max - return s -} - -// WithMinLength sets a min length value -func (s *Schema) WithMinLength(min int64) *Schema { - s.MinLength = &min - return s -} - -// WithPattern sets a pattern value -func (s *Schema) WithPattern(pattern string) *Schema { - s.Pattern = pattern - return s -} - -// WithMultipleOf sets a multiple of value -func (s *Schema) WithMultipleOf(number float64) *Schema { - s.MultipleOf = &number - return s -} - -// WithMaximum sets a maximum number value -func (s *Schema) WithMaximum(max float64, exclusive bool) *Schema { - s.Maximum = &max - s.ExclusiveMaximum = exclusive - return s -} - -// WithMinimum sets a minimum number value -func (s *Schema) WithMinimum(min float64, exclusive bool) *Schema { - s.Minimum = &min - s.ExclusiveMinimum = exclusive - return s -} - -// WithEnum sets a the enum values (replace) -func (s *Schema) WithEnum(values ...interface{}) *Schema { - s.Enum = append([]interface{}{}, values...) - return s -} - -// WithMaxItems sets the max items -func (s *Schema) WithMaxItems(size int64) *Schema { - s.MaxItems = &size - return s -} - -// WithMinItems sets the min items -func (s *Schema) WithMinItems(size int64) *Schema { - s.MinItems = &size - return s -} - -// UniqueValues dictates that this array can only have unique items -func (s *Schema) UniqueValues() *Schema { - s.UniqueItems = true - return s -} - -// AllowDuplicates this array can have duplicates -func (s *Schema) AllowDuplicates() *Schema { - s.UniqueItems = false - return s -} - -// AddToAllOf adds a schema to the allOf property -func (s *Schema) AddToAllOf(schemas ...Schema) *Schema { - s.AllOf = append(s.AllOf, schemas...) - return s -} - -// WithDiscriminator sets the name of the discriminator field -func (s *Schema) WithDiscriminator(discriminator string) *Schema { - s.Discriminator = discriminator - return s -} - -// AsReadOnly flags this schema as readonly -func (s *Schema) AsReadOnly() *Schema { - s.ReadOnly = true - return s -} - -// AsWritable flags this schema as writeable (not read-only) -func (s *Schema) AsWritable() *Schema { - s.ReadOnly = false - return s -} - -// WithExample sets the example for this schema -func (s *Schema) WithExample(example interface{}) *Schema { - s.Example = example - return s -} - -// WithExternalDocs sets/removes the external docs for/from this schema. -// When you pass empty strings as params the external documents will be removed. -// When you pass non-empty string as one value then those values will be used on the external docs object. -// So when you pass a non-empty description, you should also pass the url and vice versa. -func (s *Schema) WithExternalDocs(description, url string) *Schema { - if description == "" && url == "" { - s.ExternalDocs = nil - return s - } - - if s.ExternalDocs == nil { - s.ExternalDocs = &ExternalDocumentation{} - } - s.ExternalDocs.Description = description - s.ExternalDocs.URL = url - return s -} - -// WithXMLName sets the xml name for the object -func (s *Schema) WithXMLName(name string) *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Name = name - return s -} - -// WithXMLNamespace sets the xml namespace for the object -func (s *Schema) WithXMLNamespace(namespace string) *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Namespace = namespace - return s -} - -// WithXMLPrefix sets the xml prefix for the object -func (s *Schema) WithXMLPrefix(prefix string) *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Prefix = prefix - return s -} - -// AsXMLAttribute flags this object as xml attribute -func (s *Schema) AsXMLAttribute() *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Attribute = true - return s -} - -// AsXMLElement flags this object as an xml node -func (s *Schema) AsXMLElement() *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Attribute = false - return s -} - -// AsWrappedXML flags this object as wrapped, this is mostly useful for array types -func (s *Schema) AsWrappedXML() *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Wrapped = true - return s -} - -// AsUnwrappedXML flags this object as an xml node -func (s *Schema) AsUnwrappedXML() *Schema { - if s.XML == nil { - s.XML = new(XMLObject) - } - s.XML.Wrapped = false - return s -} - -// MarshalJSON marshal this to JSON -func (s Schema) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(s.SchemaProps) - if err != nil { - return nil, fmt.Errorf("schema props %v", err) - } - b2, err := json.Marshal(s.VendorExtensible) - if err != nil { - return nil, fmt.Errorf("vendor props %v", err) - } - b3, err := s.Ref.MarshalJSON() - if err != nil { - return nil, fmt.Errorf("ref prop %v", err) - } - b4, err := s.Schema.MarshalJSON() - if err != nil { - return nil, fmt.Errorf("schema prop %v", err) - } - b5, err := json.Marshal(s.SwaggerSchemaProps) - if err != nil { - return nil, fmt.Errorf("common validations %v", err) - } - var b6 []byte - if s.ExtraProps != nil { - jj, err := json.Marshal(s.ExtraProps) - if err != nil { - return nil, fmt.Errorf("extra props %v", err) - } - b6 = jj - } - return swag.ConcatJSON(b1, b2, b3, b4, b5, b6), nil -} - -// UnmarshalJSON marshal this from JSON -func (s *Schema) UnmarshalJSON(data []byte) error { - var sch Schema - if err := json.Unmarshal(data, &sch.SchemaProps); err != nil { - return err - } - if err := json.Unmarshal(data, &sch.Ref); err != nil { - return err - } - if err := json.Unmarshal(data, &sch.Schema); err != nil { - return err - } - if err := json.Unmarshal(data, &sch.SwaggerSchemaProps); err != nil { - return err - } - - var d map[string]interface{} - if err := json.Unmarshal(data, &d); err != nil { - return err - } - - delete(d, "$ref") - delete(d, "$schema") - for _, pn := range swag.DefaultJSONNameProvider.GetJSONNames(s) { - delete(d, pn) - } - - for k, vv := range d { - lk := strings.ToLower(k) - if strings.HasPrefix(lk, "x-") { - if sch.Extensions == nil { - sch.Extensions = map[string]interface{}{} - } - sch.Extensions[k] = vv - continue - } - if sch.ExtraProps == nil { - sch.ExtraProps = map[string]interface{}{} - } - sch.ExtraProps[k] = vv - } - - *s = sch - - return nil -} diff --git a/vendor/github.com/go-openapi/spec/security_scheme.go b/vendor/github.com/go-openapi/spec/security_scheme.go deleted file mode 100644 index 22d4f10a..00000000 --- a/vendor/github.com/go-openapi/spec/security_scheme.go +++ /dev/null @@ -1,142 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -const ( - basic = "basic" - apiKey = "apiKey" - oauth2 = "oauth2" - implicit = "implicit" - password = "password" - application = "application" - accessCode = "accessCode" -) - -// BasicAuth creates a basic auth security scheme -func BasicAuth() *SecurityScheme { - return &SecurityScheme{SecuritySchemeProps: SecuritySchemeProps{Type: basic}} -} - -// APIKeyAuth creates an api key auth security scheme -func APIKeyAuth(fieldName, valueSource string) *SecurityScheme { - return &SecurityScheme{SecuritySchemeProps: SecuritySchemeProps{Type: apiKey, Name: fieldName, In: valueSource}} -} - -// OAuth2Implicit creates an implicit flow oauth2 security scheme -func OAuth2Implicit(authorizationURL string) *SecurityScheme { - return &SecurityScheme{SecuritySchemeProps: SecuritySchemeProps{ - Type: oauth2, - Flow: implicit, - AuthorizationURL: authorizationURL, - }} -} - -// OAuth2Password creates a password flow oauth2 security scheme -func OAuth2Password(tokenURL string) *SecurityScheme { - return &SecurityScheme{SecuritySchemeProps: SecuritySchemeProps{ - Type: oauth2, - Flow: password, - TokenURL: tokenURL, - }} -} - -// OAuth2Application creates an application flow oauth2 security scheme -func OAuth2Application(tokenURL string) *SecurityScheme { - return &SecurityScheme{SecuritySchemeProps: SecuritySchemeProps{ - Type: oauth2, - Flow: application, - TokenURL: tokenURL, - }} -} - -// OAuth2AccessToken creates an access token flow oauth2 security scheme -func OAuth2AccessToken(authorizationURL, tokenURL string) *SecurityScheme { - return &SecurityScheme{SecuritySchemeProps: SecuritySchemeProps{ - Type: oauth2, - Flow: accessCode, - AuthorizationURL: authorizationURL, - TokenURL: tokenURL, - }} -} - -type SecuritySchemeProps struct { - Description string `json:"description,omitempty"` - Type string `json:"type"` - Name string `json:"name,omitempty"` // api key - In string `json:"in,omitempty"` // api key - Flow string `json:"flow,omitempty"` // oauth2 - AuthorizationURL string `json:"authorizationUrl,omitempty"` // oauth2 - TokenURL string `json:"tokenUrl,omitempty"` // oauth2 - Scopes map[string]string `json:"scopes,omitempty"` // oauth2 -} - -// AddScope adds a scope to this security scheme -func (s *SecuritySchemeProps) AddScope(scope, description string) { - if s.Scopes == nil { - s.Scopes = make(map[string]string) - } - s.Scopes[scope] = description -} - -// SecurityScheme allows the definition of a security scheme that can be used by the operations. -// Supported schemes are basic authentication, an API key (either as a header or as a query parameter) -// and OAuth2's common flows (implicit, password, application and access code). -// -// For more information: http://goo.gl/8us55a#securitySchemeObject -type SecurityScheme struct { - VendorExtensible - SecuritySchemeProps -} - -// JSONLookup implements an interface to customize json pointer lookup -func (s SecurityScheme) JSONLookup(token string) (interface{}, error) { - if ex, ok := s.Extensions[token]; ok { - return &ex, nil - } - - r, _, err := jsonpointer.GetForToken(s.SecuritySchemeProps, token) - return r, err -} - -// MarshalJSON marshal this to JSON -func (s SecurityScheme) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(s.SecuritySchemeProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(s.VendorExtensible) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b1, b2), nil -} - -// UnmarshalJSON marshal this from JSON -func (s *SecurityScheme) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &s.SecuritySchemeProps); err != nil { - return err - } - if err := json.Unmarshal(data, &s.VendorExtensible); err != nil { - return err - } - return nil -} diff --git a/vendor/github.com/go-openapi/spec/spec.go b/vendor/github.com/go-openapi/spec/spec.go deleted file mode 100644 index 0bb045bc..00000000 --- a/vendor/github.com/go-openapi/spec/spec.go +++ /dev/null @@ -1,86 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import "encoding/json" - -//go:generate curl -L --progress -o ./schemas/v2/schema.json http://swagger.io/v2/schema.json -//go:generate curl -L --progress -o ./schemas/jsonschema-draft-04.json http://json-schema.org/draft-04/schema -//go:generate go-bindata -pkg=spec -prefix=./schemas -ignore=.*\.md ./schemas/... -//go:generate perl -pi -e s,Json,JSON,g bindata.go - -const ( - // SwaggerSchemaURL the url for the swagger 2.0 schema to validate specs - SwaggerSchemaURL = "http://swagger.io/v2/schema.json#" - // JSONSchemaURL the url for the json schema schema - JSONSchemaURL = "http://json-schema.org/draft-04/schema#" -) - -var ( - jsonSchema *Schema - swaggerSchema *Schema -) - -func init() { - jsonSchema = MustLoadJSONSchemaDraft04() - swaggerSchema = MustLoadSwagger20Schema() -} - -// MustLoadJSONSchemaDraft04 panics when Swagger20Schema returns an error -func MustLoadJSONSchemaDraft04() *Schema { - d, e := JSONSchemaDraft04() - if e != nil { - panic(e) - } - return d -} - -// JSONSchemaDraft04 loads the json schema document for json shema draft04 -func JSONSchemaDraft04() (*Schema, error) { - b, err := Asset("jsonschema-draft-04.json") - if err != nil { - return nil, err - } - - schema := new(Schema) - if err := json.Unmarshal(b, schema); err != nil { - return nil, err - } - return schema, nil -} - -// MustLoadSwagger20Schema panics when Swagger20Schema returns an error -func MustLoadSwagger20Schema() *Schema { - d, e := Swagger20Schema() - if e != nil { - panic(e) - } - return d -} - -// Swagger20Schema loads the swagger 2.0 schema from the embedded assets -func Swagger20Schema() (*Schema, error) { - - b, err := Asset("v2/schema.json") - if err != nil { - return nil, err - } - - schema := new(Schema) - if err := json.Unmarshal(b, schema); err != nil { - return nil, err - } - return schema, nil -} diff --git a/vendor/github.com/go-openapi/spec/swagger.go b/vendor/github.com/go-openapi/spec/swagger.go deleted file mode 100644 index 23780c78..00000000 --- a/vendor/github.com/go-openapi/spec/swagger.go +++ /dev/null @@ -1,317 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - "fmt" - "strconv" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -// Swagger this is the root document object for the API specification. -// It combines what previously was the Resource Listing and API Declaration (version 1.2 and earlier) together into one document. -// -// For more information: http://goo.gl/8us55a#swagger-object- -type Swagger struct { - VendorExtensible - SwaggerProps -} - -// JSONLookup look up a value by the json property name -func (s Swagger) JSONLookup(token string) (interface{}, error) { - if ex, ok := s.Extensions[token]; ok { - return &ex, nil - } - r, _, err := jsonpointer.GetForToken(s.SwaggerProps, token) - return r, err -} - -// MarshalJSON marshals this swagger structure to json -func (s Swagger) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(s.SwaggerProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(s.VendorExtensible) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b1, b2), nil -} - -// UnmarshalJSON unmarshals a swagger spec from json -func (s *Swagger) UnmarshalJSON(data []byte) error { - var sw Swagger - if err := json.Unmarshal(data, &sw.SwaggerProps); err != nil { - return err - } - if err := json.Unmarshal(data, &sw.VendorExtensible); err != nil { - return err - } - *s = sw - return nil -} - -type SwaggerProps struct { - ID string `json:"id,omitempty"` - Consumes []string `json:"consumes,omitempty"` - Produces []string `json:"produces,omitempty"` - Schemes []string `json:"schemes,omitempty"` // the scheme, when present must be from [http, https, ws, wss] - Swagger string `json:"swagger,omitempty"` - Info *Info `json:"info,omitempty"` - Host string `json:"host,omitempty"` - BasePath string `json:"basePath,omitempty"` // must start with a leading "/" - Paths *Paths `json:"paths"` // required - Definitions Definitions `json:"definitions,omitempty"` - Parameters map[string]Parameter `json:"parameters,omitempty"` - Responses map[string]Response `json:"responses,omitempty"` - SecurityDefinitions SecurityDefinitions `json:"securityDefinitions,omitempty"` - Security []map[string][]string `json:"security,omitempty"` - Tags []Tag `json:"tags,omitempty"` - ExternalDocs *ExternalDocumentation `json:"externalDocs,omitempty"` -} - -// Dependencies represent a dependencies property -type Dependencies map[string]SchemaOrStringArray - -// SchemaOrBool represents a schema or boolean value, is biased towards true for the boolean property -type SchemaOrBool struct { - Allows bool - Schema *Schema -} - -// JSONLookup implements an interface to customize json pointer lookup -func (s SchemaOrBool) JSONLookup(token string) (interface{}, error) { - if token == "allows" { - return s.Allows, nil - } - r, _, err := jsonpointer.GetForToken(s.Schema, token) - return r, err -} - -var jsTrue = []byte("true") -var jsFalse = []byte("false") - -// MarshalJSON convert this object to JSON -func (s SchemaOrBool) MarshalJSON() ([]byte, error) { - if s.Schema != nil { - return json.Marshal(s.Schema) - } - - if s.Schema == nil && !s.Allows { - return jsFalse, nil - } - return jsTrue, nil -} - -// UnmarshalJSON converts this bool or schema object from a JSON structure -func (s *SchemaOrBool) UnmarshalJSON(data []byte) error { - var nw SchemaOrBool - if len(data) >= 4 { - if data[0] == '{' { - var sch Schema - if err := json.Unmarshal(data, &sch); err != nil { - return err - } - nw.Schema = &sch - } - nw.Allows = !(data[0] == 'f' && data[1] == 'a' && data[2] == 'l' && data[3] == 's' && data[4] == 'e') - } - *s = nw - return nil -} - -// SchemaOrStringArray represents a schema or a string array -type SchemaOrStringArray struct { - Schema *Schema - Property []string -} - -// JSONLookup implements an interface to customize json pointer lookup -func (s SchemaOrStringArray) JSONLookup(token string) (interface{}, error) { - r, _, err := jsonpointer.GetForToken(s.Schema, token) - return r, err -} - -// MarshalJSON converts this schema object or array into JSON structure -func (s SchemaOrStringArray) MarshalJSON() ([]byte, error) { - if len(s.Property) > 0 { - return json.Marshal(s.Property) - } - if s.Schema != nil { - return json.Marshal(s.Schema) - } - return []byte("null"), nil -} - -// UnmarshalJSON converts this schema object or array from a JSON structure -func (s *SchemaOrStringArray) UnmarshalJSON(data []byte) error { - var first byte - if len(data) > 1 { - first = data[0] - } - var nw SchemaOrStringArray - if first == '{' { - var sch Schema - if err := json.Unmarshal(data, &sch); err != nil { - return err - } - nw.Schema = &sch - } - if first == '[' { - if err := json.Unmarshal(data, &nw.Property); err != nil { - return err - } - } - *s = nw - return nil -} - -// Definitions contains the models explicitly defined in this spec -// An object to hold data types that can be consumed and produced by operations. -// These data types can be primitives, arrays or models. -// -// For more information: http://goo.gl/8us55a#definitionsObject -type Definitions map[string]Schema - -// SecurityDefinitions a declaration of the security schemes available to be used in the specification. -// This does not enforce the security schemes on the operations and only serves to provide -// the relevant details for each scheme. -// -// For more information: http://goo.gl/8us55a#securityDefinitionsObject -type SecurityDefinitions map[string]*SecurityScheme - -// StringOrArray represents a value that can either be a string -// or an array of strings. Mainly here for serialization purposes -type StringOrArray []string - -// Contains returns true when the value is contained in the slice -func (s StringOrArray) Contains(value string) bool { - for _, str := range s { - if str == value { - return true - } - } - return false -} - -// JSONLookup implements an interface to customize json pointer lookup -func (s SchemaOrArray) JSONLookup(token string) (interface{}, error) { - if _, err := strconv.Atoi(token); err == nil { - r, _, err := jsonpointer.GetForToken(s.Schemas, token) - return r, err - } - r, _, err := jsonpointer.GetForToken(s.Schema, token) - return r, err -} - -// UnmarshalJSON unmarshals this string or array object from a JSON array or JSON string -func (s *StringOrArray) UnmarshalJSON(data []byte) error { - var first byte - if len(data) > 1 { - first = data[0] - } - - if first == '[' { - var parsed []string - if err := json.Unmarshal(data, &parsed); err != nil { - return err - } - *s = StringOrArray(parsed) - return nil - } - - var single interface{} - if err := json.Unmarshal(data, &single); err != nil { - return err - } - if single == nil { - return nil - } - switch single.(type) { - case string: - *s = StringOrArray([]string{single.(string)}) - return nil - default: - return fmt.Errorf("only string or array is allowed, not %T", single) - } -} - -// MarshalJSON converts this string or array to a JSON array or JSON string -func (s StringOrArray) MarshalJSON() ([]byte, error) { - if len(s) == 1 { - return json.Marshal([]string(s)[0]) - } - return json.Marshal([]string(s)) -} - -// SchemaOrArray represents a value that can either be a Schema -// or an array of Schema. Mainly here for serialization purposes -type SchemaOrArray struct { - Schema *Schema - Schemas []Schema -} - -// Len returns the number of schemas in this property -func (s SchemaOrArray) Len() int { - if s.Schema != nil { - return 1 - } - return len(s.Schemas) -} - -// ContainsType returns true when one of the schemas is of the specified type -func (s *SchemaOrArray) ContainsType(name string) bool { - if s.Schema != nil { - return s.Schema.Type != nil && s.Schema.Type.Contains(name) - } - return false -} - -// MarshalJSON converts this schema object or array into JSON structure -func (s SchemaOrArray) MarshalJSON() ([]byte, error) { - if len(s.Schemas) > 0 { - return json.Marshal(s.Schemas) - } - return json.Marshal(s.Schema) -} - -// UnmarshalJSON converts this schema object or array from a JSON structure -func (s *SchemaOrArray) UnmarshalJSON(data []byte) error { - var nw SchemaOrArray - var first byte - if len(data) > 1 { - first = data[0] - } - if first == '{' { - var sch Schema - if err := json.Unmarshal(data, &sch); err != nil { - return err - } - nw.Schema = &sch - } - if first == '[' { - if err := json.Unmarshal(data, &nw.Schemas); err != nil { - return err - } - } - *s = nw - return nil -} - -// vim:set ft=go noet sts=2 sw=2 ts=2: diff --git a/vendor/github.com/go-openapi/spec/tag.go b/vendor/github.com/go-openapi/spec/tag.go deleted file mode 100644 index 97f55584..00000000 --- a/vendor/github.com/go-openapi/spec/tag.go +++ /dev/null @@ -1,73 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -import ( - "encoding/json" - - "github.com/go-openapi/jsonpointer" - "github.com/go-openapi/swag" -) - -type TagProps struct { - Description string `json:"description,omitempty"` - Name string `json:"name,omitempty"` - ExternalDocs *ExternalDocumentation `json:"externalDocs,omitempty"` -} - -// NewTag creates a new tag -func NewTag(name, description string, externalDocs *ExternalDocumentation) Tag { - return Tag{TagProps: TagProps{description, name, externalDocs}} -} - -// Tag allows adding meta data to a single tag that is used by the [Operation Object](http://goo.gl/8us55a#operationObject). -// It is not mandatory to have a Tag Object per tag used there. -// -// For more information: http://goo.gl/8us55a#tagObject -type Tag struct { - VendorExtensible - TagProps -} - -// JSONLookup implements an interface to customize json pointer lookup -func (t Tag) JSONLookup(token string) (interface{}, error) { - if ex, ok := t.Extensions[token]; ok { - return &ex, nil - } - - r, _, err := jsonpointer.GetForToken(t.TagProps, token) - return r, err -} - -// MarshalJSON marshal this to JSON -func (t Tag) MarshalJSON() ([]byte, error) { - b1, err := json.Marshal(t.TagProps) - if err != nil { - return nil, err - } - b2, err := json.Marshal(t.VendorExtensible) - if err != nil { - return nil, err - } - return swag.ConcatJSON(b1, b2), nil -} - -// UnmarshalJSON marshal this from JSON -func (t *Tag) UnmarshalJSON(data []byte) error { - if err := json.Unmarshal(data, &t.TagProps); err != nil { - return err - } - return json.Unmarshal(data, &t.VendorExtensible) -} diff --git a/vendor/github.com/go-openapi/spec/xml_object.go b/vendor/github.com/go-openapi/spec/xml_object.go deleted file mode 100644 index 945a4670..00000000 --- a/vendor/github.com/go-openapi/spec/xml_object.go +++ /dev/null @@ -1,68 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package spec - -// XMLObject a metadata object that allows for more fine-tuned XML model definitions. -// -// For more information: http://goo.gl/8us55a#xmlObject -type XMLObject struct { - Name string `json:"name,omitempty"` - Namespace string `json:"namespace,omitempty"` - Prefix string `json:"prefix,omitempty"` - Attribute bool `json:"attribute,omitempty"` - Wrapped bool `json:"wrapped,omitempty"` -} - -// WithName sets the xml name for the object -func (x *XMLObject) WithName(name string) *XMLObject { - x.Name = name - return x -} - -// WithNamespace sets the xml namespace for the object -func (x *XMLObject) WithNamespace(namespace string) *XMLObject { - x.Namespace = namespace - return x -} - -// WithPrefix sets the xml prefix for the object -func (x *XMLObject) WithPrefix(prefix string) *XMLObject { - x.Prefix = prefix - return x -} - -// AsAttribute flags this object as xml attribute -func (x *XMLObject) AsAttribute() *XMLObject { - x.Attribute = true - return x -} - -// AsElement flags this object as an xml node -func (x *XMLObject) AsElement() *XMLObject { - x.Attribute = false - return x -} - -// AsWrapped flags this object as wrapped, this is mostly useful for array types -func (x *XMLObject) AsWrapped() *XMLObject { - x.Wrapped = true - return x -} - -// AsUnwrapped flags this object as an xml node -func (x *XMLObject) AsUnwrapped() *XMLObject { - x.Wrapped = false - return x -} diff --git a/vendor/github.com/go-openapi/swag/.editorconfig b/vendor/github.com/go-openapi/swag/.editorconfig deleted file mode 100644 index 3152da69..00000000 --- a/vendor/github.com/go-openapi/swag/.editorconfig +++ /dev/null @@ -1,26 +0,0 @@ -# top-most EditorConfig file -root = true - -# Unix-style newlines with a newline ending every file -[*] -end_of_line = lf -insert_final_newline = true -indent_style = space -indent_size = 2 -trim_trailing_whitespace = true - -# Set default charset -[*.{js,py,go,scala,rb,java,html,css,less,sass,md}] -charset = utf-8 - -# Tab indentation (no size specified) -[*.go] -indent_style = tab - -[*.md] -trim_trailing_whitespace = false - -# Matches the exact files either package.json or .travis.yml -[{package.json,.travis.yml}] -indent_style = space -indent_size = 2 diff --git a/vendor/github.com/go-openapi/swag/.gitignore b/vendor/github.com/go-openapi/swag/.gitignore deleted file mode 100644 index 769c2440..00000000 --- a/vendor/github.com/go-openapi/swag/.gitignore +++ /dev/null @@ -1 +0,0 @@ -secrets.yml diff --git a/vendor/github.com/go-openapi/swag/.travis.yml b/vendor/github.com/go-openapi/swag/.travis.yml deleted file mode 100644 index 24c69bdf..00000000 --- a/vendor/github.com/go-openapi/swag/.travis.yml +++ /dev/null @@ -1,14 +0,0 @@ -language: go -go: -- 1.8 -install: -- go get -u github.com/stretchr/testify -- go get -u github.com/mailru/easyjson -- go get -u gopkg.in/yaml.v2 -script: -- go test -v -race -cover -coverprofile=coverage.txt -covermode=atomic ./... -after_success: -- bash <(curl -s https://codecov.io/bash) -notifications: - slack: - secure: QUWvCkBBK09GF7YtEvHHVt70JOkdlNBG0nIKu/5qc4/nW5HP8I2w0SEf/XR2je0eED1Qe3L/AfMCWwrEj+IUZc3l4v+ju8X8R3Lomhme0Eb0jd1MTMCuPcBT47YCj0M7RON7vXtbFfm1hFJ/jLe5+9FXz0hpXsR24PJc5ZIi/ogNwkaPqG4BmndzecpSh0vc2FJPZUD9LT0I09REY/vXR0oQAalLkW0asGD5taHZTUZq/kBpsNxaAFrLM23i4mUcf33M5fjLpvx5LRICrX/57XpBrDh2TooBU6Qj3CgoY0uPRYUmSNxbVx1czNzl2JtEpb5yjoxfVPQeg0BvQM00G8LJINISR+ohrjhkZmAqchDupAX+yFrxTtORa78CtnIL6z/aTNlgwwVD8kvL/1pFA/JWYmKDmz93mV/+6wubGzNSQCstzjkFA4/iZEKewKUoRIAi/fxyscP6L/rCpmY/4llZZvrnyTqVbt6URWpopUpH4rwYqreXAtJxJsfBJIeSmUIiDIOMGkCTvyTEW3fWGmGoqWtSHLoaWDyAIGb7azb+KvfpWtEcoPFWfSWU+LGee0A/YsUhBl7ADB9A0CJEuR8q4BPpKpfLwPKSiKSAXL7zDkyjExyhtgqbSl2jS+rKIHOZNL8JkCcTP2MKMVd563C5rC5FMKqu3S9m2b6380E= diff --git a/vendor/github.com/go-openapi/swag/CODE_OF_CONDUCT.md b/vendor/github.com/go-openapi/swag/CODE_OF_CONDUCT.md deleted file mode 100644 index 9322b065..00000000 --- a/vendor/github.com/go-openapi/swag/CODE_OF_CONDUCT.md +++ /dev/null @@ -1,74 +0,0 @@ -# Contributor Covenant Code of Conduct - -## Our Pledge - -In the interest of fostering an open and welcoming environment, we as -contributors and maintainers pledge to making participation in our project and -our community a harassment-free experience for everyone, regardless of age, body -size, disability, ethnicity, gender identity and expression, level of experience, -nationality, personal appearance, race, religion, or sexual identity and -orientation. - -## Our Standards - -Examples of behavior that contributes to creating a positive environment -include: - -* Using welcoming and inclusive language -* Being respectful of differing viewpoints and experiences -* Gracefully accepting constructive criticism -* Focusing on what is best for the community -* Showing empathy towards other community members - -Examples of unacceptable behavior by participants include: - -* The use of sexualized language or imagery and unwelcome sexual attention or -advances -* Trolling, insulting/derogatory comments, and personal or political attacks -* Public or private harassment -* Publishing others' private information, such as a physical or electronic - address, without explicit permission -* Other conduct which could reasonably be considered inappropriate in a - professional setting - -## Our Responsibilities - -Project maintainers are responsible for clarifying the standards of acceptable -behavior and are expected to take appropriate and fair corrective action in -response to any instances of unacceptable behavior. - -Project maintainers have the right and responsibility to remove, edit, or -reject comments, commits, code, wiki edits, issues, and other contributions -that are not aligned to this Code of Conduct, or to ban temporarily or -permanently any contributor for other behaviors that they deem inappropriate, -threatening, offensive, or harmful. - -## Scope - -This Code of Conduct applies both within project spaces and in public spaces -when an individual is representing the project or its community. Examples of -representing a project or community include using an official project e-mail -address, posting via an official social media account, or acting as an appointed -representative at an online or offline event. Representation of a project may be -further defined and clarified by project maintainers. - -## Enforcement - -Instances of abusive, harassing, or otherwise unacceptable behavior may be -reported by contacting the project team at ivan+abuse@flanders.co.nz. All -complaints will be reviewed and investigated and will result in a response that -is deemed necessary and appropriate to the circumstances. The project team is -obligated to maintain confidentiality with regard to the reporter of an incident. -Further details of specific enforcement policies may be posted separately. - -Project maintainers who do not follow or enforce the Code of Conduct in good -faith may face temporary or permanent repercussions as determined by other -members of the project's leadership. - -## Attribution - -This Code of Conduct is adapted from the [Contributor Covenant][homepage], version 1.4, -available at [http://contributor-covenant.org/version/1/4][version] - -[homepage]: http://contributor-covenant.org -[version]: http://contributor-covenant.org/version/1/4/ diff --git a/vendor/github.com/go-openapi/swag/LICENSE b/vendor/github.com/go-openapi/swag/LICENSE deleted file mode 100644 index d6456956..00000000 --- a/vendor/github.com/go-openapi/swag/LICENSE +++ /dev/null @@ -1,202 +0,0 @@ - - Apache License - Version 2.0, January 2004 - http://www.apache.org/licenses/ - - TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION - - 1. Definitions. - - "License" shall mean the terms and conditions for use, reproduction, - and distribution as defined by Sections 1 through 9 of this document. - - "Licensor" shall mean the copyright owner or entity authorized by - the copyright owner that is granting the License. - - "Legal Entity" shall mean the union of the acting entity and all - other entities that control, are controlled by, or are under common - control with that entity. For the purposes of this definition, - "control" means (i) the power, direct or indirect, to cause the - direction or management of such entity, whether by contract or - otherwise, or (ii) ownership of fifty percent (50%) or more of the - outstanding shares, or (iii) beneficial ownership of such entity. - - "You" (or "Your") shall mean an individual or Legal Entity - exercising permissions granted by this License. - - "Source" form shall mean the preferred form for making modifications, - including but not limited to software source code, documentation - source, and configuration files. - - "Object" form shall mean any form resulting from mechanical - transformation or translation of a Source form, including but - not limited to compiled object code, generated documentation, - and conversions to other media types. - - "Work" shall mean the work of authorship, whether in Source or - Object form, made available under the License, as indicated by a - copyright notice that is included in or attached to the work - (an example is provided in the Appendix below). - - "Derivative Works" shall mean any work, whether in Source or Object - form, that is based on (or derived from) the Work and for which the - editorial revisions, annotations, elaborations, or other modifications - represent, as a whole, an original work of authorship. For the purposes - of this License, Derivative Works shall not include works that remain - separable from, or merely link (or bind by name) to the interfaces of, - the Work and Derivative Works thereof. - - "Contribution" shall mean any work of authorship, including - the original version of the Work and any modifications or additions - to that Work or Derivative Works thereof, that is intentionally - submitted to Licensor for inclusion in the Work by the copyright owner - or by an individual or Legal Entity authorized to submit on behalf of - the copyright owner. For the purposes of this definition, "submitted" - means any form of electronic, verbal, or written communication sent - to the Licensor or its representatives, including but not limited to - communication on electronic mailing lists, source code control systems, - and issue tracking systems that are managed by, or on behalf of, the - Licensor for the purpose of discussing and improving the Work, but - excluding communication that is conspicuously marked or otherwise - designated in writing by the copyright owner as "Not a Contribution." - - "Contributor" shall mean Licensor and any individual or Legal Entity - on behalf of whom a Contribution has been received by Licensor and - subsequently incorporated within the Work. - - 2. Grant of Copyright License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - copyright license to reproduce, prepare Derivative Works of, - publicly display, publicly perform, sublicense, and distribute the - Work and such Derivative Works in Source or Object form. - - 3. Grant of Patent License. Subject to the terms and conditions of - this License, each Contributor hereby grants to You a perpetual, - worldwide, non-exclusive, no-charge, royalty-free, irrevocable - (except as stated in this section) patent license to make, have made, - use, offer to sell, sell, import, and otherwise transfer the Work, - where such license applies only to those patent claims licensable - by such Contributor that are necessarily infringed by their - Contribution(s) alone or by combination of their Contribution(s) - with the Work to which such Contribution(s) was submitted. If You - institute patent litigation against any entity (including a - cross-claim or counterclaim in a lawsuit) alleging that the Work - or a Contribution incorporated within the Work constitutes direct - or contributory patent infringement, then any patent licenses - granted to You under this License for that Work shall terminate - as of the date such litigation is filed. - - 4. Redistribution. You may reproduce and distribute copies of the - Work or Derivative Works thereof in any medium, with or without - modifications, and in Source or Object form, provided that You - meet the following conditions: - - (a) You must give any other recipients of the Work or - Derivative Works a copy of this License; and - - (b) You must cause any modified files to carry prominent notices - stating that You changed the files; and - - (c) You must retain, in the Source form of any Derivative Works - that You distribute, all copyright, patent, trademark, and - attribution notices from the Source form of the Work, - excluding those notices that do not pertain to any part of - the Derivative Works; and - - (d) If the Work includes a "NOTICE" text file as part of its - distribution, then any Derivative Works that You distribute must - include a readable copy of the attribution notices contained - within such NOTICE file, excluding those notices that do not - pertain to any part of the Derivative Works, in at least one - of the following places: within a NOTICE text file distributed - as part of the Derivative Works; within the Source form or - documentation, if provided along with the Derivative Works; or, - within a display generated by the Derivative Works, if and - wherever such third-party notices normally appear. The contents - of the NOTICE file are for informational purposes only and - do not modify the License. You may add Your own attribution - notices within Derivative Works that You distribute, alongside - or as an addendum to the NOTICE text from the Work, provided - that such additional attribution notices cannot be construed - as modifying the License. - - You may add Your own copyright statement to Your modifications and - may provide additional or different license terms and conditions - for use, reproduction, or distribution of Your modifications, or - for any such Derivative Works as a whole, provided Your use, - reproduction, and distribution of the Work otherwise complies with - the conditions stated in this License. - - 5. Submission of Contributions. Unless You explicitly state otherwise, - any Contribution intentionally submitted for inclusion in the Work - by You to the Licensor shall be under the terms and conditions of - this License, without any additional terms or conditions. - Notwithstanding the above, nothing herein shall supersede or modify - the terms of any separate license agreement you may have executed - with Licensor regarding such Contributions. - - 6. Trademarks. This License does not grant permission to use the trade - names, trademarks, service marks, or product names of the Licensor, - except as required for reasonable and customary use in describing the - origin of the Work and reproducing the content of the NOTICE file. - - 7. Disclaimer of Warranty. Unless required by applicable law or - agreed to in writing, Licensor provides the Work (and each - Contributor provides its Contributions) on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or - implied, including, without limitation, any warranties or conditions - of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A - PARTICULAR PURPOSE. You are solely responsible for determining the - appropriateness of using or redistributing the Work and assume any - risks associated with Your exercise of permissions under this License. - - 8. Limitation of Liability. In no event and under no legal theory, - whether in tort (including negligence), contract, or otherwise, - unless required by applicable law (such as deliberate and grossly - negligent acts) or agreed to in writing, shall any Contributor be - liable to You for damages, including any direct, indirect, special, - incidental, or consequential damages of any character arising as a - result of this License or out of the use or inability to use the - Work (including but not limited to damages for loss of goodwill, - work stoppage, computer failure or malfunction, or any and all - other commercial damages or losses), even if such Contributor - has been advised of the possibility of such damages. - - 9. Accepting Warranty or Additional Liability. While redistributing - the Work or Derivative Works thereof, You may choose to offer, - and charge a fee for, acceptance of support, warranty, indemnity, - or other liability obligations and/or rights consistent with this - License. However, in accepting such obligations, You may act only - on Your own behalf and on Your sole responsibility, not on behalf - of any other Contributor, and only if You agree to indemnify, - defend, and hold each Contributor harmless for any liability - incurred by, or claims asserted against, such Contributor by reason - of your accepting any such warranty or additional liability. - - END OF TERMS AND CONDITIONS - - APPENDIX: How to apply the Apache License to your work. - - To apply the Apache License to your work, attach the following - boilerplate notice, with the fields enclosed by brackets "[]" - replaced with your own identifying information. (Don't include - the brackets!) The text should be enclosed in the appropriate - comment syntax for the file format. We also recommend that a - file or class name and description of purpose be included on the - same "printed page" as the copyright notice for easier - identification within third-party archives. - - Copyright [yyyy] [name of copyright owner] - - Licensed under the Apache License, Version 2.0 (the "License"); - you may not use this file except in compliance with the License. - You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - - Unless required by applicable law or agreed to in writing, software - distributed under the License is distributed on an "AS IS" BASIS, - WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. - See the License for the specific language governing permissions and - limitations under the License. diff --git a/vendor/github.com/go-openapi/swag/README.md b/vendor/github.com/go-openapi/swag/README.md deleted file mode 100644 index 5d43728e..00000000 --- a/vendor/github.com/go-openapi/swag/README.md +++ /dev/null @@ -1,12 +0,0 @@ -# Swag [![Build Status](https://travis-ci.org/go-openapi/swag.svg?branch=master)](https://travis-ci.org/go-openapi/swag) [![codecov](https://codecov.io/gh/go-openapi/swag/branch/master/graph/badge.svg)](https://codecov.io/gh/go-openapi/swag) [![Slack Status](https://slackin.goswagger.io/badge.svg)](https://slackin.goswagger.io) - -[![license](http://img.shields.io/badge/license-Apache%20v2-orange.svg)](https://raw.githubusercontent.com/go-openapi/swag/master/LICENSE) [![GoDoc](https://godoc.org/github.com/go-openapi/swag?status.svg)](http://godoc.org/github.com/go-openapi/swag) - -Contains a bunch of helper functions: - -* convert between value and pointers for builtins -* convert from string to builtin -* fast json concatenation -* search in path -* load from file or http -* name manglin \ No newline at end of file diff --git a/vendor/github.com/go-openapi/swag/convert.go b/vendor/github.com/go-openapi/swag/convert.go deleted file mode 100644 index 2bf5ecbb..00000000 --- a/vendor/github.com/go-openapi/swag/convert.go +++ /dev/null @@ -1,188 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package swag - -import ( - "math" - "strconv" - "strings" -) - -// same as ECMA Number.MAX_SAFE_INTEGER and Number.MIN_SAFE_INTEGER -const ( - maxJSONFloat = float64(1<<53 - 1) // 9007199254740991.0 2^53 - 1 - minJSONFloat = -float64(1<<53 - 1) //-9007199254740991.0 -2^53 - 1 -) - -// IsFloat64AJSONInteger allow for integers [-2^53, 2^53-1] inclusive -func IsFloat64AJSONInteger(f float64) bool { - if math.IsNaN(f) || math.IsInf(f, 0) || f < minJSONFloat || f > maxJSONFloat { - return false - } - - return f == float64(int64(f)) || f == float64(uint64(f)) -} - -var evaluatesAsTrue = map[string]struct{}{ - "true": struct{}{}, - "1": struct{}{}, - "yes": struct{}{}, - "ok": struct{}{}, - "y": struct{}{}, - "on": struct{}{}, - "selected": struct{}{}, - "checked": struct{}{}, - "t": struct{}{}, - "enabled": struct{}{}, -} - -// ConvertBool turn a string into a boolean -func ConvertBool(str string) (bool, error) { - _, ok := evaluatesAsTrue[strings.ToLower(str)] - return ok, nil -} - -// ConvertFloat32 turn a string into a float32 -func ConvertFloat32(str string) (float32, error) { - f, err := strconv.ParseFloat(str, 32) - if err != nil { - return 0, err - } - return float32(f), nil -} - -// ConvertFloat64 turn a string into a float64 -func ConvertFloat64(str string) (float64, error) { - return strconv.ParseFloat(str, 64) -} - -// ConvertInt8 turn a string into int8 boolean -func ConvertInt8(str string) (int8, error) { - i, err := strconv.ParseInt(str, 10, 8) - if err != nil { - return 0, err - } - return int8(i), nil -} - -// ConvertInt16 turn a string into a int16 -func ConvertInt16(str string) (int16, error) { - i, err := strconv.ParseInt(str, 10, 16) - if err != nil { - return 0, err - } - return int16(i), nil -} - -// ConvertInt32 turn a string into a int32 -func ConvertInt32(str string) (int32, error) { - i, err := strconv.ParseInt(str, 10, 32) - if err != nil { - return 0, err - } - return int32(i), nil -} - -// ConvertInt64 turn a string into a int64 -func ConvertInt64(str string) (int64, error) { - return strconv.ParseInt(str, 10, 64) -} - -// ConvertUint8 turn a string into a uint8 -func ConvertUint8(str string) (uint8, error) { - i, err := strconv.ParseUint(str, 10, 8) - if err != nil { - return 0, err - } - return uint8(i), nil -} - -// ConvertUint16 turn a string into a uint16 -func ConvertUint16(str string) (uint16, error) { - i, err := strconv.ParseUint(str, 10, 16) - if err != nil { - return 0, err - } - return uint16(i), nil -} - -// ConvertUint32 turn a string into a uint32 -func ConvertUint32(str string) (uint32, error) { - i, err := strconv.ParseUint(str, 10, 32) - if err != nil { - return 0, err - } - return uint32(i), nil -} - -// ConvertUint64 turn a string into a uint64 -func ConvertUint64(str string) (uint64, error) { - return strconv.ParseUint(str, 10, 64) -} - -// FormatBool turns a boolean into a string -func FormatBool(value bool) string { - return strconv.FormatBool(value) -} - -// FormatFloat32 turns a float32 into a string -func FormatFloat32(value float32) string { - return strconv.FormatFloat(float64(value), 'f', -1, 32) -} - -// FormatFloat64 turns a float64 into a string -func FormatFloat64(value float64) string { - return strconv.FormatFloat(value, 'f', -1, 64) -} - -// FormatInt8 turns an int8 into a string -func FormatInt8(value int8) string { - return strconv.FormatInt(int64(value), 10) -} - -// FormatInt16 turns an int16 into a string -func FormatInt16(value int16) string { - return strconv.FormatInt(int64(value), 10) -} - -// FormatInt32 turns an int32 into a string -func FormatInt32(value int32) string { - return strconv.Itoa(int(value)) -} - -// FormatInt64 turns an int64 into a string -func FormatInt64(value int64) string { - return strconv.FormatInt(value, 10) -} - -// FormatUint8 turns an uint8 into a string -func FormatUint8(value uint8) string { - return strconv.FormatUint(uint64(value), 10) -} - -// FormatUint16 turns an uint16 into a string -func FormatUint16(value uint16) string { - return strconv.FormatUint(uint64(value), 10) -} - -// FormatUint32 turns an uint32 into a string -func FormatUint32(value uint32) string { - return strconv.FormatUint(uint64(value), 10) -} - -// FormatUint64 turns an uint64 into a string -func FormatUint64(value uint64) string { - return strconv.FormatUint(value, 10) -} diff --git a/vendor/github.com/go-openapi/swag/convert_types.go b/vendor/github.com/go-openapi/swag/convert_types.go deleted file mode 100644 index c95e4e78..00000000 --- a/vendor/github.com/go-openapi/swag/convert_types.go +++ /dev/null @@ -1,595 +0,0 @@ -package swag - -import "time" - -// This file was taken from the aws go sdk - -// String returns a pointer to of the string value passed in. -func String(v string) *string { - return &v -} - -// StringValue returns the value of the string pointer passed in or -// "" if the pointer is nil. -func StringValue(v *string) string { - if v != nil { - return *v - } - return "" -} - -// StringSlice converts a slice of string values into a slice of -// string pointers -func StringSlice(src []string) []*string { - dst := make([]*string, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// StringValueSlice converts a slice of string pointers into a slice of -// string values -func StringValueSlice(src []*string) []string { - dst := make([]string, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// StringMap converts a string map of string values into a string -// map of string pointers -func StringMap(src map[string]string) map[string]*string { - dst := make(map[string]*string) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// StringValueMap converts a string map of string pointers into a string -// map of string values -func StringValueMap(src map[string]*string) map[string]string { - dst := make(map[string]string) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Bool returns a pointer to of the bool value passed in. -func Bool(v bool) *bool { - return &v -} - -// BoolValue returns the value of the bool pointer passed in or -// false if the pointer is nil. -func BoolValue(v *bool) bool { - if v != nil { - return *v - } - return false -} - -// BoolSlice converts a slice of bool values into a slice of -// bool pointers -func BoolSlice(src []bool) []*bool { - dst := make([]*bool, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// BoolValueSlice converts a slice of bool pointers into a slice of -// bool values -func BoolValueSlice(src []*bool) []bool { - dst := make([]bool, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// BoolMap converts a string map of bool values into a string -// map of bool pointers -func BoolMap(src map[string]bool) map[string]*bool { - dst := make(map[string]*bool) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// BoolValueMap converts a string map of bool pointers into a string -// map of bool values -func BoolValueMap(src map[string]*bool) map[string]bool { - dst := make(map[string]bool) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Int returns a pointer to of the int value passed in. -func Int(v int) *int { - return &v -} - -// IntValue returns the value of the int pointer passed in or -// 0 if the pointer is nil. -func IntValue(v *int) int { - if v != nil { - return *v - } - return 0 -} - -// IntSlice converts a slice of int values into a slice of -// int pointers -func IntSlice(src []int) []*int { - dst := make([]*int, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// IntValueSlice converts a slice of int pointers into a slice of -// int values -func IntValueSlice(src []*int) []int { - dst := make([]int, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// IntMap converts a string map of int values into a string -// map of int pointers -func IntMap(src map[string]int) map[string]*int { - dst := make(map[string]*int) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// IntValueMap converts a string map of int pointers into a string -// map of int values -func IntValueMap(src map[string]*int) map[string]int { - dst := make(map[string]int) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Int32 returns a pointer to of the int64 value passed in. -func Int32(v int32) *int32 { - return &v -} - -// Int32Value returns the value of the int64 pointer passed in or -// 0 if the pointer is nil. -func Int32Value(v *int32) int32 { - if v != nil { - return *v - } - return 0 -} - -// Int32Slice converts a slice of int64 values into a slice of -// int32 pointers -func Int32Slice(src []int32) []*int32 { - dst := make([]*int32, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// Int32ValueSlice converts a slice of int32 pointers into a slice of -// int32 values -func Int32ValueSlice(src []*int32) []int32 { - dst := make([]int32, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// Int32Map converts a string map of int32 values into a string -// map of int32 pointers -func Int32Map(src map[string]int32) map[string]*int32 { - dst := make(map[string]*int32) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// Int32ValueMap converts a string map of int32 pointers into a string -// map of int32 values -func Int32ValueMap(src map[string]*int32) map[string]int32 { - dst := make(map[string]int32) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Int64 returns a pointer to of the int64 value passed in. -func Int64(v int64) *int64 { - return &v -} - -// Int64Value returns the value of the int64 pointer passed in or -// 0 if the pointer is nil. -func Int64Value(v *int64) int64 { - if v != nil { - return *v - } - return 0 -} - -// Int64Slice converts a slice of int64 values into a slice of -// int64 pointers -func Int64Slice(src []int64) []*int64 { - dst := make([]*int64, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// Int64ValueSlice converts a slice of int64 pointers into a slice of -// int64 values -func Int64ValueSlice(src []*int64) []int64 { - dst := make([]int64, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// Int64Map converts a string map of int64 values into a string -// map of int64 pointers -func Int64Map(src map[string]int64) map[string]*int64 { - dst := make(map[string]*int64) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// Int64ValueMap converts a string map of int64 pointers into a string -// map of int64 values -func Int64ValueMap(src map[string]*int64) map[string]int64 { - dst := make(map[string]int64) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Uint returns a pouinter to of the uint value passed in. -func Uint(v uint) *uint { - return &v -} - -// UintValue returns the value of the uint pouinter passed in or -// 0 if the pouinter is nil. -func UintValue(v *uint) uint { - if v != nil { - return *v - } - return 0 -} - -// UintSlice converts a slice of uint values uinto a slice of -// uint pouinters -func UintSlice(src []uint) []*uint { - dst := make([]*uint, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// UintValueSlice converts a slice of uint pouinters uinto a slice of -// uint values -func UintValueSlice(src []*uint) []uint { - dst := make([]uint, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// UintMap converts a string map of uint values uinto a string -// map of uint pouinters -func UintMap(src map[string]uint) map[string]*uint { - dst := make(map[string]*uint) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// UintValueMap converts a string map of uint pouinters uinto a string -// map of uint values -func UintValueMap(src map[string]*uint) map[string]uint { - dst := make(map[string]uint) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Uint32 returns a pouinter to of the uint64 value passed in. -func Uint32(v uint32) *uint32 { - return &v -} - -// Uint32Value returns the value of the uint64 pouinter passed in or -// 0 if the pouinter is nil. -func Uint32Value(v *uint32) uint32 { - if v != nil { - return *v - } - return 0 -} - -// Uint32Slice converts a slice of uint64 values uinto a slice of -// uint32 pouinters -func Uint32Slice(src []uint32) []*uint32 { - dst := make([]*uint32, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// Uint32ValueSlice converts a slice of uint32 pouinters uinto a slice of -// uint32 values -func Uint32ValueSlice(src []*uint32) []uint32 { - dst := make([]uint32, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// Uint32Map converts a string map of uint32 values uinto a string -// map of uint32 pouinters -func Uint32Map(src map[string]uint32) map[string]*uint32 { - dst := make(map[string]*uint32) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// Uint32ValueMap converts a string map of uint32 pouinters uinto a string -// map of uint32 values -func Uint32ValueMap(src map[string]*uint32) map[string]uint32 { - dst := make(map[string]uint32) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Uint64 returns a pouinter to of the uint64 value passed in. -func Uint64(v uint64) *uint64 { - return &v -} - -// Uint64Value returns the value of the uint64 pouinter passed in or -// 0 if the pouinter is nil. -func Uint64Value(v *uint64) uint64 { - if v != nil { - return *v - } - return 0 -} - -// Uint64Slice converts a slice of uint64 values uinto a slice of -// uint64 pouinters -func Uint64Slice(src []uint64) []*uint64 { - dst := make([]*uint64, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// Uint64ValueSlice converts a slice of uint64 pouinters uinto a slice of -// uint64 values -func Uint64ValueSlice(src []*uint64) []uint64 { - dst := make([]uint64, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// Uint64Map converts a string map of uint64 values uinto a string -// map of uint64 pouinters -func Uint64Map(src map[string]uint64) map[string]*uint64 { - dst := make(map[string]*uint64) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// Uint64ValueMap converts a string map of uint64 pouinters uinto a string -// map of uint64 values -func Uint64ValueMap(src map[string]*uint64) map[string]uint64 { - dst := make(map[string]uint64) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Float64 returns a pointer to of the float64 value passed in. -func Float64(v float64) *float64 { - return &v -} - -// Float64Value returns the value of the float64 pointer passed in or -// 0 if the pointer is nil. -func Float64Value(v *float64) float64 { - if v != nil { - return *v - } - return 0 -} - -// Float64Slice converts a slice of float64 values into a slice of -// float64 pointers -func Float64Slice(src []float64) []*float64 { - dst := make([]*float64, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// Float64ValueSlice converts a slice of float64 pointers into a slice of -// float64 values -func Float64ValueSlice(src []*float64) []float64 { - dst := make([]float64, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// Float64Map converts a string map of float64 values into a string -// map of float64 pointers -func Float64Map(src map[string]float64) map[string]*float64 { - dst := make(map[string]*float64) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// Float64ValueMap converts a string map of float64 pointers into a string -// map of float64 values -func Float64ValueMap(src map[string]*float64) map[string]float64 { - dst := make(map[string]float64) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} - -// Time returns a pointer to of the time.Time value passed in. -func Time(v time.Time) *time.Time { - return &v -} - -// TimeValue returns the value of the time.Time pointer passed in or -// time.Time{} if the pointer is nil. -func TimeValue(v *time.Time) time.Time { - if v != nil { - return *v - } - return time.Time{} -} - -// TimeSlice converts a slice of time.Time values into a slice of -// time.Time pointers -func TimeSlice(src []time.Time) []*time.Time { - dst := make([]*time.Time, len(src)) - for i := 0; i < len(src); i++ { - dst[i] = &(src[i]) - } - return dst -} - -// TimeValueSlice converts a slice of time.Time pointers into a slice of -// time.Time values -func TimeValueSlice(src []*time.Time) []time.Time { - dst := make([]time.Time, len(src)) - for i := 0; i < len(src); i++ { - if src[i] != nil { - dst[i] = *(src[i]) - } - } - return dst -} - -// TimeMap converts a string map of time.Time values into a string -// map of time.Time pointers -func TimeMap(src map[string]time.Time) map[string]*time.Time { - dst := make(map[string]*time.Time) - for k, val := range src { - v := val - dst[k] = &v - } - return dst -} - -// TimeValueMap converts a string map of time.Time pointers into a string -// map of time.Time values -func TimeValueMap(src map[string]*time.Time) map[string]time.Time { - dst := make(map[string]time.Time) - for k, val := range src { - if val != nil { - dst[k] = *val - } - } - return dst -} diff --git a/vendor/github.com/go-openapi/swag/json.go b/vendor/github.com/go-openapi/swag/json.go deleted file mode 100644 index cb20a6a0..00000000 --- a/vendor/github.com/go-openapi/swag/json.go +++ /dev/null @@ -1,295 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package swag - -import ( - "bytes" - "encoding/json" - "log" - "reflect" - "strings" - "sync" - - "github.com/mailru/easyjson/jlexer" - "github.com/mailru/easyjson/jwriter" -) - -// DefaultJSONNameProvider the default cache for types -var DefaultJSONNameProvider = NewNameProvider() - -const comma = byte(',') - -var closers = map[byte]byte{ - '{': '}', - '[': ']', -} - -type ejMarshaler interface { - MarshalEasyJSON(w *jwriter.Writer) -} - -type ejUnmarshaler interface { - UnmarshalEasyJSON(w *jlexer.Lexer) -} - -// WriteJSON writes json data, prefers finding an appropriate interface to short-circuit the marshaller -// so it takes the fastest option available. -func WriteJSON(data interface{}) ([]byte, error) { - if d, ok := data.(ejMarshaler); ok { - jw := new(jwriter.Writer) - d.MarshalEasyJSON(jw) - return jw.BuildBytes() - } - if d, ok := data.(json.Marshaler); ok { - return d.MarshalJSON() - } - return json.Marshal(data) -} - -// ReadJSON reads json data, prefers finding an appropriate interface to short-circuit the unmarshaller -// so it takes the fastes option available -func ReadJSON(data []byte, value interface{}) error { - if d, ok := value.(ejUnmarshaler); ok { - jl := &jlexer.Lexer{Data: data} - d.UnmarshalEasyJSON(jl) - return jl.Error() - } - if d, ok := value.(json.Unmarshaler); ok { - return d.UnmarshalJSON(data) - } - return json.Unmarshal(data, value) -} - -// DynamicJSONToStruct converts an untyped json structure into a struct -func DynamicJSONToStruct(data interface{}, target interface{}) error { - // TODO: convert straight to a json typed map (mergo + iterate?) - b, err := WriteJSON(data) - if err != nil { - return err - } - if err := ReadJSON(b, target); err != nil { - return err - } - return nil -} - -// ConcatJSON concatenates multiple json objects efficiently -func ConcatJSON(blobs ...[]byte) []byte { - if len(blobs) == 0 { - return nil - } - if len(blobs) == 1 { - return blobs[0] - } - - last := len(blobs) - 1 - var opening, closing byte - a := 0 - idx := 0 - buf := bytes.NewBuffer(nil) - - for i, b := range blobs { - if len(b) > 0 && opening == 0 { // is this an array or an object? - opening, closing = b[0], closers[b[0]] - } - - if opening != '{' && opening != '[' { - continue // don't know how to concatenate non container objects - } - - if len(b) < 3 { // yep empty but also the last one, so closing this thing - if i == last && a > 0 { - if err := buf.WriteByte(closing); err != nil { - log.Println(err) - } - } - continue - } - - idx = 0 - if a > 0 { // we need to join with a comma for everything beyond the first non-empty item - if err := buf.WriteByte(comma); err != nil { - log.Println(err) - } - idx = 1 // this is not the first or the last so we want to drop the leading bracket - } - - if i != last { // not the last one, strip brackets - if _, err := buf.Write(b[idx : len(b)-1]); err != nil { - log.Println(err) - } - } else { // last one, strip only the leading bracket - if _, err := buf.Write(b[idx:]); err != nil { - log.Println(err) - } - } - a++ - } - // somehow it ended up being empty, so provide a default value - if buf.Len() == 0 { - if err := buf.WriteByte(opening); err != nil { - log.Println(err) - } - if err := buf.WriteByte(closing); err != nil { - log.Println(err) - } - } - return buf.Bytes() -} - -// ToDynamicJSON turns an object into a properly JSON typed structure -func ToDynamicJSON(data interface{}) interface{} { - // TODO: convert straight to a json typed map (mergo + iterate?) - b, err := json.Marshal(data) - if err != nil { - log.Println(err) - } - var res interface{} - if err := json.Unmarshal(b, &res); err != nil { - log.Println(err) - } - return res -} - -// FromDynamicJSON turns an object into a properly JSON typed structure -func FromDynamicJSON(data, target interface{}) error { - b, err := json.Marshal(data) - if err != nil { - log.Println(err) - } - return json.Unmarshal(b, target) -} - -// NameProvider represents an object capabale of translating from go property names -// to json property names -// This type is thread-safe. -type NameProvider struct { - lock *sync.Mutex - index map[reflect.Type]nameIndex -} - -type nameIndex struct { - jsonNames map[string]string - goNames map[string]string -} - -// NewNameProvider creates a new name provider -func NewNameProvider() *NameProvider { - return &NameProvider{ - lock: &sync.Mutex{}, - index: make(map[reflect.Type]nameIndex), - } -} - -func buildnameIndex(tpe reflect.Type, idx, reverseIdx map[string]string) { - for i := 0; i < tpe.NumField(); i++ { - targetDes := tpe.Field(i) - - if targetDes.PkgPath != "" { // unexported - continue - } - - if targetDes.Anonymous { // walk embedded structures tree down first - buildnameIndex(targetDes.Type, idx, reverseIdx) - continue - } - - if tag := targetDes.Tag.Get("json"); tag != "" { - - parts := strings.Split(tag, ",") - if len(parts) == 0 { - continue - } - - nm := parts[0] - if nm == "-" { - continue - } - if nm == "" { // empty string means we want to use the Go name - nm = targetDes.Name - } - - idx[nm] = targetDes.Name - reverseIdx[targetDes.Name] = nm - } - } -} - -func newNameIndex(tpe reflect.Type) nameIndex { - var idx = make(map[string]string, tpe.NumField()) - var reverseIdx = make(map[string]string, tpe.NumField()) - - buildnameIndex(tpe, idx, reverseIdx) - return nameIndex{jsonNames: idx, goNames: reverseIdx} -} - -// GetJSONNames gets all the json property names for a type -func (n *NameProvider) GetJSONNames(subject interface{}) []string { - n.lock.Lock() - defer n.lock.Unlock() - tpe := reflect.Indirect(reflect.ValueOf(subject)).Type() - names, ok := n.index[tpe] - if !ok { - names = n.makeNameIndex(tpe) - } - - var res []string - for k := range names.jsonNames { - res = append(res, k) - } - return res -} - -// GetJSONName gets the json name for a go property name -func (n *NameProvider) GetJSONName(subject interface{}, name string) (string, bool) { - tpe := reflect.Indirect(reflect.ValueOf(subject)).Type() - return n.GetJSONNameForType(tpe, name) -} - -// GetJSONNameForType gets the json name for a go property name on a given type -func (n *NameProvider) GetJSONNameForType(tpe reflect.Type, name string) (string, bool) { - n.lock.Lock() - defer n.lock.Unlock() - names, ok := n.index[tpe] - if !ok { - names = n.makeNameIndex(tpe) - } - nme, ok := names.goNames[name] - return nme, ok -} - -func (n *NameProvider) makeNameIndex(tpe reflect.Type) nameIndex { - names := newNameIndex(tpe) - n.index[tpe] = names - return names -} - -// GetGoName gets the go name for a json property name -func (n *NameProvider) GetGoName(subject interface{}, name string) (string, bool) { - tpe := reflect.Indirect(reflect.ValueOf(subject)).Type() - return n.GetGoNameForType(tpe, name) -} - -// GetGoNameForType gets the go name for a given type for a json property name -func (n *NameProvider) GetGoNameForType(tpe reflect.Type, name string) (string, bool) { - n.lock.Lock() - defer n.lock.Unlock() - names, ok := n.index[tpe] - if !ok { - names = n.makeNameIndex(tpe) - } - nme, ok := names.jsonNames[name] - return nme, ok -} diff --git a/vendor/github.com/go-openapi/swag/loading.go b/vendor/github.com/go-openapi/swag/loading.go deleted file mode 100644 index 62ed1e80..00000000 --- a/vendor/github.com/go-openapi/swag/loading.go +++ /dev/null @@ -1,74 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package swag - -import ( - "fmt" - "io/ioutil" - "log" - "net/http" - "path/filepath" - "strings" - "time" -) - -// LoadHTTPTimeout the default timeout for load requests -var LoadHTTPTimeout = 30 * time.Second - -// LoadFromFileOrHTTP loads the bytes from a file or a remote http server based on the path passed in -func LoadFromFileOrHTTP(path string) ([]byte, error) { - return LoadStrategy(path, ioutil.ReadFile, loadHTTPBytes(LoadHTTPTimeout))(path) -} - -// LoadFromFileOrHTTPWithTimeout loads the bytes from a file or a remote http server based on the path passed in -// timeout arg allows for per request overriding of the request timeout -func LoadFromFileOrHTTPWithTimeout(path string, timeout time.Duration) ([]byte, error) { - return LoadStrategy(path, ioutil.ReadFile, loadHTTPBytes(timeout))(path) -} - -// LoadStrategy returns a loader function for a given path or uri -func LoadStrategy(path string, local, remote func(string) ([]byte, error)) func(string) ([]byte, error) { - if strings.HasPrefix(path, "http") { - return remote - } - return func(pth string) ([]byte, error) { return local(filepath.FromSlash(pth)) } -} - -func loadHTTPBytes(timeout time.Duration) func(path string) ([]byte, error) { - return func(path string) ([]byte, error) { - client := &http.Client{Timeout: timeout} - req, err := http.NewRequest("GET", path, nil) - if err != nil { - return nil, err - } - resp, err := client.Do(req) - defer func() { - if resp != nil { - if e := resp.Body.Close(); e != nil { - log.Println(e) - } - } - }() - if err != nil { - return nil, err - } - - if resp.StatusCode != http.StatusOK { - return nil, fmt.Errorf("could not access document at %q [%s] ", path, resp.Status) - } - - return ioutil.ReadAll(resp.Body) - } -} diff --git a/vendor/github.com/go-openapi/swag/net.go b/vendor/github.com/go-openapi/swag/net.go deleted file mode 100644 index 8323fa37..00000000 --- a/vendor/github.com/go-openapi/swag/net.go +++ /dev/null @@ -1,24 +0,0 @@ -package swag - -import ( - "net" - "strconv" -) - -// SplitHostPort splits a network address into a host and a port. -// The port is -1 when there is no port to be found -func SplitHostPort(addr string) (host string, port int, err error) { - h, p, err := net.SplitHostPort(addr) - if err != nil { - return "", -1, err - } - if p == "" { - return "", -1, &net.AddrError{Err: "missing port in address", Addr: addr} - } - - pi, err := strconv.Atoi(p) - if err != nil { - return "", -1, err - } - return h, pi, nil -} diff --git a/vendor/github.com/go-openapi/swag/path.go b/vendor/github.com/go-openapi/swag/path.go deleted file mode 100644 index 941bd017..00000000 --- a/vendor/github.com/go-openapi/swag/path.go +++ /dev/null @@ -1,59 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package swag - -import ( - "os" - "path/filepath" - "runtime" - "strings" -) - -const ( - // GOPATHKey represents the env key for gopath - GOPATHKey = "GOPATH" -) - -// FindInSearchPath finds a package in a provided lists of paths -func FindInSearchPath(searchPath, pkg string) string { - pathsList := filepath.SplitList(searchPath) - for _, path := range pathsList { - if evaluatedPath, err := filepath.EvalSymlinks(filepath.Join(path, "src", pkg)); err == nil { - if _, err := os.Stat(evaluatedPath); err == nil { - return evaluatedPath - } - } - } - return "" -} - -// FindInGoSearchPath finds a package in the $GOPATH:$GOROOT -func FindInGoSearchPath(pkg string) string { - return FindInSearchPath(FullGoSearchPath(), pkg) -} - -// FullGoSearchPath gets the search paths for finding packages -func FullGoSearchPath() string { - allPaths := os.Getenv(GOPATHKey) - if allPaths == "" { - allPaths = filepath.Join(os.Getenv("HOME"), "go") - } - if allPaths != "" { - allPaths = strings.Join([]string{allPaths, runtime.GOROOT()}, ":") - } else { - allPaths = runtime.GOROOT() - } - return allPaths -} diff --git a/vendor/github.com/go-openapi/swag/util.go b/vendor/github.com/go-openapi/swag/util.go deleted file mode 100644 index 40751aab..00000000 --- a/vendor/github.com/go-openapi/swag/util.go +++ /dev/null @@ -1,336 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package swag - -import ( - "math" - "reflect" - "regexp" - "sort" - "strings" - "unicode" -) - -// Taken from https://github.com/golang/lint/blob/3390df4df2787994aea98de825b964ac7944b817/lint.go#L732-L769 -var commonInitialisms = map[string]bool{ - "ACL": true, - "API": true, - "ASCII": true, - "CPU": true, - "CSS": true, - "DNS": true, - "EOF": true, - "GUID": true, - "HTML": true, - "HTTPS": true, - "HTTP": true, - "ID": true, - "IP": true, - "JSON": true, - "LHS": true, - "QPS": true, - "RAM": true, - "RHS": true, - "RPC": true, - "SLA": true, - "SMTP": true, - "SQL": true, - "SSH": true, - "TCP": true, - "TLS": true, - "TTL": true, - "UDP": true, - "UI": true, - "UID": true, - "UUID": true, - "URI": true, - "URL": true, - "UTF8": true, - "VM": true, - "XML": true, - "XMPP": true, - "XSRF": true, - "XSS": true, -} -var initialisms []string - -func init() { - for k := range commonInitialisms { - initialisms = append(initialisms, k) - } - sort.Sort(sort.Reverse(byLength(initialisms))) -} - -// JoinByFormat joins a string array by a known format: -// ssv: space separated value -// tsv: tab separated value -// pipes: pipe (|) separated value -// csv: comma separated value (default) -func JoinByFormat(data []string, format string) []string { - if len(data) == 0 { - return data - } - var sep string - switch format { - case "ssv": - sep = " " - case "tsv": - sep = "\t" - case "pipes": - sep = "|" - case "multi": - return data - default: - sep = "," - } - return []string{strings.Join(data, sep)} -} - -// SplitByFormat splits a string by a known format: -// ssv: space separated value -// tsv: tab separated value -// pipes: pipe (|) separated value -// csv: comma separated value (default) -func SplitByFormat(data, format string) []string { - if data == "" { - return nil - } - var sep string - switch format { - case "ssv": - sep = " " - case "tsv": - sep = "\t" - case "pipes": - sep = "|" - case "multi": - return nil - default: - sep = "," - } - var result []string - for _, s := range strings.Split(data, sep) { - if ts := strings.TrimSpace(s); ts != "" { - result = append(result, ts) - } - } - return result -} - -type byLength []string - -func (s byLength) Len() int { - return len(s) -} -func (s byLength) Swap(i, j int) { - s[i], s[j] = s[j], s[i] -} -func (s byLength) Less(i, j int) bool { - return len(s[i]) < len(s[j]) -} - -// Prepares strings by splitting by caps, spaces, dashes, and underscore -func split(str string) (words []string) { - repl := strings.NewReplacer( - "@", "At ", - "&", "And ", - "|", "Pipe ", - "$", "Dollar ", - "!", "Bang ", - "-", " ", - "_", " ", - ) - - rex1 := regexp.MustCompile(`(\p{Lu})`) - rex2 := regexp.MustCompile(`(\pL|\pM|\pN|\p{Pc})+`) - - str = trim(str) - - // Convert dash and underscore to spaces - str = repl.Replace(str) - - // Split when uppercase is found (needed for Snake) - str = rex1.ReplaceAllString(str, " $1") - // check if consecutive single char things make up an initialism - - for _, k := range initialisms { - str = strings.Replace(str, rex1.ReplaceAllString(k, " $1"), " "+k, -1) - } - // Get the final list of words - words = rex2.FindAllString(str, -1) - - return -} - -// Removes leading whitespaces -func trim(str string) string { - return strings.Trim(str, " ") -} - -// Shortcut to strings.ToUpper() -func upper(str string) string { - return strings.ToUpper(trim(str)) -} - -// Shortcut to strings.ToLower() -func lower(str string) string { - return strings.ToLower(trim(str)) -} - -// ToFileName lowercases and underscores a go type name -func ToFileName(name string) string { - var out []string - for _, w := range split(name) { - out = append(out, lower(w)) - } - return strings.Join(out, "_") -} - -// ToCommandName lowercases and underscores a go type name -func ToCommandName(name string) string { - var out []string - for _, w := range split(name) { - out = append(out, lower(w)) - } - return strings.Join(out, "-") -} - -// ToHumanNameLower represents a code name as a human series of words -func ToHumanNameLower(name string) string { - var out []string - for _, w := range split(name) { - if !commonInitialisms[upper(w)] { - out = append(out, lower(w)) - } else { - out = append(out, w) - } - } - return strings.Join(out, " ") -} - -// ToHumanNameTitle represents a code name as a human series of words with the first letters titleized -func ToHumanNameTitle(name string) string { - var out []string - for _, w := range split(name) { - uw := upper(w) - if !commonInitialisms[uw] { - out = append(out, upper(w[:1])+lower(w[1:])) - } else { - out = append(out, w) - } - } - return strings.Join(out, " ") -} - -// ToJSONName camelcases a name which can be underscored or pascal cased -func ToJSONName(name string) string { - var out []string - for i, w := range split(name) { - if i == 0 { - out = append(out, lower(w)) - continue - } - out = append(out, upper(w[:1])+lower(w[1:])) - } - return strings.Join(out, "") -} - -// ToVarName camelcases a name which can be underscored or pascal cased -func ToVarName(name string) string { - res := ToGoName(name) - if _, ok := commonInitialisms[res]; ok { - return lower(res) - } - if len(res) <= 1 { - return lower(res) - } - return lower(res[:1]) + res[1:] -} - -// ToGoName translates a swagger name which can be underscored or camel cased to a name that golint likes -func ToGoName(name string) string { - var out []string - for _, w := range split(name) { - uw := upper(w) - mod := int(math.Min(float64(len(uw)), 2)) - if !commonInitialisms[uw] && !commonInitialisms[uw[:len(uw)-mod]] { - uw = upper(w[:1]) + lower(w[1:]) - } - out = append(out, uw) - } - - result := strings.Join(out, "") - if len(result) > 0 { - ud := upper(result[:1]) - ru := []rune(ud) - if unicode.IsUpper(ru[0]) { - result = ud + result[1:] - } else { - result = "X" + ud + result[1:] - } - } - return result -} - -// ContainsStringsCI searches a slice of strings for a case-insensitive match -func ContainsStringsCI(coll []string, item string) bool { - for _, a := range coll { - if strings.EqualFold(a, item) { - return true - } - } - return false -} - -type zeroable interface { - IsZero() bool -} - -// IsZero returns true when the value passed into the function is a zero value. -// This allows for safer checking of interface values. -func IsZero(data interface{}) bool { - // check for things that have an IsZero method instead - if vv, ok := data.(zeroable); ok { - return vv.IsZero() - } - // continue with slightly more complex reflection - v := reflect.ValueOf(data) - switch v.Kind() { - case reflect.String: - return v.Len() == 0 - case reflect.Bool: - return !v.Bool() - case reflect.Int, reflect.Int8, reflect.Int16, reflect.Int32, reflect.Int64: - return v.Int() == 0 - case reflect.Uint, reflect.Uint8, reflect.Uint16, reflect.Uint32, reflect.Uint64, reflect.Uintptr: - return v.Uint() == 0 - case reflect.Float32, reflect.Float64: - return v.Float() == 0 - case reflect.Interface, reflect.Map, reflect.Ptr, reflect.Slice: - return v.IsNil() - case reflect.Struct, reflect.Array: - return reflect.DeepEqual(data, reflect.Zero(v.Type()).Interface()) - case reflect.Invalid: - return true - } - return false -} - -// CommandLineOptionsGroup represents a group of user-defined command line options -type CommandLineOptionsGroup struct { - ShortDescription string - LongDescription string - Options interface{} -} diff --git a/vendor/github.com/go-openapi/swag/yaml.go b/vendor/github.com/go-openapi/swag/yaml.go deleted file mode 100644 index 26502f21..00000000 --- a/vendor/github.com/go-openapi/swag/yaml.go +++ /dev/null @@ -1,215 +0,0 @@ -// Copyright 2015 go-swagger maintainers -// -// Licensed under the Apache License, Version 2.0 (the "License"); -// you may not use this file except in compliance with the License. -// You may obtain a copy of the License at -// -// http://www.apache.org/licenses/LICENSE-2.0 -// -// Unless required by applicable law or agreed to in writing, software -// distributed under the License is distributed on an "AS IS" BASIS, -// WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -// See the License for the specific language governing permissions and -// limitations under the License. - -package swag - -import ( - "encoding/json" - "fmt" - "path/filepath" - "strconv" - - "github.com/mailru/easyjson/jlexer" - "github.com/mailru/easyjson/jwriter" - - yaml "gopkg.in/yaml.v2" -) - -// YAMLMatcher matches yaml -func YAMLMatcher(path string) bool { - ext := filepath.Ext(path) - return ext == ".yaml" || ext == ".yml" -} - -// YAMLToJSON converts YAML unmarshaled data into json compatible data -func YAMLToJSON(data interface{}) (json.RawMessage, error) { - jm, err := transformData(data) - if err != nil { - return nil, err - } - b, err := WriteJSON(jm) - return json.RawMessage(b), err -} - -func BytesToYAMLDoc(data []byte) (interface{}, error) { - var canary map[interface{}]interface{} // validate this is an object and not a different type - if err := yaml.Unmarshal(data, &canary); err != nil { - return nil, err - } - - var document yaml.MapSlice // preserve order that is present in the document - if err := yaml.Unmarshal(data, &document); err != nil { - return nil, err - } - return document, nil -} - -type JSONMapSlice []JSONMapItem - -func (s JSONMapSlice) MarshalJSON() ([]byte, error) { - w := &jwriter.Writer{Flags: jwriter.NilMapAsEmpty | jwriter.NilSliceAsEmpty} - s.MarshalEasyJSON(w) - return w.BuildBytes() -} - -func (s JSONMapSlice) MarshalEasyJSON(w *jwriter.Writer) { - w.RawByte('{') - - ln := len(s) - last := ln - 1 - for i := 0; i < ln; i++ { - s[i].MarshalEasyJSON(w) - if i != last { // last item - w.RawByte(',') - } - } - - w.RawByte('}') -} - -func (s *JSONMapSlice) UnmarshalJSON(data []byte) error { - l := jlexer.Lexer{Data: data} - s.UnmarshalEasyJSON(&l) - return l.Error() -} -func (s *JSONMapSlice) UnmarshalEasyJSON(in *jlexer.Lexer) { - if in.IsNull() { - in.Skip() - return - } - - var result JSONMapSlice - in.Delim('{') - for !in.IsDelim('}') { - var mi JSONMapItem - mi.UnmarshalEasyJSON(in) - result = append(result, mi) - } - *s = result -} - -type JSONMapItem struct { - Key string - Value interface{} -} - -func (s JSONMapItem) MarshalJSON() ([]byte, error) { - w := &jwriter.Writer{Flags: jwriter.NilMapAsEmpty | jwriter.NilSliceAsEmpty} - s.MarshalEasyJSON(w) - return w.BuildBytes() -} - -func (s JSONMapItem) MarshalEasyJSON(w *jwriter.Writer) { - w.String(s.Key) - w.RawByte(':') - w.Raw(WriteJSON(s.Value)) -} - -func (s *JSONMapItem) UnmarshalEasyJSON(in *jlexer.Lexer) { - key := in.UnsafeString() - in.WantColon() - value := in.Interface() - in.WantComma() - s.Key = key - s.Value = value -} -func (s *JSONMapItem) UnmarshalJSON(data []byte) error { - l := jlexer.Lexer{Data: data} - s.UnmarshalEasyJSON(&l) - return l.Error() -} - -func transformData(input interface{}) (out interface{}, err error) { - switch in := input.(type) { - case yaml.MapSlice: - - o := make(JSONMapSlice, len(in)) - for i, mi := range in { - var nmi JSONMapItem - switch k := mi.Key.(type) { - case string: - nmi.Key = k - case int: - nmi.Key = strconv.Itoa(k) - default: - return nil, fmt.Errorf("types don't match expect map key string or int got: %T", mi.Key) - } - - v, err := transformData(mi.Value) - if err != nil { - return nil, err - } - nmi.Value = v - o[i] = nmi - } - return o, nil - case map[interface{}]interface{}: - o := make(JSONMapSlice, 0, len(in)) - for ke, va := range in { - var nmi JSONMapItem - switch k := ke.(type) { - case string: - nmi.Key = k - case int: - nmi.Key = strconv.Itoa(k) - default: - return nil, fmt.Errorf("types don't match expect map key string or int got: %T", ke) - } - - v, err := transformData(va) - if err != nil { - return nil, err - } - nmi.Value = v - o = append(o, nmi) - } - return o, nil - case []interface{}: - len1 := len(in) - o := make([]interface{}, len1) - for i := 0; i < len1; i++ { - o[i], err = transformData(in[i]) - if err != nil { - return nil, err - } - } - return o, nil - } - return input, nil -} - -// YAMLDoc loads a yaml document from either http or a file and converts it to json -func YAMLDoc(path string) (json.RawMessage, error) { - yamlDoc, err := YAMLData(path) - if err != nil { - return nil, err - } - - data, err := YAMLToJSON(yamlDoc) - if err != nil { - return nil, err - } - - return json.RawMessage(data), nil -} - -// YAMLData loads a yaml document from either http or a file -func YAMLData(path string) (interface{}, error) { - data, err := LoadFromFileOrHTTP(path) - if err != nil { - return nil, err - } - - return BytesToYAMLDoc(data) -} diff --git a/vendor/github.com/mailru/easyjson/LICENSE b/vendor/github.com/mailru/easyjson/LICENSE deleted file mode 100644 index fbff658f..00000000 --- a/vendor/github.com/mailru/easyjson/LICENSE +++ /dev/null @@ -1,7 +0,0 @@ -Copyright (c) 2016 Mail.Ru Group - -Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: - -The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. - -THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. diff --git a/vendor/github.com/mailru/easyjson/buffer/pool.go b/vendor/github.com/mailru/easyjson/buffer/pool.go deleted file mode 100644 index 07fb4bc1..00000000 --- a/vendor/github.com/mailru/easyjson/buffer/pool.go +++ /dev/null @@ -1,270 +0,0 @@ -// Package buffer implements a buffer for serialization, consisting of a chain of []byte-s to -// reduce copying and to allow reuse of individual chunks. -package buffer - -import ( - "io" - "sync" -) - -// PoolConfig contains configuration for the allocation and reuse strategy. -type PoolConfig struct { - StartSize int // Minimum chunk size that is allocated. - PooledSize int // Minimum chunk size that is reused, reusing chunks too small will result in overhead. - MaxSize int // Maximum chunk size that will be allocated. -} - -var config = PoolConfig{ - StartSize: 128, - PooledSize: 512, - MaxSize: 32768, -} - -// Reuse pool: chunk size -> pool. -var buffers = map[int]*sync.Pool{} - -func initBuffers() { - for l := config.PooledSize; l <= config.MaxSize; l *= 2 { - buffers[l] = new(sync.Pool) - } -} - -func init() { - initBuffers() -} - -// Init sets up a non-default pooling and allocation strategy. Should be run before serialization is done. -func Init(cfg PoolConfig) { - config = cfg - initBuffers() -} - -// putBuf puts a chunk to reuse pool if it can be reused. -func putBuf(buf []byte) { - size := cap(buf) - if size < config.PooledSize { - return - } - if c := buffers[size]; c != nil { - c.Put(buf[:0]) - } -} - -// getBuf gets a chunk from reuse pool or creates a new one if reuse failed. -func getBuf(size int) []byte { - if size < config.PooledSize { - return make([]byte, 0, size) - } - - if c := buffers[size]; c != nil { - v := c.Get() - if v != nil { - return v.([]byte) - } - } - return make([]byte, 0, size) -} - -// Buffer is a buffer optimized for serialization without extra copying. -type Buffer struct { - - // Buf is the current chunk that can be used for serialization. - Buf []byte - - toPool []byte - bufs [][]byte -} - -// EnsureSpace makes sure that the current chunk contains at least s free bytes, -// possibly creating a new chunk. -func (b *Buffer) EnsureSpace(s int) { - if cap(b.Buf)-len(b.Buf) >= s { - return - } - l := len(b.Buf) - if l > 0 { - if cap(b.toPool) != cap(b.Buf) { - // Chunk was reallocated, toPool can be pooled. - putBuf(b.toPool) - } - if cap(b.bufs) == 0 { - b.bufs = make([][]byte, 0, 8) - } - b.bufs = append(b.bufs, b.Buf) - l = cap(b.toPool) * 2 - } else { - l = config.StartSize - } - - if l > config.MaxSize { - l = config.MaxSize - } - b.Buf = getBuf(l) - b.toPool = b.Buf -} - -// AppendByte appends a single byte to buffer. -func (b *Buffer) AppendByte(data byte) { - if cap(b.Buf) == len(b.Buf) { // EnsureSpace won't be inlined. - b.EnsureSpace(1) - } - b.Buf = append(b.Buf, data) -} - -// AppendBytes appends a byte slice to buffer. -func (b *Buffer) AppendBytes(data []byte) { - for len(data) > 0 { - if cap(b.Buf) == len(b.Buf) { // EnsureSpace won't be inlined. - b.EnsureSpace(1) - } - - sz := cap(b.Buf) - len(b.Buf) - if sz > len(data) { - sz = len(data) - } - - b.Buf = append(b.Buf, data[:sz]...) - data = data[sz:] - } -} - -// AppendBytes appends a string to buffer. -func (b *Buffer) AppendString(data string) { - for len(data) > 0 { - if cap(b.Buf) == len(b.Buf) { // EnsureSpace won't be inlined. - b.EnsureSpace(1) - } - - sz := cap(b.Buf) - len(b.Buf) - if sz > len(data) { - sz = len(data) - } - - b.Buf = append(b.Buf, data[:sz]...) - data = data[sz:] - } -} - -// Size computes the size of a buffer by adding sizes of every chunk. -func (b *Buffer) Size() int { - size := len(b.Buf) - for _, buf := range b.bufs { - size += len(buf) - } - return size -} - -// DumpTo outputs the contents of a buffer to a writer and resets the buffer. -func (b *Buffer) DumpTo(w io.Writer) (written int, err error) { - var n int - for _, buf := range b.bufs { - if err == nil { - n, err = w.Write(buf) - written += n - } - putBuf(buf) - } - - if err == nil { - n, err = w.Write(b.Buf) - written += n - } - putBuf(b.toPool) - - b.bufs = nil - b.Buf = nil - b.toPool = nil - - return -} - -// BuildBytes creates a single byte slice with all the contents of the buffer. Data is -// copied if it does not fit in a single chunk. You can optionally provide one byte -// slice as argument that it will try to reuse. -func (b *Buffer) BuildBytes(reuse ...[]byte) []byte { - if len(b.bufs) == 0 { - ret := b.Buf - b.toPool = nil - b.Buf = nil - return ret - } - - var ret []byte - size := b.Size() - - // If we got a buffer as argument and it is big enought, reuse it. - if len(reuse) == 1 && cap(reuse[0]) >= size { - ret = reuse[0][:0] - } else { - ret = make([]byte, 0, size) - } - for _, buf := range b.bufs { - ret = append(ret, buf...) - putBuf(buf) - } - - ret = append(ret, b.Buf...) - putBuf(b.toPool) - - b.bufs = nil - b.toPool = nil - b.Buf = nil - - return ret -} - -type readCloser struct { - offset int - bufs [][]byte -} - -func (r *readCloser) Read(p []byte) (n int, err error) { - for _, buf := range r.bufs { - // Copy as much as we can. - x := copy(p[n:], buf[r.offset:]) - n += x // Increment how much we filled. - - // Did we empty the whole buffer? - if r.offset+x == len(buf) { - // On to the next buffer. - r.offset = 0 - r.bufs = r.bufs[1:] - - // We can release this buffer. - putBuf(buf) - } else { - r.offset += x - } - - if n == len(p) { - break - } - } - // No buffers left or nothing read? - if len(r.bufs) == 0 { - err = io.EOF - } - return -} - -func (r *readCloser) Close() error { - // Release all remaining buffers. - for _, buf := range r.bufs { - putBuf(buf) - } - // In case Close gets called multiple times. - r.bufs = nil - - return nil -} - -// ReadCloser creates an io.ReadCloser with all the contents of the buffer. -func (b *Buffer) ReadCloser() io.ReadCloser { - ret := &readCloser{0, append(b.bufs, b.Buf)} - - b.bufs = nil - b.toPool = nil - b.Buf = nil - - return ret -} diff --git a/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go b/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go deleted file mode 100644 index ff7b27c5..00000000 --- a/vendor/github.com/mailru/easyjson/jlexer/bytestostr.go +++ /dev/null @@ -1,24 +0,0 @@ -// This file will only be included to the build if neither -// easyjson_nounsafe nor appengine build tag is set. See README notes -// for more details. - -//+build !easyjson_nounsafe -//+build !appengine - -package jlexer - -import ( - "reflect" - "unsafe" -) - -// bytesToStr creates a string pointing at the slice to avoid copying. -// -// Warning: the string returned by the function should be used with care, as the whole input data -// chunk may be either blocked from being freed by GC because of a single string or the buffer.Data -// may be garbage-collected even when the string exists. -func bytesToStr(data []byte) string { - h := (*reflect.SliceHeader)(unsafe.Pointer(&data)) - shdr := reflect.StringHeader{Data: h.Data, Len: h.Len} - return *(*string)(unsafe.Pointer(&shdr)) -} diff --git a/vendor/github.com/mailru/easyjson/jlexer/bytestostr_nounsafe.go b/vendor/github.com/mailru/easyjson/jlexer/bytestostr_nounsafe.go deleted file mode 100644 index 864d1be6..00000000 --- a/vendor/github.com/mailru/easyjson/jlexer/bytestostr_nounsafe.go +++ /dev/null @@ -1,13 +0,0 @@ -// This file is included to the build if any of the buildtags below -// are defined. Refer to README notes for more details. - -//+build easyjson_nounsafe appengine - -package jlexer - -// bytesToStr creates a string normally from []byte -// -// Note that this method is roughly 1.5x slower than using the 'unsafe' method. -func bytesToStr(data []byte) string { - return string(data) -} diff --git a/vendor/github.com/mailru/easyjson/jlexer/error.go b/vendor/github.com/mailru/easyjson/jlexer/error.go deleted file mode 100644 index e90ec40d..00000000 --- a/vendor/github.com/mailru/easyjson/jlexer/error.go +++ /dev/null @@ -1,15 +0,0 @@ -package jlexer - -import "fmt" - -// LexerError implements the error interface and represents all possible errors that can be -// generated during parsing the JSON data. -type LexerError struct { - Reason string - Offset int - Data string -} - -func (l *LexerError) Error() string { - return fmt.Sprintf("parse error: %s near offset %d of '%s'", l.Reason, l.Offset, l.Data) -} diff --git a/vendor/github.com/mailru/easyjson/jlexer/lexer.go b/vendor/github.com/mailru/easyjson/jlexer/lexer.go deleted file mode 100644 index e81f1031..00000000 --- a/vendor/github.com/mailru/easyjson/jlexer/lexer.go +++ /dev/null @@ -1,1114 +0,0 @@ -// Package jlexer contains a JSON lexer implementation. -// -// It is expected that it is mostly used with generated parser code, so the interface is tuned -// for a parser that knows what kind of data is expected. -package jlexer - -import ( - "encoding/base64" - "errors" - "fmt" - "io" - "strconv" - "unicode" - "unicode/utf16" - "unicode/utf8" -) - -// tokenKind determines type of a token. -type tokenKind byte - -const ( - tokenUndef tokenKind = iota // No token. - tokenDelim // Delimiter: one of '{', '}', '[' or ']'. - tokenString // A string literal, e.g. "abc\u1234" - tokenNumber // Number literal, e.g. 1.5e5 - tokenBool // Boolean literal: true or false. - tokenNull // null keyword. -) - -// token describes a single token: type, position in the input and value. -type token struct { - kind tokenKind // Type of a token. - - boolValue bool // Value if a boolean literal token. - byteValue []byte // Raw value of a token. - delimValue byte -} - -// Lexer is a JSON lexer: it iterates over JSON tokens in a byte slice. -type Lexer struct { - Data []byte // Input data given to the lexer. - - start int // Start of the current token. - pos int // Current unscanned position in the input stream. - token token // Last scanned token, if token.kind != tokenUndef. - - firstElement bool // Whether current element is the first in array or an object. - wantSep byte // A comma or a colon character, which need to occur before a token. - - UseMultipleErrors bool // If we want to use multiple errors. - fatalError error // Fatal error occurred during lexing. It is usually a syntax error. - multipleErrors []*LexerError // Semantic errors occurred during lexing. Marshalling will be continued after finding this errors. -} - -// FetchToken scans the input for the next token. -func (r *Lexer) FetchToken() { - r.token.kind = tokenUndef - r.start = r.pos - - // Check if r.Data has r.pos element - // If it doesn't, it mean corrupted input data - if len(r.Data) < r.pos { - r.errParse("Unexpected end of data") - return - } - // Determine the type of a token by skipping whitespace and reading the - // first character. - for _, c := range r.Data[r.pos:] { - switch c { - case ':', ',': - if r.wantSep == c { - r.pos++ - r.start++ - r.wantSep = 0 - } else { - r.errSyntax() - } - - case ' ', '\t', '\r', '\n': - r.pos++ - r.start++ - - case '"': - if r.wantSep != 0 { - r.errSyntax() - } - - r.token.kind = tokenString - r.fetchString() - return - - case '{', '[': - if r.wantSep != 0 { - r.errSyntax() - } - r.firstElement = true - r.token.kind = tokenDelim - r.token.delimValue = r.Data[r.pos] - r.pos++ - return - - case '}', ']': - if !r.firstElement && (r.wantSep != ',') { - r.errSyntax() - } - r.wantSep = 0 - r.token.kind = tokenDelim - r.token.delimValue = r.Data[r.pos] - r.pos++ - return - - case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9', '-': - if r.wantSep != 0 { - r.errSyntax() - } - r.token.kind = tokenNumber - r.fetchNumber() - return - - case 'n': - if r.wantSep != 0 { - r.errSyntax() - } - - r.token.kind = tokenNull - r.fetchNull() - return - - case 't': - if r.wantSep != 0 { - r.errSyntax() - } - - r.token.kind = tokenBool - r.token.boolValue = true - r.fetchTrue() - return - - case 'f': - if r.wantSep != 0 { - r.errSyntax() - } - - r.token.kind = tokenBool - r.token.boolValue = false - r.fetchFalse() - return - - default: - r.errSyntax() - return - } - } - r.fatalError = io.EOF - return -} - -// isTokenEnd returns true if the char can follow a non-delimiter token -func isTokenEnd(c byte) bool { - return c == ' ' || c == '\t' || c == '\r' || c == '\n' || c == '[' || c == ']' || c == '{' || c == '}' || c == ',' || c == ':' -} - -// fetchNull fetches and checks remaining bytes of null keyword. -func (r *Lexer) fetchNull() { - r.pos += 4 - if r.pos > len(r.Data) || - r.Data[r.pos-3] != 'u' || - r.Data[r.pos-2] != 'l' || - r.Data[r.pos-1] != 'l' || - (r.pos != len(r.Data) && !isTokenEnd(r.Data[r.pos])) { - - r.pos -= 4 - r.errSyntax() - } -} - -// fetchTrue fetches and checks remaining bytes of true keyword. -func (r *Lexer) fetchTrue() { - r.pos += 4 - if r.pos > len(r.Data) || - r.Data[r.pos-3] != 'r' || - r.Data[r.pos-2] != 'u' || - r.Data[r.pos-1] != 'e' || - (r.pos != len(r.Data) && !isTokenEnd(r.Data[r.pos])) { - - r.pos -= 4 - r.errSyntax() - } -} - -// fetchFalse fetches and checks remaining bytes of false keyword. -func (r *Lexer) fetchFalse() { - r.pos += 5 - if r.pos > len(r.Data) || - r.Data[r.pos-4] != 'a' || - r.Data[r.pos-3] != 'l' || - r.Data[r.pos-2] != 's' || - r.Data[r.pos-1] != 'e' || - (r.pos != len(r.Data) && !isTokenEnd(r.Data[r.pos])) { - - r.pos -= 5 - r.errSyntax() - } -} - -// fetchNumber scans a number literal token. -func (r *Lexer) fetchNumber() { - hasE := false - afterE := false - hasDot := false - - r.pos++ - for i, c := range r.Data[r.pos:] { - switch { - case c >= '0' && c <= '9': - afterE = false - case c == '.' && !hasDot: - hasDot = true - case (c == 'e' || c == 'E') && !hasE: - hasE = true - hasDot = true - afterE = true - case (c == '+' || c == '-') && afterE: - afterE = false - default: - r.pos += i - if !isTokenEnd(c) { - r.errSyntax() - } else { - r.token.byteValue = r.Data[r.start:r.pos] - } - return - } - } - - r.pos = len(r.Data) - r.token.byteValue = r.Data[r.start:] -} - -// findStringLen tries to scan into the string literal for ending quote char to determine required size. -// The size will be exact if no escapes are present and may be inexact if there are escaped chars. -func findStringLen(data []byte) (hasEscapes bool, length int) { - delta := 0 - - for i := 0; i < len(data); i++ { - switch data[i] { - case '\\': - i++ - delta++ - if i < len(data) && data[i] == 'u' { - delta++ - } - case '"': - return (delta > 0), (i - delta) - } - } - - return false, len(data) -} - -// getu4 decodes \uXXXX from the beginning of s, returning the hex value, -// or it returns -1. -func getu4(s []byte) rune { - if len(s) < 6 || s[0] != '\\' || s[1] != 'u' { - return -1 - } - var val rune - for i := 2; i < len(s) && i < 6; i++ { - var v byte - c := s[i] - switch c { - case '0', '1', '2', '3', '4', '5', '6', '7', '8', '9': - v = c - '0' - case 'a', 'b', 'c', 'd', 'e', 'f': - v = c - 'a' + 10 - case 'A', 'B', 'C', 'D', 'E', 'F': - v = c - 'A' + 10 - default: - return -1 - } - - val <<= 4 - val |= rune(v) - } - return val -} - -// processEscape processes a single escape sequence and returns number of bytes processed. -func (r *Lexer) processEscape(data []byte) (int, error) { - if len(data) < 2 { - return 0, fmt.Errorf("syntax error at %v", string(data)) - } - - c := data[1] - switch c { - case '"', '/', '\\': - r.token.byteValue = append(r.token.byteValue, c) - return 2, nil - case 'b': - r.token.byteValue = append(r.token.byteValue, '\b') - return 2, nil - case 'f': - r.token.byteValue = append(r.token.byteValue, '\f') - return 2, nil - case 'n': - r.token.byteValue = append(r.token.byteValue, '\n') - return 2, nil - case 'r': - r.token.byteValue = append(r.token.byteValue, '\r') - return 2, nil - case 't': - r.token.byteValue = append(r.token.byteValue, '\t') - return 2, nil - case 'u': - rr := getu4(data) - if rr < 0 { - return 0, errors.New("syntax error") - } - - read := 6 - if utf16.IsSurrogate(rr) { - rr1 := getu4(data[read:]) - if dec := utf16.DecodeRune(rr, rr1); dec != unicode.ReplacementChar { - read += 6 - rr = dec - } else { - rr = unicode.ReplacementChar - } - } - var d [4]byte - s := utf8.EncodeRune(d[:], rr) - r.token.byteValue = append(r.token.byteValue, d[:s]...) - return read, nil - } - - return 0, errors.New("syntax error") -} - -// fetchString scans a string literal token. -func (r *Lexer) fetchString() { - r.pos++ - data := r.Data[r.pos:] - - hasEscapes, length := findStringLen(data) - if !hasEscapes { - r.token.byteValue = data[:length] - r.pos += length + 1 - return - } - - r.token.byteValue = make([]byte, 0, length) - p := 0 - for i := 0; i < len(data); { - switch data[i] { - case '"': - r.pos += i + 1 - r.token.byteValue = append(r.token.byteValue, data[p:i]...) - i++ - return - - case '\\': - r.token.byteValue = append(r.token.byteValue, data[p:i]...) - off, err := r.processEscape(data[i:]) - if err != nil { - r.errParse(err.Error()) - return - } - i += off - p = i - - default: - i++ - } - } - r.errParse("unterminated string literal") -} - -// scanToken scans the next token if no token is currently available in the lexer. -func (r *Lexer) scanToken() { - if r.token.kind != tokenUndef || r.fatalError != nil { - return - } - - r.FetchToken() -} - -// consume resets the current token to allow scanning the next one. -func (r *Lexer) consume() { - r.token.kind = tokenUndef - r.token.delimValue = 0 -} - -// Ok returns true if no error (including io.EOF) was encountered during scanning. -func (r *Lexer) Ok() bool { - return r.fatalError == nil -} - -const maxErrorContextLen = 13 - -func (r *Lexer) errParse(what string) { - if r.fatalError == nil { - var str string - if len(r.Data)-r.pos <= maxErrorContextLen { - str = string(r.Data) - } else { - str = string(r.Data[r.pos:r.pos+maxErrorContextLen-3]) + "..." - } - r.fatalError = &LexerError{ - Reason: what, - Offset: r.pos, - Data: str, - } - } -} - -func (r *Lexer) errSyntax() { - r.errParse("syntax error") -} - -func (r *Lexer) errInvalidToken(expected string) { - if r.fatalError != nil { - return - } - if r.UseMultipleErrors { - r.pos = r.start - r.consume() - r.SkipRecursive() - switch expected { - case "[": - r.token.delimValue = ']' - r.token.kind = tokenDelim - case "{": - r.token.delimValue = '}' - r.token.kind = tokenDelim - } - r.addNonfatalError(&LexerError{ - Reason: fmt.Sprintf("expected %s", expected), - Offset: r.start, - Data: string(r.Data[r.start:r.pos]), - }) - return - } - - var str string - if len(r.token.byteValue) <= maxErrorContextLen { - str = string(r.token.byteValue) - } else { - str = string(r.token.byteValue[:maxErrorContextLen-3]) + "..." - } - r.fatalError = &LexerError{ - Reason: fmt.Sprintf("expected %s", expected), - Offset: r.pos, - Data: str, - } -} - -func (r *Lexer) GetPos() int { - return r.pos -} - -// Delim consumes a token and verifies that it is the given delimiter. -func (r *Lexer) Delim(c byte) { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - - if !r.Ok() || r.token.delimValue != c { - r.consume() // errInvalidToken can change token if UseMultipleErrors is enabled. - r.errInvalidToken(string([]byte{c})) - } else { - r.consume() - } -} - -// IsDelim returns true if there was no scanning error and next token is the given delimiter. -func (r *Lexer) IsDelim(c byte) bool { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - return !r.Ok() || r.token.delimValue == c -} - -// Null verifies that the next token is null and consumes it. -func (r *Lexer) Null() { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - if !r.Ok() || r.token.kind != tokenNull { - r.errInvalidToken("null") - } - r.consume() -} - -// IsNull returns true if the next token is a null keyword. -func (r *Lexer) IsNull() bool { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - return r.Ok() && r.token.kind == tokenNull -} - -// Skip skips a single token. -func (r *Lexer) Skip() { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - r.consume() -} - -// SkipRecursive skips next array or object completely, or just skips a single token if not -// an array/object. -// -// Note: no syntax validation is performed on the skipped data. -func (r *Lexer) SkipRecursive() { - r.scanToken() - var start, end byte - - if r.token.delimValue == '{' { - start, end = '{', '}' - } else if r.token.delimValue == '[' { - start, end = '[', ']' - } else { - r.consume() - return - } - - r.consume() - - level := 1 - inQuotes := false - wasEscape := false - - for i, c := range r.Data[r.pos:] { - switch { - case c == start && !inQuotes: - level++ - case c == end && !inQuotes: - level-- - if level == 0 { - r.pos += i + 1 - return - } - case c == '\\' && inQuotes: - wasEscape = !wasEscape - continue - case c == '"' && inQuotes: - inQuotes = wasEscape - case c == '"': - inQuotes = true - } - wasEscape = false - } - r.pos = len(r.Data) - r.fatalError = &LexerError{ - Reason: "EOF reached while skipping array/object or token", - Offset: r.pos, - Data: string(r.Data[r.pos:]), - } -} - -// Raw fetches the next item recursively as a data slice -func (r *Lexer) Raw() []byte { - r.SkipRecursive() - if !r.Ok() { - return nil - } - return r.Data[r.start:r.pos] -} - -// IsStart returns whether the lexer is positioned at the start -// of an input string. -func (r *Lexer) IsStart() bool { - return r.pos == 0 -} - -// Consumed reads all remaining bytes from the input, publishing an error if -// there is anything but whitespace remaining. -func (r *Lexer) Consumed() { - if r.pos > len(r.Data) || !r.Ok() { - return - } - - for _, c := range r.Data[r.pos:] { - if c != ' ' && c != '\t' && c != '\r' && c != '\n' { - r.AddError(&LexerError{ - Reason: "invalid character '" + string(c) + "' after top-level value", - Offset: r.pos, - Data: string(r.Data[r.pos:]), - }) - return - } - - r.pos++ - r.start++ - } -} - -func (r *Lexer) unsafeString() (string, []byte) { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - if !r.Ok() || r.token.kind != tokenString { - r.errInvalidToken("string") - return "", nil - } - bytes := r.token.byteValue - ret := bytesToStr(r.token.byteValue) - r.consume() - return ret, bytes -} - -// UnsafeString returns the string value if the token is a string literal. -// -// Warning: returned string may point to the input buffer, so the string should not outlive -// the input buffer. Intended pattern of usage is as an argument to a switch statement. -func (r *Lexer) UnsafeString() string { - ret, _ := r.unsafeString() - return ret -} - -// UnsafeBytes returns the byte slice if the token is a string literal. -func (r *Lexer) UnsafeBytes() []byte { - _, ret := r.unsafeString() - return ret -} - -// String reads a string literal. -func (r *Lexer) String() string { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - if !r.Ok() || r.token.kind != tokenString { - r.errInvalidToken("string") - return "" - } - ret := string(r.token.byteValue) - r.consume() - return ret -} - -// Bytes reads a string literal and base64 decodes it into a byte slice. -func (r *Lexer) Bytes() []byte { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - if !r.Ok() || r.token.kind != tokenString { - r.errInvalidToken("string") - return nil - } - ret := make([]byte, base64.StdEncoding.DecodedLen(len(r.token.byteValue))) - len, err := base64.StdEncoding.Decode(ret, r.token.byteValue) - if err != nil { - r.fatalError = &LexerError{ - Reason: err.Error(), - } - return nil - } - - r.consume() - return ret[:len] -} - -// Bool reads a true or false boolean keyword. -func (r *Lexer) Bool() bool { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - if !r.Ok() || r.token.kind != tokenBool { - r.errInvalidToken("bool") - return false - } - ret := r.token.boolValue - r.consume() - return ret -} - -func (r *Lexer) number() string { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - if !r.Ok() || r.token.kind != tokenNumber { - r.errInvalidToken("number") - return "" - } - ret := bytesToStr(r.token.byteValue) - r.consume() - return ret -} - -func (r *Lexer) Uint8() uint8 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 8) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return uint8(n) -} - -func (r *Lexer) Uint16() uint16 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 16) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return uint16(n) -} - -func (r *Lexer) Uint32() uint32 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 32) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return uint32(n) -} - -func (r *Lexer) Uint64() uint64 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 64) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return n -} - -func (r *Lexer) Uint() uint { - return uint(r.Uint64()) -} - -func (r *Lexer) Int8() int8 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 8) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return int8(n) -} - -func (r *Lexer) Int16() int16 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 16) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return int16(n) -} - -func (r *Lexer) Int32() int32 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 32) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return int32(n) -} - -func (r *Lexer) Int64() int64 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 64) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return n -} - -func (r *Lexer) Int() int { - return int(r.Int64()) -} - -func (r *Lexer) Uint8Str() uint8 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 8) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return uint8(n) -} - -func (r *Lexer) Uint16Str() uint16 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 16) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return uint16(n) -} - -func (r *Lexer) Uint32Str() uint32 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 32) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return uint32(n) -} - -func (r *Lexer) Uint64Str() uint64 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseUint(s, 10, 64) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return n -} - -func (r *Lexer) UintStr() uint { - return uint(r.Uint64Str()) -} - -func (r *Lexer) Int8Str() int8 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 8) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return int8(n) -} - -func (r *Lexer) Int16Str() int16 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 16) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return int16(n) -} - -func (r *Lexer) Int32Str() int32 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 32) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return int32(n) -} - -func (r *Lexer) Int64Str() int64 { - s, b := r.unsafeString() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseInt(s, 10, 64) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: string(b), - }) - } - return n -} - -func (r *Lexer) IntStr() int { - return int(r.Int64Str()) -} - -func (r *Lexer) Float32() float32 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseFloat(s, 32) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return float32(n) -} - -func (r *Lexer) Float64() float64 { - s := r.number() - if !r.Ok() { - return 0 - } - - n, err := strconv.ParseFloat(s, 64) - if err != nil { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Reason: err.Error(), - Data: s, - }) - } - return n -} - -func (r *Lexer) Error() error { - return r.fatalError -} - -func (r *Lexer) AddError(e error) { - if r.fatalError == nil { - r.fatalError = e - } -} - -func (r *Lexer) AddNonFatalError(e error) { - r.addNonfatalError(&LexerError{ - Offset: r.start, - Data: string(r.Data[r.start:r.pos]), - Reason: e.Error(), - }) -} - -func (r *Lexer) addNonfatalError(err *LexerError) { - if r.UseMultipleErrors { - // We don't want to add errors with the same offset. - if len(r.multipleErrors) != 0 && r.multipleErrors[len(r.multipleErrors)-1].Offset == err.Offset { - return - } - r.multipleErrors = append(r.multipleErrors, err) - return - } - r.fatalError = err -} - -func (r *Lexer) GetNonFatalErrors() []*LexerError { - return r.multipleErrors -} - -// Interface fetches an interface{} analogous to the 'encoding/json' package. -func (r *Lexer) Interface() interface{} { - if r.token.kind == tokenUndef && r.Ok() { - r.FetchToken() - } - - if !r.Ok() { - return nil - } - switch r.token.kind { - case tokenString: - return r.String() - case tokenNumber: - return r.Float64() - case tokenBool: - return r.Bool() - case tokenNull: - r.Null() - return nil - } - - if r.token.delimValue == '{' { - r.consume() - - ret := map[string]interface{}{} - for !r.IsDelim('}') { - key := r.String() - r.WantColon() - ret[key] = r.Interface() - r.WantComma() - } - r.Delim('}') - - if r.Ok() { - return ret - } else { - return nil - } - } else if r.token.delimValue == '[' { - r.consume() - - var ret []interface{} - for !r.IsDelim(']') { - ret = append(ret, r.Interface()) - r.WantComma() - } - r.Delim(']') - - if r.Ok() { - return ret - } else { - return nil - } - } - r.errSyntax() - return nil -} - -// WantComma requires a comma to be present before fetching next token. -func (r *Lexer) WantComma() { - r.wantSep = ',' - r.firstElement = false -} - -// WantColon requires a colon to be present before fetching next token. -func (r *Lexer) WantColon() { - r.wantSep = ':' - r.firstElement = false -} diff --git a/vendor/github.com/mailru/easyjson/jwriter/writer.go b/vendor/github.com/mailru/easyjson/jwriter/writer.go deleted file mode 100644 index 7b55293a..00000000 --- a/vendor/github.com/mailru/easyjson/jwriter/writer.go +++ /dev/null @@ -1,328 +0,0 @@ -// Package jwriter contains a JSON writer. -package jwriter - -import ( - "encoding/base64" - "io" - "strconv" - "unicode/utf8" - - "github.com/mailru/easyjson/buffer" -) - -// Flags describe various encoding options. The behavior may be actually implemented in the encoder, but -// Flags field in Writer is used to set and pass them around. -type Flags int - -const ( - NilMapAsEmpty Flags = 1 << iota // Encode nil map as '{}' rather than 'null'. - NilSliceAsEmpty // Encode nil slice as '[]' rather than 'null'. -) - -// Writer is a JSON writer. -type Writer struct { - Flags Flags - - Error error - Buffer buffer.Buffer - NoEscapeHTML bool -} - -// Size returns the size of the data that was written out. -func (w *Writer) Size() int { - return w.Buffer.Size() -} - -// DumpTo outputs the data to given io.Writer, resetting the buffer. -func (w *Writer) DumpTo(out io.Writer) (written int, err error) { - return w.Buffer.DumpTo(out) -} - -// BuildBytes returns writer data as a single byte slice. You can optionally provide one byte slice -// as argument that it will try to reuse. -func (w *Writer) BuildBytes(reuse ...[]byte) ([]byte, error) { - if w.Error != nil { - return nil, w.Error - } - - return w.Buffer.BuildBytes(reuse...), nil -} - -// ReadCloser returns an io.ReadCloser that can be used to read the data. -// ReadCloser also resets the buffer. -func (w *Writer) ReadCloser() (io.ReadCloser, error) { - if w.Error != nil { - return nil, w.Error - } - - return w.Buffer.ReadCloser(), nil -} - -// RawByte appends raw binary data to the buffer. -func (w *Writer) RawByte(c byte) { - w.Buffer.AppendByte(c) -} - -// RawByte appends raw binary data to the buffer. -func (w *Writer) RawString(s string) { - w.Buffer.AppendString(s) -} - -// Raw appends raw binary data to the buffer or sets the error if it is given. Useful for -// calling with results of MarshalJSON-like functions. -func (w *Writer) Raw(data []byte, err error) { - switch { - case w.Error != nil: - return - case err != nil: - w.Error = err - case len(data) > 0: - w.Buffer.AppendBytes(data) - default: - w.RawString("null") - } -} - -// RawText encloses raw binary data in quotes and appends in to the buffer. -// Useful for calling with results of MarshalText-like functions. -func (w *Writer) RawText(data []byte, err error) { - switch { - case w.Error != nil: - return - case err != nil: - w.Error = err - case len(data) > 0: - w.String(string(data)) - default: - w.RawString("null") - } -} - -// Base64Bytes appends data to the buffer after base64 encoding it -func (w *Writer) Base64Bytes(data []byte) { - if data == nil { - w.Buffer.AppendString("null") - return - } - w.Buffer.AppendByte('"') - dst := make([]byte, base64.StdEncoding.EncodedLen(len(data))) - base64.StdEncoding.Encode(dst, data) - w.Buffer.AppendBytes(dst) - w.Buffer.AppendByte('"') -} - -func (w *Writer) Uint8(n uint8) { - w.Buffer.EnsureSpace(3) - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) -} - -func (w *Writer) Uint16(n uint16) { - w.Buffer.EnsureSpace(5) - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) -} - -func (w *Writer) Uint32(n uint32) { - w.Buffer.EnsureSpace(10) - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) -} - -func (w *Writer) Uint(n uint) { - w.Buffer.EnsureSpace(20) - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) -} - -func (w *Writer) Uint64(n uint64) { - w.Buffer.EnsureSpace(20) - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, n, 10) -} - -func (w *Writer) Int8(n int8) { - w.Buffer.EnsureSpace(4) - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) -} - -func (w *Writer) Int16(n int16) { - w.Buffer.EnsureSpace(6) - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) -} - -func (w *Writer) Int32(n int32) { - w.Buffer.EnsureSpace(11) - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) -} - -func (w *Writer) Int(n int) { - w.Buffer.EnsureSpace(21) - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) -} - -func (w *Writer) Int64(n int64) { - w.Buffer.EnsureSpace(21) - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, n, 10) -} - -func (w *Writer) Uint8Str(n uint8) { - w.Buffer.EnsureSpace(3) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Uint16Str(n uint16) { - w.Buffer.EnsureSpace(5) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Uint32Str(n uint32) { - w.Buffer.EnsureSpace(10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) UintStr(n uint) { - w.Buffer.EnsureSpace(20) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, uint64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Uint64Str(n uint64) { - w.Buffer.EnsureSpace(20) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendUint(w.Buffer.Buf, n, 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Int8Str(n int8) { - w.Buffer.EnsureSpace(4) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Int16Str(n int16) { - w.Buffer.EnsureSpace(6) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Int32Str(n int32) { - w.Buffer.EnsureSpace(11) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) IntStr(n int) { - w.Buffer.EnsureSpace(21) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, int64(n), 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Int64Str(n int64) { - w.Buffer.EnsureSpace(21) - w.Buffer.Buf = append(w.Buffer.Buf, '"') - w.Buffer.Buf = strconv.AppendInt(w.Buffer.Buf, n, 10) - w.Buffer.Buf = append(w.Buffer.Buf, '"') -} - -func (w *Writer) Float32(n float32) { - w.Buffer.EnsureSpace(20) - w.Buffer.Buf = strconv.AppendFloat(w.Buffer.Buf, float64(n), 'g', -1, 32) -} - -func (w *Writer) Float64(n float64) { - w.Buffer.EnsureSpace(20) - w.Buffer.Buf = strconv.AppendFloat(w.Buffer.Buf, n, 'g', -1, 64) -} - -func (w *Writer) Bool(v bool) { - w.Buffer.EnsureSpace(5) - if v { - w.Buffer.Buf = append(w.Buffer.Buf, "true"...) - } else { - w.Buffer.Buf = append(w.Buffer.Buf, "false"...) - } -} - -const chars = "0123456789abcdef" - -func isNotEscapedSingleChar(c byte, escapeHTML bool) bool { - // Note: might make sense to use a table if there are more chars to escape. With 4 chars - // it benchmarks the same. - if escapeHTML { - return c != '<' && c != '>' && c != '&' && c != '\\' && c != '"' && c >= 0x20 && c < utf8.RuneSelf - } else { - return c != '\\' && c != '"' && c >= 0x20 && c < utf8.RuneSelf - } -} - -func (w *Writer) String(s string) { - w.Buffer.AppendByte('"') - - // Portions of the string that contain no escapes are appended as - // byte slices. - - p := 0 // last non-escape symbol - - for i := 0; i < len(s); { - c := s[i] - - if isNotEscapedSingleChar(c, !w.NoEscapeHTML) { - // single-width character, no escaping is required - i++ - continue - } else if c < utf8.RuneSelf { - // single-with character, need to escape - w.Buffer.AppendString(s[p:i]) - switch c { - case '\t': - w.Buffer.AppendString(`\t`) - case '\r': - w.Buffer.AppendString(`\r`) - case '\n': - w.Buffer.AppendString(`\n`) - case '\\': - w.Buffer.AppendString(`\\`) - case '"': - w.Buffer.AppendString(`\"`) - default: - w.Buffer.AppendString(`\u00`) - w.Buffer.AppendByte(chars[c>>4]) - w.Buffer.AppendByte(chars[c&0xf]) - } - - i++ - p = i - continue - } - - // broken utf - runeValue, runeWidth := utf8.DecodeRuneInString(s[i:]) - if runeValue == utf8.RuneError && runeWidth == 1 { - w.Buffer.AppendString(s[p:i]) - w.Buffer.AppendString(`\ufffd`) - i++ - p = i - continue - } - - // jsonp stuff - tab separator and line separator - if runeValue == '\u2028' || runeValue == '\u2029' { - w.Buffer.AppendString(s[p:i]) - w.Buffer.AppendString(`\u202`) - w.Buffer.AppendByte(chars[runeValue&0xf]) - i += runeWidth - p = i - continue - } - i += runeWidth - } - w.Buffer.AppendString(s[p:]) - w.Buffer.AppendByte('"') -} diff --git a/vendor/golang.org/x/text/cases/cases.go b/vendor/golang.org/x/text/cases/cases.go deleted file mode 100644 index cf70630e..00000000 --- a/vendor/golang.org/x/text/cases/cases.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_trieval.go - -// Package cases provides general and language-specific case mappers. -package cases - -import ( - "golang.org/x/text/language" - "golang.org/x/text/transform" -) - -// References: -// - Unicode Reference Manual Chapter 3.13, 4.2, and 5.18. -// - http://www.unicode.org/reports/tr29/ -// - http://www.unicode.org/Public/6.3.0/ucd/CaseFolding.txt -// - http://www.unicode.org/Public/6.3.0/ucd/SpecialCasing.txt -// - http://www.unicode.org/Public/6.3.0/ucd/DerivedCoreProperties.txt -// - http://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakProperty.txt -// - http://www.unicode.org/Public/6.3.0/ucd/auxiliary/WordBreakTest.txt -// - http://userguide.icu-project.org/transforms/casemappings - -// TODO: -// - Case folding -// - Wide and Narrow? -// - Segmenter option for title casing. -// - ASCII fast paths -// - Encode Soft-Dotted property within trie somehow. - -// A Caser transforms given input to a certain case. It implements -// transform.Transformer. -// -// A Caser may be stateful and should therefore not be shared between -// goroutines. -type Caser struct { - t transform.SpanningTransformer -} - -// Bytes returns a new byte slice with the result of converting b to the case -// form implemented by c. -func (c Caser) Bytes(b []byte) []byte { - b, _, _ = transform.Bytes(c.t, b) - return b -} - -// String returns a string with the result of transforming s to the case form -// implemented by c. -func (c Caser) String(s string) string { - s, _, _ = transform.String(c.t, s) - return s -} - -// Reset resets the Caser to be reused for new input after a previous call to -// Transform. -func (c Caser) Reset() { c.t.Reset() } - -// Transform implements the transform.Transformer interface and transforms the -// given input to the case form implemented by c. -func (c Caser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return c.t.Transform(dst, src, atEOF) -} - -// Span implements the transform.SpanningTransformer interface. -func (c Caser) Span(src []byte, atEOF bool) (n int, err error) { - return c.t.Span(src, atEOF) -} - -// Upper returns a Caser for language-specific uppercasing. -func Upper(t language.Tag, opts ...Option) Caser { - return Caser{makeUpper(t, getOpts(opts...))} -} - -// Lower returns a Caser for language-specific lowercasing. -func Lower(t language.Tag, opts ...Option) Caser { - return Caser{makeLower(t, getOpts(opts...))} -} - -// Title returns a Caser for language-specific title casing. It uses an -// approximation of the default Unicode Word Break algorithm. -func Title(t language.Tag, opts ...Option) Caser { - return Caser{makeTitle(t, getOpts(opts...))} -} - -// Fold returns a Caser that implements Unicode case folding. The returned Caser -// is stateless and safe to use concurrently by multiple goroutines. -// -// Case folding does not normalize the input and may not preserve a normal form. -// Use the collate or search package for more convenient and linguistically -// sound comparisons. Use golang.org/x/text/secure/precis for string comparisons -// where security aspects are a concern. -func Fold(opts ...Option) Caser { - return Caser{makeFold(getOpts(opts...))} -} - -// An Option is used to modify the behavior of a Caser. -type Option func(o options) options - -// TODO: consider these options to take a boolean as well, like FinalSigma. -// The advantage of using this approach is that other providers of a lower-case -// algorithm could set different defaults by prefixing a user-provided slice -// of options with their own. This is handy, for instance, for the precis -// package which would override the default to not handle the Greek final sigma. - -var ( - // NoLower disables the lowercasing of non-leading letters for a title - // caser. - NoLower Option = noLower - - // Compact omits mappings in case folding for characters that would grow the - // input. (Unimplemented.) - Compact Option = compact -) - -// TODO: option to preserve a normal form, if applicable? - -type options struct { - noLower bool - simple bool - - // TODO: segmenter, max ignorable, alternative versions, etc. - - ignoreFinalSigma bool -} - -func getOpts(o ...Option) (res options) { - for _, f := range o { - res = f(res) - } - return -} - -func noLower(o options) options { - o.noLower = true - return o -} - -func compact(o options) options { - o.simple = true - return o -} - -// HandleFinalSigma specifies whether the special handling of Greek final sigma -// should be enabled. Unicode prescribes handling the Greek final sigma for all -// locales, but standards like IDNA and PRECIS override this default. -func HandleFinalSigma(enable bool) Option { - if enable { - return handleFinalSigma - } - return ignoreFinalSigma -} - -func ignoreFinalSigma(o options) options { - o.ignoreFinalSigma = true - return o -} - -func handleFinalSigma(o options) options { - o.ignoreFinalSigma = false - return o -} diff --git a/vendor/golang.org/x/text/cases/context.go b/vendor/golang.org/x/text/cases/context.go deleted file mode 100644 index e9aa9e19..00000000 --- a/vendor/golang.org/x/text/cases/context.go +++ /dev/null @@ -1,376 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -import "golang.org/x/text/transform" - -// A context is used for iterating over source bytes, fetching case info and -// writing to a destination buffer. -// -// Casing operations may need more than one rune of context to decide how a rune -// should be cased. Casing implementations should call checkpoint on context -// whenever it is known to be safe to return the runes processed so far. -// -// It is recommended for implementations to not allow for more than 30 case -// ignorables as lookahead (analogous to the limit in norm) and to use state if -// unbounded lookahead is needed for cased runes. -type context struct { - dst, src []byte - atEOF bool - - pDst int // pDst points past the last written rune in dst. - pSrc int // pSrc points to the start of the currently scanned rune. - - // checkpoints safe to return in Transform, where nDst <= pDst and nSrc <= pSrc. - nDst, nSrc int - err error - - sz int // size of current rune - info info // case information of currently scanned rune - - // State preserved across calls to Transform. - isMidWord bool // false if next cased letter needs to be title-cased. -} - -func (c *context) Reset() { - c.isMidWord = false -} - -// ret returns the return values for the Transform method. It checks whether -// there were insufficient bytes in src to complete and introduces an error -// accordingly, if necessary. -func (c *context) ret() (nDst, nSrc int, err error) { - if c.err != nil || c.nSrc == len(c.src) { - return c.nDst, c.nSrc, c.err - } - // This point is only reached by mappers if there was no short destination - // buffer. This means that the source buffer was exhausted and that c.sz was - // set to 0 by next. - if c.atEOF && c.pSrc == len(c.src) { - return c.pDst, c.pSrc, nil - } - return c.nDst, c.nSrc, transform.ErrShortSrc -} - -// retSpan returns the return values for the Span method. It checks whether -// there were insufficient bytes in src to complete and introduces an error -// accordingly, if necessary. -func (c *context) retSpan() (n int, err error) { - _, nSrc, err := c.ret() - return nSrc, err -} - -// checkpoint sets the return value buffer points for Transform to the current -// positions. -func (c *context) checkpoint() { - if c.err == nil { - c.nDst, c.nSrc = c.pDst, c.pSrc+c.sz - } -} - -// unreadRune causes the last rune read by next to be reread on the next -// invocation of next. Only one unreadRune may be called after a call to next. -func (c *context) unreadRune() { - c.sz = 0 -} - -func (c *context) next() bool { - c.pSrc += c.sz - if c.pSrc == len(c.src) || c.err != nil { - c.info, c.sz = 0, 0 - return false - } - v, sz := trie.lookup(c.src[c.pSrc:]) - c.info, c.sz = info(v), sz - if c.sz == 0 { - if c.atEOF { - // A zero size means we have an incomplete rune. If we are atEOF, - // this means it is an illegal rune, which we will consume one - // byte at a time. - c.sz = 1 - } else { - c.err = transform.ErrShortSrc - return false - } - } - return true -} - -// writeBytes adds bytes to dst. -func (c *context) writeBytes(b []byte) bool { - if len(c.dst)-c.pDst < len(b) { - c.err = transform.ErrShortDst - return false - } - // This loop is faster than using copy. - for _, ch := range b { - c.dst[c.pDst] = ch - c.pDst++ - } - return true -} - -// writeString writes the given string to dst. -func (c *context) writeString(s string) bool { - if len(c.dst)-c.pDst < len(s) { - c.err = transform.ErrShortDst - return false - } - // This loop is faster than using copy. - for i := 0; i < len(s); i++ { - c.dst[c.pDst] = s[i] - c.pDst++ - } - return true -} - -// copy writes the current rune to dst. -func (c *context) copy() bool { - return c.writeBytes(c.src[c.pSrc : c.pSrc+c.sz]) -} - -// copyXOR copies the current rune to dst and modifies it by applying the XOR -// pattern of the case info. It is the responsibility of the caller to ensure -// that this is a rune with a XOR pattern defined. -func (c *context) copyXOR() bool { - if !c.copy() { - return false - } - if c.info&xorIndexBit == 0 { - // Fast path for 6-bit XOR pattern, which covers most cases. - c.dst[c.pDst-1] ^= byte(c.info >> xorShift) - } else { - // Interpret XOR bits as an index. - // TODO: test performance for unrolling this loop. Verify that we have - // at least two bytes and at most three. - idx := c.info >> xorShift - for p := c.pDst - 1; ; p-- { - c.dst[p] ^= xorData[idx] - idx-- - if xorData[idx] == 0 { - break - } - } - } - return true -} - -// hasPrefix returns true if src[pSrc:] starts with the given string. -func (c *context) hasPrefix(s string) bool { - b := c.src[c.pSrc:] - if len(b) < len(s) { - return false - } - for i, c := range b[:len(s)] { - if c != s[i] { - return false - } - } - return true -} - -// caseType returns an info with only the case bits, normalized to either -// cLower, cUpper, cTitle or cUncased. -func (c *context) caseType() info { - cm := c.info & 0x7 - if cm < 4 { - return cm - } - if cm >= cXORCase { - // xor the last bit of the rune with the case type bits. - b := c.src[c.pSrc+c.sz-1] - return info(b&1) ^ cm&0x3 - } - if cm == cIgnorableCased { - return cLower - } - return cUncased -} - -// lower writes the lowercase version of the current rune to dst. -func lower(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cLower { - return c.copy() - } - if c.info&exceptionBit == 0 { - return c.copyXOR() - } - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { - return c.writeString(e[offset : offset+nLower]) - } - return c.copy() -} - -func isLower(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cLower { - return true - } - if c.info&exceptionBit == 0 { - c.err = transform.ErrEndOfSpan - return false - } - e := exceptions[c.info>>exceptionShift:] - if nLower := (e[1] >> lengthBits) & lengthMask; nLower != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// upper writes the uppercase version of the current rune to dst. -func upper(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cUpper { - return c.copy() - } - if c.info&exceptionBit == 0 { - return c.copyXOR() - } - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - // Get length of first special case mapping. - n := (e[1] >> lengthBits) & lengthMask - if ct == cTitle { - // The first special case mapping is for lower. Set n to the second. - if n == noChange { - n = 0 - } - n, e = e[1]&lengthMask, e[n:] - } - if n != noChange { - return c.writeString(e[offset : offset+n]) - } - return c.copy() -} - -// isUpper writes the isUppercase version of the current rune to dst. -func isUpper(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cUpper { - return true - } - if c.info&exceptionBit == 0 { - c.err = transform.ErrEndOfSpan - return false - } - e := exceptions[c.info>>exceptionShift:] - // Get length of first special case mapping. - n := (e[1] >> lengthBits) & lengthMask - if ct == cTitle { - n = e[1] & lengthMask - } - if n != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// title writes the title case version of the current rune to dst. -func title(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cTitle { - return c.copy() - } - if c.info&exceptionBit == 0 { - if ct == cLower { - return c.copyXOR() - } - return c.copy() - } - // Get the exception data. - e := exceptions[c.info>>exceptionShift:] - offset := 2 + e[0]&lengthMask // size of header + fold string - - nFirst := (e[1] >> lengthBits) & lengthMask - if nTitle := e[1] & lengthMask; nTitle != noChange { - if nFirst != noChange { - e = e[nFirst:] - } - return c.writeString(e[offset : offset+nTitle]) - } - if ct == cLower && nFirst != noChange { - // Use the uppercase version instead. - return c.writeString(e[offset : offset+nFirst]) - } - // Already in correct case. - return c.copy() -} - -// isTitle reports whether the current rune is in title case. -func isTitle(c *context) bool { - ct := c.caseType() - if c.info&hasMappingMask == 0 || ct == cTitle { - return true - } - if c.info&exceptionBit == 0 { - if ct == cLower { - c.err = transform.ErrEndOfSpan - return false - } - return true - } - // Get the exception data. - e := exceptions[c.info>>exceptionShift:] - if nTitle := e[1] & lengthMask; nTitle != noChange { - c.err = transform.ErrEndOfSpan - return false - } - nFirst := (e[1] >> lengthBits) & lengthMask - if ct == cLower && nFirst != noChange { - c.err = transform.ErrEndOfSpan - return false - } - return true -} - -// foldFull writes the foldFull version of the current rune to dst. -func foldFull(c *context) bool { - if c.info&hasMappingMask == 0 { - return c.copy() - } - ct := c.caseType() - if c.info&exceptionBit == 0 { - if ct != cLower || c.info&inverseFoldBit != 0 { - return c.copyXOR() - } - return c.copy() - } - e := exceptions[c.info>>exceptionShift:] - n := e[0] & lengthMask - if n == 0 { - if ct == cLower { - return c.copy() - } - n = (e[1] >> lengthBits) & lengthMask - } - return c.writeString(e[2 : 2+n]) -} - -// isFoldFull reports whether the current run is mapped to foldFull -func isFoldFull(c *context) bool { - if c.info&hasMappingMask == 0 { - return true - } - ct := c.caseType() - if c.info&exceptionBit == 0 { - if ct != cLower || c.info&inverseFoldBit != 0 { - c.err = transform.ErrEndOfSpan - return false - } - return true - } - e := exceptions[c.info>>exceptionShift:] - n := e[0] & lengthMask - if n == 0 && ct == cLower { - return true - } - c.err = transform.ErrEndOfSpan - return false -} diff --git a/vendor/golang.org/x/text/cases/fold.go b/vendor/golang.org/x/text/cases/fold.go deleted file mode 100644 index 85cc434f..00000000 --- a/vendor/golang.org/x/text/cases/fold.go +++ /dev/null @@ -1,34 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -import "golang.org/x/text/transform" - -type caseFolder struct{ transform.NopResetter } - -// caseFolder implements the Transformer interface for doing case folding. -func (t *caseFolder) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() { - foldFull(&c) - c.checkpoint() - } - return c.ret() -} - -func (t *caseFolder) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isFoldFull(&c) { - c.checkpoint() - } - return c.retSpan() -} - -func makeFold(o options) transform.SpanningTransformer { - // TODO: Special case folding, through option Language, Special/Turkic, or - // both. - // TODO: Implement Compact options. - return &caseFolder{} -} diff --git a/vendor/golang.org/x/text/cases/gen.go b/vendor/golang.org/x/text/cases/gen.go deleted file mode 100644 index 24b72300..00000000 --- a/vendor/golang.org/x/text/cases/gen.go +++ /dev/null @@ -1,839 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -// This program generates the trie for casing operations. The Unicode casing -// algorithm requires the lookup of various properties and mappings for each -// rune. The table generated by this generator combines several of the most -// frequently used of these into a single trie so that they can be accessed -// with a single lookup. -package main - -import ( - "bytes" - "fmt" - "io" - "io/ioutil" - "log" - "reflect" - "strconv" - "strings" - "unicode" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/triegen" - "golang.org/x/text/internal/ucd" - "golang.org/x/text/unicode/norm" -) - -func main() { - gen.Init() - genTables() - genTablesTest() - gen.Repackage("gen_trieval.go", "trieval.go", "cases") -} - -// runeInfo contains all information for a rune that we care about for casing -// operations. -type runeInfo struct { - Rune rune - - entry info // trie value for this rune. - - CaseMode info - - // Simple case mappings. - Simple [1 + maxCaseMode][]rune - - // Special casing - HasSpecial bool - Conditional bool - Special [1 + maxCaseMode][]rune - - // Folding - FoldSimple rune - FoldSpecial rune - FoldFull []rune - - // TODO: FC_NFKC, or equivalent data. - - // Properties - SoftDotted bool - CaseIgnorable bool - Cased bool - DecomposeGreek bool - BreakType string - BreakCat breakCategory - - // We care mostly about 0, Above, and IotaSubscript. - CCC byte -} - -type breakCategory int - -const ( - breakBreak breakCategory = iota - breakLetter - breakMid -) - -// mapping returns the case mapping for the given case type. -func (r *runeInfo) mapping(c info) string { - if r.HasSpecial { - return string(r.Special[c]) - } - if len(r.Simple[c]) != 0 { - return string(r.Simple[c]) - } - return string(r.Rune) -} - -func parse(file string, f func(p *ucd.Parser)) { - ucd.Parse(gen.OpenUCDFile(file), f) -} - -func parseUCD() []runeInfo { - chars := make([]runeInfo, unicode.MaxRune) - - get := func(r rune) *runeInfo { - c := &chars[r] - c.Rune = r - return c - } - - parse("UnicodeData.txt", func(p *ucd.Parser) { - ri := get(p.Rune(0)) - ri.CCC = byte(p.Int(ucd.CanonicalCombiningClass)) - ri.Simple[cLower] = p.Runes(ucd.SimpleLowercaseMapping) - ri.Simple[cUpper] = p.Runes(ucd.SimpleUppercaseMapping) - ri.Simple[cTitle] = p.Runes(ucd.SimpleTitlecaseMapping) - if p.String(ucd.GeneralCategory) == "Lt" { - ri.CaseMode = cTitle - } - }) - - // ; - parse("PropList.txt", func(p *ucd.Parser) { - if p.String(1) == "Soft_Dotted" { - chars[p.Rune(0)].SoftDotted = true - } - }) - - // ; - parse("DerivedCoreProperties.txt", func(p *ucd.Parser) { - ri := get(p.Rune(0)) - switch p.String(1) { - case "Case_Ignorable": - ri.CaseIgnorable = true - case "Cased": - ri.Cased = true - case "Lowercase": - ri.CaseMode = cLower - case "Uppercase": - ri.CaseMode = cUpper - } - }) - - // ; ; ; <upper> ; (<condition_list> ;)? - parse("SpecialCasing.txt", func(p *ucd.Parser) { - // We drop all conditional special casing and deal with them manually in - // the language-specific case mappers. Rune 0x03A3 is the only one with - // a conditional formatting that is not language-specific. However, - // dealing with this letter is tricky, especially in a streaming - // context, so we deal with it in the Caser for Greek specifically. - ri := get(p.Rune(0)) - if p.String(4) == "" { - ri.HasSpecial = true - ri.Special[cLower] = p.Runes(1) - ri.Special[cTitle] = p.Runes(2) - ri.Special[cUpper] = p.Runes(3) - } else { - ri.Conditional = true - } - }) - - // TODO: Use text breaking according to UAX #29. - // <code>; <word break type> - parse("auxiliary/WordBreakProperty.txt", func(p *ucd.Parser) { - ri := get(p.Rune(0)) - ri.BreakType = p.String(1) - - // We collapse the word breaking properties onto the categories we need. - switch p.String(1) { // TODO: officially we need to canonicalize. - case "MidLetter", "MidNumLet", "Single_Quote": - ri.BreakCat = breakMid - if !ri.CaseIgnorable { - // finalSigma relies on the fact that all breakMid runes are - // also a Case_Ignorable. Revisit this code when this changes. - log.Fatalf("Rune %U, which has a break category mid, is not a case ignorable", ri) - } - case "ALetter", "Hebrew_Letter", "Numeric", "Extend", "ExtendNumLet", "Format", "ZWJ": - ri.BreakCat = breakLetter - } - }) - - // <code>; <type>; <mapping> - parse("CaseFolding.txt", func(p *ucd.Parser) { - ri := get(p.Rune(0)) - switch p.String(1) { - case "C": - ri.FoldSimple = p.Rune(2) - ri.FoldFull = p.Runes(2) - case "S": - ri.FoldSimple = p.Rune(2) - case "T": - ri.FoldSpecial = p.Rune(2) - case "F": - ri.FoldFull = p.Runes(2) - default: - log.Fatalf("%U: unknown type: %s", p.Rune(0), p.String(1)) - } - }) - - return chars -} - -func genTables() { - chars := parseUCD() - verifyProperties(chars) - - t := triegen.NewTrie("case") - for i := range chars { - c := &chars[i] - makeEntry(c) - t.Insert(rune(i), uint64(c.entry)) - } - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "cases") - - gen.WriteUnicodeVersion(w) - - // TODO: write CLDR version after adding a mechanism to detect that the - // tables on which the manually created locale-sensitive casing code is - // based hasn't changed. - - w.WriteVar("xorData", string(xorData)) - w.WriteVar("exceptions", string(exceptionData)) - - sz, err := t.Gen(w, triegen.Compact(&sparseCompacter{})) - if err != nil { - log.Fatal(err) - } - w.Size += sz -} - -func makeEntry(ri *runeInfo) { - if ri.CaseIgnorable { - if ri.Cased { - ri.entry = cIgnorableCased - } else { - ri.entry = cIgnorableUncased - } - } else { - ri.entry = ri.CaseMode - } - - // TODO: handle soft-dotted. - - ccc := cccOther - switch ri.CCC { - case 0: // Not_Reordered - ccc = cccZero - case above: // Above - ccc = cccAbove - } - switch ri.BreakCat { - case breakBreak: - ccc = cccBreak - case breakMid: - ri.entry |= isMidBit - } - - ri.entry |= ccc - - if ri.CaseMode == cUncased { - return - } - - // Need to do something special. - if ri.CaseMode == cTitle || ri.HasSpecial || ri.mapping(cTitle) != ri.mapping(cUpper) { - makeException(ri) - return - } - if f := string(ri.FoldFull); len(f) > 0 && f != ri.mapping(cUpper) && f != ri.mapping(cLower) { - makeException(ri) - return - } - - // Rune is either lowercase or uppercase. - - orig := string(ri.Rune) - mapped := "" - if ri.CaseMode == cUpper { - mapped = ri.mapping(cLower) - } else { - mapped = ri.mapping(cUpper) - } - - if len(orig) != len(mapped) { - makeException(ri) - return - } - - if string(ri.FoldFull) == ri.mapping(cUpper) { - ri.entry |= inverseFoldBit - } - - n := len(orig) - - // Create per-byte XOR mask. - var b []byte - for i := 0; i < n; i++ { - b = append(b, orig[i]^mapped[i]) - } - - // Remove leading 0 bytes, but keep at least one byte. - for ; len(b) > 1 && b[0] == 0; b = b[1:] { - } - - if len(b) == 1 && b[0]&0xc0 == 0 { - ri.entry |= info(b[0]) << xorShift - return - } - - key := string(b) - x, ok := xorCache[key] - if !ok { - xorData = append(xorData, 0) // for detecting start of sequence - xorData = append(xorData, b...) - - x = len(xorData) - 1 - xorCache[key] = x - } - ri.entry |= info(x<<xorShift) | xorIndexBit -} - -var xorCache = map[string]int{} - -// xorData contains byte-wise XOR data for the least significant bytes of a -// UTF-8 encoded rune. An index points to the last byte. The sequence starts -// with a zero terminator. -var xorData = []byte{} - -// See the comments in gen_trieval.go re "the exceptions slice". -var exceptionData = []byte{0} - -// makeException encodes case mappings that cannot be expressed in a simple -// XOR diff. -func makeException(ri *runeInfo) { - ccc := ri.entry & cccMask - // Set exception bit and retain case type. - ri.entry &= 0x0007 - ri.entry |= exceptionBit - - if len(exceptionData) >= 1<<numExceptionBits { - log.Fatalf("%U:exceptionData too large %x > %d bits", ri.Rune, len(exceptionData), numExceptionBits) - } - - // Set the offset in the exceptionData array. - ri.entry |= info(len(exceptionData) << exceptionShift) - - orig := string(ri.Rune) - tc := ri.mapping(cTitle) - uc := ri.mapping(cUpper) - lc := ri.mapping(cLower) - ff := string(ri.FoldFull) - - // addString sets the length of a string and adds it to the expansions array. - addString := func(s string, b *byte) { - if len(s) == 0 { - // Zero-length mappings exist, but only for conditional casing, - // which we are representing outside of this table. - log.Fatalf("%U: has zero-length mapping.", ri.Rune) - } - *b <<= 3 - if s != orig { - n := len(s) - if n > 7 { - log.Fatalf("%U: mapping larger than 7 (%d)", ri.Rune, n) - } - *b |= byte(n) - exceptionData = append(exceptionData, s...) - } - } - - // byte 0: - exceptionData = append(exceptionData, byte(ccc)|byte(len(ff))) - - // byte 1: - p := len(exceptionData) - exceptionData = append(exceptionData, 0) - - if len(ff) > 7 { // May be zero-length. - log.Fatalf("%U: fold string larger than 7 (%d)", ri.Rune, len(ff)) - } - exceptionData = append(exceptionData, ff...) - ct := ri.CaseMode - if ct != cLower { - addString(lc, &exceptionData[p]) - } - if ct != cUpper { - addString(uc, &exceptionData[p]) - } - if ct != cTitle { - // If title is the same as upper, we set it to the original string so - // that it will be marked as not present. This implies title case is - // the same as upper case. - if tc == uc { - tc = orig - } - addString(tc, &exceptionData[p]) - } -} - -// sparseCompacter is a trie value block Compacter. There are many cases where -// successive runes alternate between lower- and upper-case. This Compacter -// exploits this by adding a special case type where the case value is obtained -// from or-ing it with the least-significant bit of the rune, creating large -// ranges of equal case values that compress well. -type sparseCompacter struct { - sparseBlocks [][]uint16 - sparseOffsets []uint16 - sparseCount int -} - -// makeSparse returns the number of elements that compact block would contain -// as well as the modified values. -func makeSparse(vals []uint64) ([]uint16, int) { - // Copy the values. - values := make([]uint16, len(vals)) - for i, v := range vals { - values[i] = uint16(v) - } - - alt := func(i int, v uint16) uint16 { - if cm := info(v & fullCasedMask); cm == cUpper || cm == cLower { - // Convert cLower or cUpper to cXORCase value, which has the form 11x. - xor := v - xor &^= 1 - xor |= uint16(i&1) ^ (v & 1) - xor |= 0x4 - return xor - } - return v - } - - var count int - var previous uint16 - for i, v := range values { - if v != 0 { - // Try if the unmodified value is equal to the previous. - if v == previous { - continue - } - - // Try if the xor-ed value is equal to the previous value. - a := alt(i, v) - if a == previous { - values[i] = a - continue - } - - // This is a new value. - count++ - - // Use the xor-ed value if it will be identical to the next value. - if p := i + 1; p < len(values) && alt(p, values[p]) == a { - values[i] = a - v = a - } - } - previous = v - } - return values, count -} - -func (s *sparseCompacter) Size(v []uint64) (int, bool) { - _, n := makeSparse(v) - - // We limit using this method to having 16 entries. - if n > 16 { - return 0, false - } - - return 2 + int(reflect.TypeOf(valueRange{}).Size())*n, true -} - -func (s *sparseCompacter) Store(v []uint64) uint32 { - h := uint32(len(s.sparseOffsets)) - values, sz := makeSparse(v) - s.sparseBlocks = append(s.sparseBlocks, values) - s.sparseOffsets = append(s.sparseOffsets, uint16(s.sparseCount)) - s.sparseCount += sz - return h -} - -func (s *sparseCompacter) Handler() string { - // The sparse global variable and its lookup method is defined in gen_trieval.go. - return "sparse.lookup" -} - -func (s *sparseCompacter) Print(w io.Writer) (retErr error) { - p := func(format string, args ...interface{}) { - _, err := fmt.Fprintf(w, format, args...) - if retErr == nil && err != nil { - retErr = err - } - } - - ls := len(s.sparseBlocks) - if ls == len(s.sparseOffsets) { - s.sparseOffsets = append(s.sparseOffsets, uint16(s.sparseCount)) - } - p("// sparseOffsets: %d entries, %d bytes\n", ls+1, (ls+1)*2) - p("var sparseOffsets = %#v\n\n", s.sparseOffsets) - - ns := s.sparseCount - p("// sparseValues: %d entries, %d bytes\n", ns, ns*4) - p("var sparseValues = [%d]valueRange {", ns) - for i, values := range s.sparseBlocks { - p("\n// Block %#x, offset %#x", i, s.sparseOffsets[i]) - var v uint16 - for i, nv := range values { - if nv != v { - if v != 0 { - p(",hi:%#02x},", 0x80+i-1) - } - if nv != 0 { - p("\n{value:%#04x,lo:%#02x", nv, 0x80+i) - } - } - v = nv - } - if v != 0 { - p(",hi:%#02x},", 0x80+len(values)-1) - } - } - p("\n}\n\n") - return -} - -// verifyProperties that properties of the runes that are relied upon in the -// implementation. Each property is marked with an identifier that is referred -// to in the places where it is used. -func verifyProperties(chars []runeInfo) { - for i, c := range chars { - r := rune(i) - - // Rune properties. - - // A.1: modifier never changes on lowercase. [ltLower] - if c.CCC > 0 && unicode.ToLower(r) != r { - log.Fatalf("%U: non-starter changes when lowercased", r) - } - - // A.2: properties of decompositions starting with I or J. [ltLower] - d := norm.NFD.PropertiesString(string(r)).Decomposition() - if len(d) > 0 { - if d[0] == 'I' || d[0] == 'J' { - // A.2.1: we expect at least an ASCII character and a modifier. - if len(d) < 3 { - log.Fatalf("%U: length of decomposition was %d; want >= 3", r, len(d)) - } - - // All subsequent runes are modifiers and all have the same CCC. - runes := []rune(string(d[1:])) - ccc := chars[runes[0]].CCC - - for _, mr := range runes[1:] { - mc := chars[mr] - - // A.2.2: all modifiers have a CCC of Above or less. - if ccc == 0 || ccc > above { - log.Fatalf("%U: CCC of successive rune (%U) was %d; want (0,230]", r, mr, ccc) - } - - // A.2.3: a sequence of modifiers all have the same CCC. - if mc.CCC != ccc { - log.Fatalf("%U: CCC of follow-up modifier (%U) was %d; want %d", r, mr, mc.CCC, ccc) - } - - // A.2.4: for each trailing r, r in [0x300, 0x311] <=> CCC == Above. - if (ccc == above) != (0x300 <= mr && mr <= 0x311) { - log.Fatalf("%U: modifier %U in [U+0300, U+0311] != ccc(%U) == 230", r, mr, mr) - } - - if i += len(string(mr)); i >= len(d) { - break - } - } - } - } - - // A.3: no U+0307 in decomposition of Soft-Dotted rune. [ltUpper] - if unicode.Is(unicode.Soft_Dotted, r) && strings.Contains(string(d), "\u0307") { - log.Fatalf("%U: decomposition of soft-dotted rune may not contain U+0307", r) - } - - // A.4: only rune U+0345 may be of CCC Iota_Subscript. [elUpper] - if c.CCC == iotaSubscript && r != 0x0345 { - log.Fatalf("%U: only rune U+0345 may have CCC Iota_Subscript", r) - } - - // A.5: soft-dotted runes do not have exceptions. - if c.SoftDotted && c.entry&exceptionBit != 0 { - log.Fatalf("%U: soft-dotted has exception", r) - } - - // A.6: Greek decomposition. [elUpper] - if unicode.Is(unicode.Greek, r) { - if b := norm.NFD.PropertiesString(string(r)).Decomposition(); b != nil { - runes := []rune(string(b)) - // A.6.1: If a Greek rune decomposes and the first rune of the - // decomposition is greater than U+00FF, the rune is always - // great and not a modifier. - if f := runes[0]; unicode.IsMark(f) || f > 0xFF && !unicode.Is(unicode.Greek, f) { - log.Fatalf("%U: expected first rune of Greek decomposition to be letter, found %U", r, f) - } - // A.6.2: Any follow-up rune in a Greek decomposition is a - // modifier of which the first should be gobbled in - // decomposition. - for _, m := range runes[1:] { - switch m { - case 0x0313, 0x0314, 0x0301, 0x0300, 0x0306, 0x0342, 0x0308, 0x0304, 0x345: - default: - log.Fatalf("%U: modifier %U is outside of expected Greek modifier set", r, m) - } - } - } - } - - // Breaking properties. - - // B.1: all runes with CCC > 0 are of break type Extend. - if c.CCC > 0 && c.BreakType != "Extend" { - log.Fatalf("%U: CCC == %d, but got break type %s; want Extend", r, c.CCC, c.BreakType) - } - - // B.2: all cased runes with c.CCC == 0 are of break type ALetter. - if c.CCC == 0 && c.Cased && c.BreakType != "ALetter" { - log.Fatalf("%U: cased, but got break type %s; want ALetter", r, c.BreakType) - } - - // B.3: letter category. - if c.CCC == 0 && c.BreakCat != breakBreak && !c.CaseIgnorable { - if c.BreakCat != breakLetter { - log.Fatalf("%U: check for letter break type gave %d; want %d", r, c.BreakCat, breakLetter) - } - } - } -} - -func genTablesTest() { - w := &bytes.Buffer{} - - fmt.Fprintln(w, "var (") - printProperties(w, "DerivedCoreProperties.txt", "Case_Ignorable", verifyIgnore) - - // We discard the output as we know we have perfect functions. We run them - // just to verify the properties are correct. - n := printProperties(ioutil.Discard, "DerivedCoreProperties.txt", "Cased", verifyCased) - n += printProperties(ioutil.Discard, "DerivedCoreProperties.txt", "Lowercase", verifyLower) - n += printProperties(ioutil.Discard, "DerivedCoreProperties.txt", "Uppercase", verifyUpper) - if n > 0 { - log.Fatalf("One of the discarded properties does not have a perfect filter.") - } - - // <code>; <lower> ; <title> ; <upper> ; (<condition_list> ;)? - fmt.Fprintln(w, "\tspecial = map[rune]struct{ toLower, toTitle, toUpper string }{") - parse("SpecialCasing.txt", func(p *ucd.Parser) { - // Skip conditional entries. - if p.String(4) != "" { - return - } - r := p.Rune(0) - fmt.Fprintf(w, "\t\t0x%04x: {%q, %q, %q},\n", - r, string(p.Runes(1)), string(p.Runes(2)), string(p.Runes(3))) - }) - fmt.Fprint(w, "\t}\n\n") - - // <code>; <type>; <runes> - table := map[rune]struct{ simple, full, special string }{} - parse("CaseFolding.txt", func(p *ucd.Parser) { - r := p.Rune(0) - t := p.String(1) - v := string(p.Runes(2)) - if t != "T" && v == string(unicode.ToLower(r)) { - return - } - x := table[r] - switch t { - case "C": - x.full = v - x.simple = v - case "S": - x.simple = v - case "F": - x.full = v - case "T": - x.special = v - } - table[r] = x - }) - fmt.Fprintln(w, "\tfoldMap = map[rune]struct{ simple, full, special string }{") - for r := rune(0); r < 0x10FFFF; r++ { - x, ok := table[r] - if !ok { - continue - } - fmt.Fprintf(w, "\t\t0x%04x: {%q, %q, %q},\n", r, x.simple, x.full, x.special) - } - fmt.Fprint(w, "\t}\n\n") - - // Break property - notBreak := map[rune]bool{} - parse("auxiliary/WordBreakProperty.txt", func(p *ucd.Parser) { - switch p.String(1) { - case "Extend", "Format", "MidLetter", "MidNumLet", "Single_Quote", - "ALetter", "Hebrew_Letter", "Numeric", "ExtendNumLet", "ZWJ": - notBreak[p.Rune(0)] = true - } - }) - - fmt.Fprintln(w, "\tbreakProp = []struct{ lo, hi rune }{") - inBreak := false - for r := rune(0); r <= lastRuneForTesting; r++ { - if isBreak := !notBreak[r]; isBreak != inBreak { - if isBreak { - fmt.Fprintf(w, "\t\t{0x%x, ", r) - } else { - fmt.Fprintf(w, "0x%x},\n", r-1) - } - inBreak = isBreak - } - } - if inBreak { - fmt.Fprintf(w, "0x%x},\n", lastRuneForTesting) - } - fmt.Fprint(w, "\t}\n\n") - - // Word break test - // Filter out all samples that do not contain cased characters. - cased := map[rune]bool{} - parse("DerivedCoreProperties.txt", func(p *ucd.Parser) { - if p.String(1) == "Cased" { - cased[p.Rune(0)] = true - } - }) - - fmt.Fprintln(w, "\tbreakTest = []string{") - parse("auxiliary/WordBreakTest.txt", func(p *ucd.Parser) { - c := strings.Split(p.String(0), " ") - - const sep = '|' - numCased := 0 - test := "" - for ; len(c) >= 2; c = c[2:] { - if c[0] == "÷" && test != "" { - test += string(sep) - } - i, err := strconv.ParseUint(c[1], 16, 32) - r := rune(i) - if err != nil { - log.Fatalf("Invalid rune %q.", c[1]) - } - if r == sep { - log.Fatalf("Separator %q not allowed in test data. Pick another one.", sep) - } - if cased[r] { - numCased++ - } - test += string(r) - } - if numCased > 1 { - fmt.Fprintf(w, "\t\t%q,\n", test) - } - }) - fmt.Fprintln(w, "\t}") - - fmt.Fprintln(w, ")") - - gen.WriteGoFile("tables_test.go", "cases", w.Bytes()) -} - -// These functions are just used for verification that their definition have not -// changed in the Unicode Standard. - -func verifyCased(r rune) bool { - return verifyLower(r) || verifyUpper(r) || unicode.IsTitle(r) -} - -func verifyLower(r rune) bool { - return unicode.IsLower(r) || unicode.Is(unicode.Other_Lowercase, r) -} - -func verifyUpper(r rune) bool { - return unicode.IsUpper(r) || unicode.Is(unicode.Other_Uppercase, r) -} - -// verifyIgnore is an approximation of the Case_Ignorable property using the -// core unicode package. It is used to reduce the size of the test data. -func verifyIgnore(r rune) bool { - props := []*unicode.RangeTable{ - unicode.Mn, - unicode.Me, - unicode.Cf, - unicode.Lm, - unicode.Sk, - } - for _, p := range props { - if unicode.Is(p, r) { - return true - } - } - return false -} - -// printProperties prints tables of rune properties from the given UCD file. -// A filter func f can be given to exclude certain values. A rune r will have -// the indicated property if it is in the generated table or if f(r). -func printProperties(w io.Writer, file, property string, f func(r rune) bool) int { - verify := map[rune]bool{} - n := 0 - varNameParts := strings.Split(property, "_") - varNameParts[0] = strings.ToLower(varNameParts[0]) - fmt.Fprintf(w, "\t%s = map[rune]bool{\n", strings.Join(varNameParts, "")) - parse(file, func(p *ucd.Parser) { - if p.String(1) == property { - r := p.Rune(0) - verify[r] = true - if !f(r) { - n++ - fmt.Fprintf(w, "\t\t0x%.4x: true,\n", r) - } - } - }) - fmt.Fprint(w, "\t}\n\n") - - // Verify that f is correct, that is, it represents a subset of the property. - for r := rune(0); r <= lastRuneForTesting; r++ { - if !verify[r] && f(r) { - log.Fatalf("Incorrect filter func for property %q.", property) - } - } - return n -} - -// The newCaseTrie, sparseValues and sparseOffsets definitions below are -// placeholders referred to by gen_trieval.go. The real definitions are -// generated by this program and written to tables.go. - -func newCaseTrie(int) int { return 0 } - -var ( - sparseValues [0]valueRange - sparseOffsets [0]uint16 -) diff --git a/vendor/golang.org/x/text/cases/gen_trieval.go b/vendor/golang.org/x/text/cases/gen_trieval.go deleted file mode 100644 index 376d22c8..00000000 --- a/vendor/golang.org/x/text/cases/gen_trieval.go +++ /dev/null @@ -1,219 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file contains definitions for interpreting the trie value of the case -// trie generated by "go run gen*.go". It is shared by both the generator -// program and the resultant package. Sharing is achieved by the generator -// copying gen_trieval.go to trieval.go and changing what's above this comment. - -// info holds case information for a single rune. It is the value returned -// by a trie lookup. Most mapping information can be stored in a single 16-bit -// value. If not, for example when a rune is mapped to multiple runes, the value -// stores some basic case data and an index into an array with additional data. -// -// The per-rune values have the following format: -// -// if (exception) { -// 15..5 unsigned exception index -// 4 unused -// } else { -// 15..8 XOR pattern or index to XOR pattern for case mapping -// Only 13..8 are used for XOR patterns. -// 7 inverseFold (fold to upper, not to lower) -// 6 index: interpret the XOR pattern as an index -// or isMid if case mode is cIgnorableUncased. -// 5..4 CCC: zero (normal or break), above or other -// } -// 3 exception: interpret this value as an exception index -// (TODO: is this bit necessary? Probably implied from case mode.) -// 2..0 case mode -// -// For the non-exceptional cases, a rune must be either uncased, lowercase or -// uppercase. If the rune is cased, the XOR pattern maps either a lowercase -// rune to uppercase or an uppercase rune to lowercase (applied to the 10 -// least-significant bits of the rune). -// -// See the definitions below for a more detailed description of the various -// bits. -type info uint16 - -const ( - casedMask = 0x0003 - fullCasedMask = 0x0007 - ignorableMask = 0x0006 - ignorableValue = 0x0004 - - inverseFoldBit = 1 << 7 - isMidBit = 1 << 6 - - exceptionBit = 1 << 3 - exceptionShift = 5 - numExceptionBits = 11 - - xorIndexBit = 1 << 6 - xorShift = 8 - - // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xff80 | exceptionBit -) - -// The case mode bits encodes the case type of a rune. This includes uncased, -// title, upper and lower case and case ignorable. (For a definition of these -// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare -// cases, a rune can be both cased and case-ignorable. This is encoded by -// cIgnorableCased. A rune of this type is always lower case. Some runes are -// cased while not having a mapping. -// -// A common pattern for scripts in the Unicode standard is for upper and lower -// case runes to alternate for increasing rune values (e.g. the accented Latin -// ranges starting from U+0100 and U+1E00 among others and some Cyrillic -// characters). We use this property by defining a cXORCase mode, where the case -// mode (always upper or lower case) is derived from the rune value. As the XOR -// pattern for case mappings is often identical for successive runes, using -// cXORCase can result in large series of identical trie values. This, in turn, -// allows us to better compress the trie blocks. -const ( - cUncased info = iota // 000 - cTitle // 001 - cLower // 010 - cUpper // 011 - cIgnorableUncased // 100 - cIgnorableCased // 101 // lower case if mappings exist - cXORCase // 11x // case is cLower | ((rune&1) ^ x) - - maxCaseMode = cUpper -) - -func (c info) isCased() bool { - return c&casedMask != 0 -} - -func (c info) isCaseIgnorable() bool { - return c&ignorableMask == ignorableValue -} - -func (c info) isNotCasedAndNotCaseIgnorable() bool { - return c&fullCasedMask == 0 -} - -func (c info) isCaseIgnorableAndNotCased() bool { - return c&fullCasedMask == cIgnorableUncased -} - -func (c info) isMid() bool { - return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased -} - -// The case mapping implementation will need to know about various Canonical -// Combining Class (CCC) values. We encode two of these in the trie value: -// cccZero (0) and cccAbove (230). If the value is cccOther, it means that -// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that -// the rune also has the break category Break (see below). -const ( - cccBreak info = iota << 4 - cccZero - cccAbove - cccOther - - cccMask = cccBreak | cccZero | cccAbove | cccOther -) - -const ( - starter = 0 - above = 230 - iotaSubscript = 240 -) - -// The exceptions slice holds data that does not fit in a normal info entry. -// The entry is pointed to by the exception index in an entry. It has the -// following format: -// -// Header -// byte 0: -// 7..6 unused -// 5..4 CCC type (same bits as entry) -// 3 unused -// 2..0 length of fold -// -// byte 1: -// 7..6 unused -// 5..3 length of 1st mapping of case type -// 2..0 length of 2nd mapping of case type -// -// case 1st 2nd -// lower -> upper, title -// upper -> lower, title -// title -> lower, upper -// -// Lengths with the value 0x7 indicate no value and implies no change. -// A length of 0 indicates a mapping to zero-length string. -// -// Body bytes: -// case folding bytes -// lowercase mapping bytes -// uppercase mapping bytes -// titlecase mapping bytes -// closure mapping bytes (for NFKC_Casefold). (TODO) -// -// Fallbacks: -// missing fold -> lower -// missing title -> upper -// all missing -> original rune -// -// exceptions starts with a dummy byte to enforce that there is no zero index -// value. -const ( - lengthMask = 0x07 - lengthBits = 3 - noChange = 0 -) - -// References to generated trie. - -var trie = newCaseTrie(0) - -var sparse = sparseBlocks{ - values: sparseValues[:], - offsets: sparseOffsets[:], -} - -// Sparse block lookup code. - -// valueRange is an entry in a sparse block. -type valueRange struct { - value uint16 - lo, hi byte -} - -type sparseBlocks struct { - values []valueRange - offsets []uint16 -} - -// lookup returns the value from values block n for byte b using binary search. -func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { - lo := s.offsets[n] - hi := s.offsets[n+1] - for lo < hi { - m := lo + (hi-lo)/2 - r := s.values[m] - if r.lo <= b && b <= r.hi { - return r.value - } - if b < r.lo { - hi = m - } else { - lo = m + 1 - } - } - return 0 -} - -// lastRuneForTesting is the last rune used for testing. Everything after this -// is boring. -const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/cases/icu.go b/vendor/golang.org/x/text/cases/icu.go deleted file mode 100644 index 46530d1e..00000000 --- a/vendor/golang.org/x/text/cases/icu.go +++ /dev/null @@ -1,61 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build icu - -package cases - -// Ideally these functions would be defined in a test file, but go test doesn't -// allow CGO in tests. The build tag should ensure either way that these -// functions will not end up in the package. - -// TODO: Ensure that the correct ICU version is set. - -/* -#cgo LDFLAGS: -licui18n.57 -licuuc.57 -#include <stdlib.h> -#include <unicode/ustring.h> -#include <unicode/utypes.h> -#include <unicode/localpointer.h> -#include <unicode/ucasemap.h> -*/ -import "C" - -import "unsafe" - -func doICU(tag, caser, input string) string { - err := C.UErrorCode(0) - loc := C.CString(tag) - cm := C.ucasemap_open(loc, C.uint32_t(0), &err) - - buf := make([]byte, len(input)*4) - dst := (*C.char)(unsafe.Pointer(&buf[0])) - src := C.CString(input) - - cn := C.int32_t(0) - - switch caser { - case "fold": - cn = C.ucasemap_utf8FoldCase(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "lower": - cn = C.ucasemap_utf8ToLower(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "upper": - cn = C.ucasemap_utf8ToUpper(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - case "title": - cn = C.ucasemap_utf8ToTitle(cm, - dst, C.int32_t(len(buf)), - src, C.int32_t(len(input)), - &err) - } - return string(buf[:cn]) -} diff --git a/vendor/golang.org/x/text/cases/info.go b/vendor/golang.org/x/text/cases/info.go deleted file mode 100644 index 3b51f03d..00000000 --- a/vendor/golang.org/x/text/cases/info.go +++ /dev/null @@ -1,82 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -func (c info) cccVal() info { - if c&exceptionBit != 0 { - return info(exceptions[c>>exceptionShift]) & cccMask - } - return c & cccMask -} - -func (c info) cccType() info { - ccc := c.cccVal() - if ccc <= cccZero { - return cccZero - } - return ccc -} - -// TODO: Implement full Unicode breaking algorithm: -// 1) Implement breaking in separate package. -// 2) Use the breaker here. -// 3) Compare table size and performance of using the more generic breaker. -// -// Note that we can extend the current algorithm to be much more accurate. This -// only makes sense, though, if the performance and/or space penalty of using -// the generic breaker is big. Extra data will only be needed for non-cased -// runes, which means there are sufficient bits left in the caseType. -// ICU prohibits breaking in such cases as well. - -// For the purpose of title casing we use an approximation of the Unicode Word -// Breaking algorithm defined in Annex #29: -// http://www.unicode.org/reports/tr29/#Default_Grapheme_Cluster_Table. -// -// For our approximation, we group the Word Break types into the following -// categories, with associated rules: -// -// 1) Letter: -// ALetter, Hebrew_Letter, Numeric, ExtendNumLet, Extend, Format_FE, ZWJ. -// Rule: Never break between consecutive runes of this category. -// -// 2) Mid: -// MidLetter, MidNumLet, Single_Quote. -// (Cf. case-ignorable: MidLetter, MidNumLet, Single_Quote or cat is Mn, -// Me, Cf, Lm or Sk). -// Rule: Don't break between Letter and Mid, but break between two Mids. -// -// 3) Break: -// Any other category: NewLine, MidNum, CR, LF, Double_Quote, Katakana, and -// Other. -// These categories should always result in a break between two cased letters. -// Rule: Always break. -// -// Note 1: the Katakana and MidNum categories can, in esoteric cases, result in -// preventing a break between two cased letters. For now we will ignore this -// (e.g. [ALetter] [ExtendNumLet] [Katakana] [ExtendNumLet] [ALetter] and -// [ALetter] [Numeric] [MidNum] [Numeric] [ALetter].) -// -// Note 2: the rule for Mid is very approximate, but works in most cases. To -// improve, we could store the categories in the trie value and use a FA to -// manage breaks. See TODO comment above. -// -// Note 3: according to the spec, it is possible for the Extend category to -// introduce breaks between other categories grouped in Letter. However, this -// is undesirable for our purposes. ICU prevents breaks in such cases as well. - -// isBreak returns whether this rune should introduce a break. -func (c info) isBreak() bool { - return c.cccVal() == cccBreak -} - -// isLetter returns whether the rune is of break type ALetter, Hebrew_Letter, -// Numeric, ExtendNumLet, or Extend. -func (c info) isLetter() bool { - ccc := c.cccVal() - if ccc == cccZero { - return !c.isCaseIgnorable() - } - return ccc != cccBreak -} diff --git a/vendor/golang.org/x/text/cases/map.go b/vendor/golang.org/x/text/cases/map.go deleted file mode 100644 index 4baebaaa..00000000 --- a/vendor/golang.org/x/text/cases/map.go +++ /dev/null @@ -1,816 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package cases - -// This file contains the definitions of case mappings for all supported -// languages. The rules for the language-specific tailorings were taken and -// modified from the CLDR transform definitions in common/transforms. - -import ( - "strings" - "unicode" - "unicode/utf8" - - "golang.org/x/text/internal" - "golang.org/x/text/language" - "golang.org/x/text/transform" - "golang.org/x/text/unicode/norm" -) - -// A mapFunc takes a context set to the current rune and writes the mapped -// version to the same context. It may advance the context to the next rune. It -// returns whether a checkpoint is possible: whether the pDst bytes written to -// dst so far won't need changing as we see more source bytes. -type mapFunc func(*context) bool - -// A spanFunc takes a context set to the current rune and returns whether this -// rune would be altered when written to the output. It may advance the context -// to the next rune. It returns whether a checkpoint is possible. -type spanFunc func(*context) bool - -// maxIgnorable defines the maximum number of ignorables to consider for -// lookahead operations. -const maxIgnorable = 30 - -// supported lists the language tags for which we have tailorings. -const supported = "und af az el lt nl tr" - -func init() { - tags := []language.Tag{} - for _, s := range strings.Split(supported, " ") { - tags = append(tags, language.MustParse(s)) - } - matcher = internal.NewInheritanceMatcher(tags) - Supported = language.NewCoverage(tags) -} - -var ( - matcher *internal.InheritanceMatcher - - Supported language.Coverage - - // We keep the following lists separate, instead of having a single per- - // language struct, to give the compiler a chance to remove unused code. - - // Some uppercase mappers are stateless, so we can precompute the - // Transformers and save a bit on runtime allocations. - upperFunc = []struct { - upper mapFunc - span spanFunc - }{ - {nil, nil}, // und - {nil, nil}, // af - {aztrUpper(upper), isUpper}, // az - {elUpper, noSpan}, // el - {ltUpper(upper), noSpan}, // lt - {nil, nil}, // nl - {aztrUpper(upper), isUpper}, // tr - } - - undUpper transform.SpanningTransformer = &undUpperCaser{} - undLower transform.SpanningTransformer = &undLowerCaser{} - undLowerIgnoreSigma transform.SpanningTransformer = &undLowerIgnoreSigmaCaser{} - - lowerFunc = []mapFunc{ - nil, // und - nil, // af - aztrLower, // az - nil, // el - ltLower, // lt - nil, // nl - aztrLower, // tr - } - - titleInfos = []struct { - title mapFunc - lower mapFunc - titleSpan spanFunc - rewrite func(*context) - }{ - {title, lower, isTitle, nil}, // und - {title, lower, isTitle, afnlRewrite}, // af - {aztrUpper(title), aztrLower, isTitle, nil}, // az - {title, lower, isTitle, nil}, // el - {ltUpper(title), ltLower, noSpan, nil}, // lt - {nlTitle, lower, nlTitleSpan, afnlRewrite}, // nl - {aztrUpper(title), aztrLower, isTitle, nil}, // tr - } -) - -func makeUpper(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - f := upperFunc[i].upper - if f == nil { - return undUpper - } - return &simpleCaser{f: f, span: upperFunc[i].span} -} - -func makeLower(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - f := lowerFunc[i] - if f == nil { - if o.ignoreFinalSigma { - return undLowerIgnoreSigma - } - return undLower - } - if o.ignoreFinalSigma { - return &simpleCaser{f: f, span: isLower} - } - return &lowerCaser{ - first: f, - midWord: finalSigma(f), - } -} - -func makeTitle(t language.Tag, o options) transform.SpanningTransformer { - _, i, _ := matcher.Match(t) - x := &titleInfos[i] - lower := x.lower - if o.noLower { - lower = (*context).copy - } else if !o.ignoreFinalSigma { - lower = finalSigma(lower) - } - return &titleCaser{ - title: x.title, - lower: lower, - titleSpan: x.titleSpan, - rewrite: x.rewrite, - } -} - -func noSpan(c *context) bool { - c.err = transform.ErrEndOfSpan - return false -} - -// TODO: consider a similar special case for the fast majority lower case. This -// is a bit more involved so will require some more precise benchmarking to -// justify it. - -type undUpperCaser struct{ transform.NopResetter } - -// undUpperCaser implements the Transformer interface for doing an upper case -// mapping for the root locale (und). It eliminates the need for an allocation -// as it prevents escaping by not using function pointers. -func (t undUpperCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() { - upper(&c) - c.checkpoint() - } - return c.ret() -} - -func (t undUpperCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isUpper(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// undLowerIgnoreSigmaCaser implements the Transformer interface for doing -// a lower case mapping for the root locale (und) ignoring final sigma -// handling. This casing algorithm is used in some performance-critical packages -// like secure/precis and x/net/http/idna, which warrants its special-casing. -type undLowerIgnoreSigmaCaser struct{ transform.NopResetter } - -func (t undLowerIgnoreSigmaCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() && lower(&c) { - c.checkpoint() - } - return c.ret() - -} - -// Span implements a generic lower-casing. This is possible as isLower works -// for all lowercasing variants. All lowercase variants only vary in how they -// transform a non-lowercase letter. They will never change an already lowercase -// letter. In addition, there is no state. -func (t undLowerIgnoreSigmaCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isLower(&c) { - c.checkpoint() - } - return c.retSpan() -} - -type simpleCaser struct { - context - f mapFunc - span spanFunc -} - -// simpleCaser implements the Transformer interface for doing a case operation -// on a rune-by-rune basis. -func (t *simpleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - for c.next() && t.f(&c) { - c.checkpoint() - } - return c.ret() -} - -func (t *simpleCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && t.span(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// undLowerCaser implements the Transformer interface for doing a lower case -// mapping for the root locale (und) ignoring final sigma handling. This casing -// algorithm is used in some performance-critical packages like secure/precis -// and x/net/http/idna, which warrants its special-casing. -type undLowerCaser struct{ transform.NopResetter } - -func (t undLowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - c := context{dst: dst, src: src, atEOF: atEOF} - - for isInterWord := true; c.next(); { - if isInterWord { - if c.info.isCased() { - if !lower(&c) { - break - } - isInterWord = false - } else if !c.copy() { - break - } - } else { - if c.info.isNotCasedAndNotCaseIgnorable() { - if !c.copy() { - break - } - isInterWord = true - } else if !c.hasPrefix("Σ") { - if !lower(&c) { - break - } - } else if !finalSigmaBody(&c) { - break - } - } - c.checkpoint() - } - return c.ret() -} - -func (t undLowerCaser) Span(src []byte, atEOF bool) (n int, err error) { - c := context{src: src, atEOF: atEOF} - for c.next() && isLower(&c) { - c.checkpoint() - } - return c.retSpan() -} - -// lowerCaser implements the Transformer interface. The default Unicode lower -// casing requires different treatment for the first and subsequent characters -// of a word, most notably to handle the Greek final Sigma. -type lowerCaser struct { - undLowerIgnoreSigmaCaser - - context - - first, midWord mapFunc -} - -func (t *lowerCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF} - c := &t.context - - for isInterWord := true; c.next(); { - if isInterWord { - if c.info.isCased() { - if !t.first(c) { - break - } - isInterWord = false - } else if !c.copy() { - break - } - } else { - if c.info.isNotCasedAndNotCaseIgnorable() { - if !c.copy() { - break - } - isInterWord = true - } else if !t.midWord(c) { - break - } - } - c.checkpoint() - } - return c.ret() -} - -// titleCaser implements the Transformer interface. Title casing algorithms -// distinguish between the first letter of a word and subsequent letters of the -// same word. It uses state to avoid requiring a potentially infinite lookahead. -type titleCaser struct { - context - - // rune mappings used by the actual casing algorithms. - title mapFunc - lower mapFunc - titleSpan spanFunc - - rewrite func(*context) -} - -// Transform implements the standard Unicode title case algorithm as defined in -// Chapter 3 of The Unicode Standard: -// toTitlecase(X): Find the word boundaries in X according to Unicode Standard -// Annex #29, "Unicode Text Segmentation." For each word boundary, find the -// first cased character F following the word boundary. If F exists, map F to -// Titlecase_Mapping(F); then map all characters C between F and the following -// word boundary to Lowercase_Mapping(C). -func (t *titleCaser) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - t.context = context{dst: dst, src: src, atEOF: atEOF, isMidWord: t.isMidWord} - c := &t.context - - if !c.next() { - return c.ret() - } - - for { - p := c.info - if t.rewrite != nil { - t.rewrite(c) - } - - wasMid := p.isMid() - // Break out of this loop on failure to ensure we do not modify the - // state incorrectly. - if p.isCased() { - if !c.isMidWord { - if !t.title(c) { - break - } - c.isMidWord = true - } else if !t.lower(c) { - break - } - } else if !c.copy() { - break - } else if p.isBreak() { - c.isMidWord = false - } - - // As we save the state of the transformer, it is safe to call - // checkpoint after any successful write. - if !(c.isMidWord && wasMid) { - c.checkpoint() - } - - if !c.next() { - break - } - if wasMid && c.info.isMid() { - c.isMidWord = false - } - } - return c.ret() -} - -func (t *titleCaser) Span(src []byte, atEOF bool) (n int, err error) { - t.context = context{src: src, atEOF: atEOF, isMidWord: t.isMidWord} - c := &t.context - - if !c.next() { - return c.retSpan() - } - - for { - p := c.info - if t.rewrite != nil { - t.rewrite(c) - } - - wasMid := p.isMid() - // Break out of this loop on failure to ensure we do not modify the - // state incorrectly. - if p.isCased() { - if !c.isMidWord { - if !t.titleSpan(c) { - break - } - c.isMidWord = true - } else if !isLower(c) { - break - } - } else if p.isBreak() { - c.isMidWord = false - } - // As we save the state of the transformer, it is safe to call - // checkpoint after any successful write. - if !(c.isMidWord && wasMid) { - c.checkpoint() - } - - if !c.next() { - break - } - if wasMid && c.info.isMid() { - c.isMidWord = false - } - } - return c.retSpan() -} - -// finalSigma adds Greek final Sigma handing to another casing function. It -// determines whether a lowercased sigma should be σ or ς, by looking ahead for -// case-ignorables and a cased letters. -func finalSigma(f mapFunc) mapFunc { - return func(c *context) bool { - if !c.hasPrefix("Σ") { - return f(c) - } - return finalSigmaBody(c) - } -} - -func finalSigmaBody(c *context) bool { - // Current rune must be ∑. - - // ::NFD(); - // # 03A3; 03C2; 03A3; 03A3; Final_Sigma; # GREEK CAPITAL LETTER SIGMA - // Σ } [:case-ignorable:]* [:cased:] → σ; - // [:cased:] [:case-ignorable:]* { Σ → ς; - // ::Any-Lower; - // ::NFC(); - - p := c.pDst - c.writeString("ς") - - // TODO: we should do this here, but right now this will never have an - // effect as this is called when the prefix is Sigma, whereas Dutch and - // Afrikaans only test for an apostrophe. - // - // if t.rewrite != nil { - // t.rewrite(c) - // } - - // We need to do one more iteration after maxIgnorable, as a cased - // letter is not an ignorable and may modify the result. - wasMid := false - for i := 0; i < maxIgnorable+1; i++ { - if !c.next() { - return false - } - if !c.info.isCaseIgnorable() { - // All Midword runes are also case ignorable, so we are - // guaranteed to have a letter or word break here. As we are - // unreading the run, there is no need to unset c.isMidWord; - // the title caser will handle this. - if c.info.isCased() { - // p+1 is guaranteed to be in bounds: if writing ς was - // successful, p+1 will contain the second byte of ς. If not, - // this function will have returned after c.next returned false. - c.dst[p+1]++ // ς → σ - } - c.unreadRune() - return true - } - // A case ignorable may also introduce a word break, so we may need - // to continue searching even after detecting a break. - isMid := c.info.isMid() - if (wasMid && isMid) || c.info.isBreak() { - c.isMidWord = false - } - wasMid = isMid - c.copy() - } - return true -} - -// finalSigmaSpan would be the same as isLower. - -// elUpper implements Greek upper casing, which entails removing a predefined -// set of non-blocked modifiers. Note that these accents should not be removed -// for title casing! -// Example: "Οδός" -> "ΟΔΟΣ". -func elUpper(c *context) bool { - // From CLDR: - // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Above:]]*? { [\u0313\u0314\u0301\u0300\u0306\u0342\u0308\u0304] → ; - // [:Greek:] [^[:ccc=Not_Reordered:][:ccc=Iota_Subscript:]]*? { \u0345 → ; - - r, _ := utf8.DecodeRune(c.src[c.pSrc:]) - oldPDst := c.pDst - if !upper(c) { - return false - } - if !unicode.Is(unicode.Greek, r) { - return true - } - i := 0 - // Take the properties of the uppercased rune that is already written to the - // destination. This saves us the trouble of having to uppercase the - // decomposed rune again. - if b := norm.NFD.Properties(c.dst[oldPDst:]).Decomposition(); b != nil { - // Restore the destination position and process the decomposed rune. - r, sz := utf8.DecodeRune(b) - if r <= 0xFF { // See A.6.1 - return true - } - c.pDst = oldPDst - // Insert the first rune and ignore the modifiers. See A.6.2. - c.writeBytes(b[:sz]) - i = len(b[sz:]) / 2 // Greek modifiers are always of length 2. - } - - for ; i < maxIgnorable && c.next(); i++ { - switch r, _ := utf8.DecodeRune(c.src[c.pSrc:]); r { - // Above and Iota Subscript - case 0x0300, // U+0300 COMBINING GRAVE ACCENT - 0x0301, // U+0301 COMBINING ACUTE ACCENT - 0x0304, // U+0304 COMBINING MACRON - 0x0306, // U+0306 COMBINING BREVE - 0x0308, // U+0308 COMBINING DIAERESIS - 0x0313, // U+0313 COMBINING COMMA ABOVE - 0x0314, // U+0314 COMBINING REVERSED COMMA ABOVE - 0x0342, // U+0342 COMBINING GREEK PERISPOMENI - 0x0345: // U+0345 COMBINING GREEK YPOGEGRAMMENI - // No-op. Gobble the modifier. - - default: - switch v, _ := trie.lookup(c.src[c.pSrc:]); info(v).cccType() { - case cccZero: - c.unreadRune() - return true - - // We don't need to test for IotaSubscript as the only rune that - // qualifies (U+0345) was already excluded in the switch statement - // above. See A.4. - - case cccAbove: - return c.copy() - default: - // Some other modifier. We're still allowed to gobble Greek - // modifiers after this. - c.copy() - } - } - } - return i == maxIgnorable -} - -// TODO: implement elUpperSpan (low-priority: complex and infrequent). - -func ltLower(c *context) bool { - // From CLDR: - // # Introduce an explicit dot above when lowercasing capital I's and J's - // # whenever there are more accents above. - // # (of the accents used in Lithuanian: grave, acute, tilde above, and ogonek) - // # 0049; 0069 0307; 0049; 0049; lt More_Above; # LATIN CAPITAL LETTER I - // # 004A; 006A 0307; 004A; 004A; lt More_Above; # LATIN CAPITAL LETTER J - // # 012E; 012F 0307; 012E; 012E; lt More_Above; # LATIN CAPITAL LETTER I WITH OGONEK - // # 00CC; 0069 0307 0300; 00CC; 00CC; lt; # LATIN CAPITAL LETTER I WITH GRAVE - // # 00CD; 0069 0307 0301; 00CD; 00CD; lt; # LATIN CAPITAL LETTER I WITH ACUTE - // # 0128; 0069 0307 0303; 0128; 0128; lt; # LATIN CAPITAL LETTER I WITH TILDE - // ::NFD(); - // I } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0307; - // J } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → j \u0307; - // I \u0328 (Į) } [^[:ccc=Not_Reordered:][:ccc=Above:]]* [:ccc=Above:] → i \u0328 \u0307; - // I \u0300 (Ì) → i \u0307 \u0300; - // I \u0301 (Í) → i \u0307 \u0301; - // I \u0303 (Ĩ) → i \u0307 \u0303; - // ::Any-Lower(); - // ::NFC(); - - i := 0 - if r := c.src[c.pSrc]; r < utf8.RuneSelf { - lower(c) - if r != 'I' && r != 'J' { - return true - } - } else { - p := norm.NFD.Properties(c.src[c.pSrc:]) - if d := p.Decomposition(); len(d) >= 3 && (d[0] == 'I' || d[0] == 'J') { - // UTF-8 optimization: the decomposition will only have an above - // modifier if the last rune of the decomposition is in [U+300-U+311]. - // In all other cases, a decomposition starting with I is always - // an I followed by modifiers that are not cased themselves. See A.2. - if d[1] == 0xCC && d[2] <= 0x91 { // A.2.4. - if !c.writeBytes(d[:1]) { - return false - } - c.dst[c.pDst-1] += 'a' - 'A' // lower - - // Assumption: modifier never changes on lowercase. See A.1. - // Assumption: all modifiers added have CCC = Above. See A.2.3. - return c.writeString("\u0307") && c.writeBytes(d[1:]) - } - // In all other cases the additional modifiers will have a CCC - // that is less than 230 (Above). We will insert the U+0307, if - // needed, after these modifiers so that a string in FCD form - // will remain so. See A.2.2. - lower(c) - i = 1 - } else { - return lower(c) - } - } - - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccZero: - c.unreadRune() - return true - case cccAbove: - return c.writeString("\u0307") && c.copy() // See A.1. - default: - c.copy() // See A.1. - } - } - return i == maxIgnorable -} - -// ltLowerSpan would be the same as isLower. - -func ltUpper(f mapFunc) mapFunc { - return func(c *context) bool { - // Unicode: - // 0307; 0307; ; ; lt After_Soft_Dotted; # COMBINING DOT ABOVE - // - // From CLDR: - // # Remove \u0307 following soft-dotteds (i, j, and the like), with possible - // # intervening non-230 marks. - // ::NFD(); - // [:Soft_Dotted:] [^[:ccc=Not_Reordered:][:ccc=Above:]]* { \u0307 → ; - // ::Any-Upper(); - // ::NFC(); - - // TODO: See A.5. A soft-dotted rune never has an exception. This would - // allow us to overload the exception bit and encode this property in - // info. Need to measure performance impact of this. - r, _ := utf8.DecodeRune(c.src[c.pSrc:]) - oldPDst := c.pDst - if !f(c) { - return false - } - if !unicode.Is(unicode.Soft_Dotted, r) { - return true - } - - // We don't need to do an NFD normalization, as a soft-dotted rune never - // contains U+0307. See A.3. - - i := 0 - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccZero: - c.unreadRune() - return true - case cccAbove: - if c.hasPrefix("\u0307") { - // We don't do a full NFC, but rather combine runes for - // some of the common cases. (Returning NFC or - // preserving normal form is neither a requirement nor - // a possibility anyway). - if !c.next() { - return false - } - if c.dst[oldPDst] == 'I' && c.pDst == oldPDst+1 && c.src[c.pSrc] == 0xcc { - s := "" - switch c.src[c.pSrc+1] { - case 0x80: // U+0300 COMBINING GRAVE ACCENT - s = "\u00cc" // U+00CC LATIN CAPITAL LETTER I WITH GRAVE - case 0x81: // U+0301 COMBINING ACUTE ACCENT - s = "\u00cd" // U+00CD LATIN CAPITAL LETTER I WITH ACUTE - case 0x83: // U+0303 COMBINING TILDE - s = "\u0128" // U+0128 LATIN CAPITAL LETTER I WITH TILDE - case 0x88: // U+0308 COMBINING DIAERESIS - s = "\u00cf" // U+00CF LATIN CAPITAL LETTER I WITH DIAERESIS - default: - } - if s != "" { - c.pDst = oldPDst - return c.writeString(s) - } - } - } - return c.copy() - default: - c.copy() - } - } - return i == maxIgnorable - } -} - -// TODO: implement ltUpperSpan (low priority: complex and infrequent). - -func aztrUpper(f mapFunc) mapFunc { - return func(c *context) bool { - // i→İ; - if c.src[c.pSrc] == 'i' { - return c.writeString("İ") - } - return f(c) - } -} - -func aztrLower(c *context) (done bool) { - // From CLDR: - // # I and i-dotless; I-dot and i are case pairs in Turkish and Azeri - // # 0130; 0069; 0130; 0130; tr; # LATIN CAPITAL LETTER I WITH DOT ABOVE - // İ→i; - // # When lowercasing, remove dot_above in the sequence I + dot_above, which will turn into i. - // # This matches the behavior of the canonically equivalent I-dot_above - // # 0307; ; 0307; 0307; tr After_I; # COMBINING DOT ABOVE - // # When lowercasing, unless an I is before a dot_above, it turns into a dotless i. - // # 0049; 0131; 0049; 0049; tr Not_Before_Dot; # LATIN CAPITAL LETTER I - // I([^[:ccc=Not_Reordered:][:ccc=Above:]]*)\u0307 → i$1 ; - // I→ı ; - // ::Any-Lower(); - if c.hasPrefix("\u0130") { // İ - return c.writeString("i") - } - if c.src[c.pSrc] != 'I' { - return lower(c) - } - - // We ignore the lower-case I for now, but insert it later when we know - // which form we need. - start := c.pSrc + c.sz - - i := 0 -Loop: - // We check for up to n ignorables before \u0307. As \u0307 is an - // ignorable as well, n is maxIgnorable-1. - for ; i < maxIgnorable && c.next(); i++ { - switch c.info.cccType() { - case cccAbove: - if c.hasPrefix("\u0307") { - return c.writeString("i") && c.writeBytes(c.src[start:c.pSrc]) // ignore U+0307 - } - done = true - break Loop - case cccZero: - c.unreadRune() - done = true - break Loop - default: - // We'll write this rune after we know which starter to use. - } - } - if i == maxIgnorable { - done = true - } - return c.writeString("ı") && c.writeBytes(c.src[start:c.pSrc+c.sz]) && done -} - -// aztrLowerSpan would be the same as isLower. - -func nlTitle(c *context) bool { - // From CLDR: - // # Special titlecasing for Dutch initial "ij". - // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) - // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; - if c.src[c.pSrc] != 'I' && c.src[c.pSrc] != 'i' { - return title(c) - } - - if !c.writeString("I") || !c.next() { - return false - } - if c.src[c.pSrc] == 'j' || c.src[c.pSrc] == 'J' { - return c.writeString("J") - } - c.unreadRune() - return true -} - -func nlTitleSpan(c *context) bool { - // From CLDR: - // # Special titlecasing for Dutch initial "ij". - // ::Any-Title(); - // # Fix up Ij at the beginning of a "word" (per Any-Title, notUAX #29) - // [:^WB=ALetter:] [:WB=Extend:]* [[:WB=MidLetter:][:WB=MidNumLet:]]? { Ij } → IJ ; - if c.src[c.pSrc] != 'I' { - return isTitle(c) - } - if !c.next() || c.src[c.pSrc] == 'j' { - return false - } - if c.src[c.pSrc] != 'J' { - c.unreadRune() - } - return true -} - -// Not part of CLDR, but see http://unicode.org/cldr/trac/ticket/7078. -func afnlRewrite(c *context) { - if c.hasPrefix("'") || c.hasPrefix("’") { - c.isMidWord = true - } -} diff --git a/vendor/golang.org/x/text/cases/tables.go b/vendor/golang.org/x/text/cases/tables.go deleted file mode 100644 index e6e95a68..00000000 --- a/vendor/golang.org/x/text/cases/tables.go +++ /dev/null @@ -1,2211 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package cases - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "9.0.0" - -var xorData string = "" + // Size: 185 bytes - "\x00\x06\x07\x00\x01?\x00\x0f\x03\x00\x0f\x12\x00\x0f\x1f\x00\x0f\x1d" + - "\x00\x01\x13\x00\x0f\x16\x00\x0f\x0b\x00\x0f3\x00\x0f7\x00\x01#\x00\x0f?" + - "\x00\x0e'\x00\x0f/\x00\x0e>\x00\x0f*\x00\x0c&\x00\x0c*\x00\x0c;\x00\x0c9" + - "\x00\x0c%\x00\x01\x08\x00\x03\x0d\x00\x03\x09\x00\x02\x06\x00\x02\x02" + - "\x00\x02\x0c\x00\x01\x00\x00\x01\x03\x00\x01\x01\x00\x01 \x00\x01\x0c" + - "\x00\x01\x10\x00\x03\x10\x00\x036 \x00\x037 \x00\x0b#\x10\x00\x0b 0\x00" + - "\x0b!\x10\x00\x0b!0\x00\x0b(\x04\x00\x03\x04\x1e\x00\x03\x0a\x00\x02:" + - "\x00\x02>\x00\x02,\x00\x02\x00\x00\x02\x10\x00\x01<\x00\x01&\x00\x01*" + - "\x00\x01.\x00\x010\x003 \x00\x01\x18\x00\x01(\x00\x01\x1e\x00\x01\x22" - -var exceptions string = "" + // Size: 1852 bytes - "\x00\x12\x10μΜ\x12\x12ssSSSs\x13\x18i̇i̇\x10\x08I\x13\x18ʼnʼN\x11\x08sS" + - "\x12\x12dždžDž\x12\x12dždžDŽ\x10\x12DŽDž\x12\x12ljljLj\x12\x12ljljLJ\x10\x12LJLj\x12\x12" + - "njnjNj\x12\x12njnjNJ\x10\x12NJNj\x13\x18ǰJ̌\x12\x12dzdzDz\x12\x12dzdzDZ\x10\x12DZDz" + - "\x13\x18ⱥⱥ\x13\x18ⱦⱦ\x10\x18Ȿ\x10\x18Ɀ\x10\x18Ɐ\x10\x18Ɑ\x10\x18Ɒ\x10" + - "\x18Ɜ\x10\x18Ɡ\x10\x18Ɥ\x10\x18Ɦ\x10\x18Ɪ\x10\x18Ɫ\x10\x18Ɬ\x10\x18Ɱ\x10" + - "\x18Ɽ\x10\x18Ʇ\x10\x18Ʝ\x10\x18Ʞ2\x10ιΙ\x160ΐΪ́\x160ΰΫ́\x12\x10σΣ" + - "\x12\x10βΒ\x12\x10θΘ\x12\x10φΦ\x12\x10πΠ\x12\x10κΚ\x12\x10ρΡ\x12\x10εΕ" + - "\x14$եւԵՒԵւ\x12\x10вВ\x12\x10дД\x12\x10оО\x12\x10сС\x12\x10тТ\x12\x10тТ" + - "\x12\x10ъЪ\x12\x10ѣѢ\x13\x18ꙋꙊ\x13\x18ẖH̱\x13\x18ẗT̈\x13\x18ẘW̊\x13" + - "\x18ẙY̊\x13\x18aʾAʾ\x13\x18ṡṠ\x12\x10ssß\x14 ὐΥ̓\x160ὒΥ̓̀\x160ὔΥ̓́" + - "\x160ὖΥ̓͂\x15+ἀιἈΙᾈ\x15+ἁιἉΙᾉ\x15+ἂιἊΙᾊ\x15+ἃιἋΙᾋ\x15+ἄιἌΙᾌ\x15+ἅιἍΙᾍ" + - "\x15+ἆιἎΙᾎ\x15+ἇιἏΙᾏ\x15\x1dἀιᾀἈΙ\x15\x1dἁιᾁἉΙ\x15\x1dἂιᾂἊΙ\x15\x1dἃιᾃἋΙ" + - "\x15\x1dἄιᾄἌΙ\x15\x1dἅιᾅἍΙ\x15\x1dἆιᾆἎΙ\x15\x1dἇιᾇἏΙ\x15+ἠιἨΙᾘ\x15+ἡιἩΙᾙ" + - "\x15+ἢιἪΙᾚ\x15+ἣιἫΙᾛ\x15+ἤιἬΙᾜ\x15+ἥιἭΙᾝ\x15+ἦιἮΙᾞ\x15+ἧιἯΙᾟ\x15\x1dἠιᾐἨ" + - "Ι\x15\x1dἡιᾑἩΙ\x15\x1dἢιᾒἪΙ\x15\x1dἣιᾓἫΙ\x15\x1dἤιᾔἬΙ\x15\x1dἥιᾕἭΙ\x15" + - "\x1dἦιᾖἮΙ\x15\x1dἧιᾗἯΙ\x15+ὠιὨΙᾨ\x15+ὡιὩΙᾩ\x15+ὢιὪΙᾪ\x15+ὣιὫΙᾫ\x15+ὤιὬΙᾬ" + - "\x15+ὥιὭΙᾭ\x15+ὦιὮΙᾮ\x15+ὧιὯΙᾯ\x15\x1dὠιᾠὨΙ\x15\x1dὡιᾡὩΙ\x15\x1dὢιᾢὪΙ" + - "\x15\x1dὣιᾣὫΙ\x15\x1dὤιᾤὬΙ\x15\x1dὥιᾥὭΙ\x15\x1dὦιᾦὮΙ\x15\x1dὧιᾧὯΙ\x15-ὰι" + - "ᾺΙᾺͅ\x14#αιΑΙᾼ\x14$άιΆΙΆͅ\x14 ᾶΑ͂\x166ᾶιΑ͂Ιᾼ͂\x14\x1cαιᾳΑΙ\x12\x10ι" + - "Ι\x15-ὴιῊΙῊͅ\x14#ηιΗΙῌ\x14$ήιΉΙΉͅ\x14 ῆΗ͂\x166ῆιΗ͂Ιῌ͂\x14\x1cηιῃΗΙ" + - "\x160ῒΪ̀\x160ΐΪ́\x14 ῖΙ͂\x160ῗΪ͂\x160ῢΫ̀\x160ΰΫ́\x14 ῤΡ" + - "̓\x14 ῦΥ͂\x160ῧΫ͂\x15-ὼιῺΙῺͅ\x14#ωιΩΙῼ\x14$ώιΏΙΏͅ\x14 ῶΩ͂\x166ῶιΩ" + - "͂Ιῼ͂\x14\x1cωιῳΩΙ\x12\x10ωω\x11\x08kk\x12\x10åå\x12\x10ɫɫ\x12\x10ɽɽ" + - "\x10\x10Ⱥ\x10\x10Ⱦ\x12\x10ɑɑ\x12\x10ɱɱ\x12\x10ɐɐ\x12\x10ɒɒ\x12\x10ȿȿ\x12" + - "\x10ɀɀ\x12\x10ɥɥ\x12\x10ɦɦ\x12\x10ɜɜ\x12\x10ɡɡ\x12\x10ɬɬ\x12\x10ɪɪ\x12" + - "\x10ʞʞ\x12\x10ʇʇ\x12\x10ʝʝ\x12\x12ffFFFf\x12\x12fiFIFi\x12\x12flFLFl\x13" + - "\x1bffiFFIFfi\x13\x1bfflFFLFfl\x12\x12stSTSt\x12\x12stSTSt\x14$մնՄՆՄն" + - "\x14$մեՄԵՄե\x14$միՄԻՄի\x14$վնՎՆՎն\x14$մխՄԽՄխ" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *caseTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return caseValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := caseIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = caseIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = caseIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *caseTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return caseValues[c0] - } - i := caseIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = caseIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = caseIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// caseTrie. Total size: 11742 bytes (11.47 KiB). Checksum: 147a11466b427436. -type caseTrie struct{} - -func newCaseTrie(i int) *caseTrie { - return &caseTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *caseTrie) lookupValue(n uint32, b byte) uint16 { - switch { - case n < 18: - return uint16(caseValues[n<<6+uint32(b)]) - default: - n -= 18 - return uint16(sparse.lookup(n, b)) - } -} - -// caseValues: 20 blocks, 1280 entries, 2560 bytes -// The third block is the zero block. -var caseValues = [1280]uint16{ - // Block 0x0, offset 0x0 - 0x27: 0x0054, - 0x2e: 0x0054, - 0x30: 0x0010, 0x31: 0x0010, 0x32: 0x0010, 0x33: 0x0010, 0x34: 0x0010, 0x35: 0x0010, - 0x36: 0x0010, 0x37: 0x0010, 0x38: 0x0010, 0x39: 0x0010, 0x3a: 0x0054, - // Block 0x1, offset 0x40 - 0x41: 0x2013, 0x42: 0x2013, 0x43: 0x2013, 0x44: 0x2013, 0x45: 0x2013, - 0x46: 0x2013, 0x47: 0x2013, 0x48: 0x2013, 0x49: 0x2013, 0x4a: 0x2013, 0x4b: 0x2013, - 0x4c: 0x2013, 0x4d: 0x2013, 0x4e: 0x2013, 0x4f: 0x2013, 0x50: 0x2013, 0x51: 0x2013, - 0x52: 0x2013, 0x53: 0x2013, 0x54: 0x2013, 0x55: 0x2013, 0x56: 0x2013, 0x57: 0x2013, - 0x58: 0x2013, 0x59: 0x2013, 0x5a: 0x2013, - 0x5e: 0x0004, 0x5f: 0x0010, 0x60: 0x0004, 0x61: 0x2012, 0x62: 0x2012, 0x63: 0x2012, - 0x64: 0x2012, 0x65: 0x2012, 0x66: 0x2012, 0x67: 0x2012, 0x68: 0x2012, 0x69: 0x2012, - 0x6a: 0x2012, 0x6b: 0x2012, 0x6c: 0x2012, 0x6d: 0x2012, 0x6e: 0x2012, 0x6f: 0x2012, - 0x70: 0x2012, 0x71: 0x2012, 0x72: 0x2012, 0x73: 0x2012, 0x74: 0x2012, 0x75: 0x2012, - 0x76: 0x2012, 0x77: 0x2012, 0x78: 0x2012, 0x79: 0x2012, 0x7a: 0x2012, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0852, 0xc1: 0x0b53, 0xc2: 0x0113, 0xc3: 0x0112, 0xc4: 0x0113, 0xc5: 0x0112, - 0xc6: 0x0b53, 0xc7: 0x0f13, 0xc8: 0x0f12, 0xc9: 0x0e53, 0xca: 0x1153, 0xcb: 0x0713, - 0xcc: 0x0712, 0xcd: 0x0012, 0xce: 0x1453, 0xcf: 0x1753, 0xd0: 0x1a53, 0xd1: 0x0313, - 0xd2: 0x0312, 0xd3: 0x1d53, 0xd4: 0x2053, 0xd5: 0x2352, 0xd6: 0x2653, 0xd7: 0x2653, - 0xd8: 0x0113, 0xd9: 0x0112, 0xda: 0x2952, 0xdb: 0x0012, 0xdc: 0x1d53, 0xdd: 0x2c53, - 0xde: 0x2f52, 0xdf: 0x3253, 0xe0: 0x0113, 0xe1: 0x0112, 0xe2: 0x0113, 0xe3: 0x0112, - 0xe4: 0x0113, 0xe5: 0x0112, 0xe6: 0x3553, 0xe7: 0x0f13, 0xe8: 0x0f12, 0xe9: 0x3853, - 0xea: 0x0012, 0xeb: 0x0012, 0xec: 0x0113, 0xed: 0x0112, 0xee: 0x3553, 0xef: 0x1f13, - 0xf0: 0x1f12, 0xf1: 0x3b53, 0xf2: 0x3e53, 0xf3: 0x0713, 0xf4: 0x0712, 0xf5: 0x0313, - 0xf6: 0x0312, 0xf7: 0x4153, 0xf8: 0x0113, 0xf9: 0x0112, 0xfa: 0x0012, 0xfb: 0x0010, - 0xfc: 0x0113, 0xfd: 0x0112, 0xfe: 0x0012, 0xff: 0x4452, - // Block 0x4, offset 0x100 - 0x100: 0x0010, 0x101: 0x0010, 0x102: 0x0010, 0x103: 0x0010, 0x104: 0x04cb, 0x105: 0x05c9, - 0x106: 0x06ca, 0x107: 0x078b, 0x108: 0x0889, 0x109: 0x098a, 0x10a: 0x0a4b, 0x10b: 0x0b49, - 0x10c: 0x0c4a, 0x10d: 0x0313, 0x10e: 0x0312, 0x10f: 0x1f13, 0x110: 0x1f12, 0x111: 0x0313, - 0x112: 0x0312, 0x113: 0x0713, 0x114: 0x0712, 0x115: 0x0313, 0x116: 0x0312, 0x117: 0x0f13, - 0x118: 0x0f12, 0x119: 0x0313, 0x11a: 0x0312, 0x11b: 0x0713, 0x11c: 0x0712, 0x11d: 0x1452, - 0x11e: 0x0113, 0x11f: 0x0112, 0x120: 0x0113, 0x121: 0x0112, 0x122: 0x0113, 0x123: 0x0112, - 0x124: 0x0113, 0x125: 0x0112, 0x126: 0x0113, 0x127: 0x0112, 0x128: 0x0113, 0x129: 0x0112, - 0x12a: 0x0113, 0x12b: 0x0112, 0x12c: 0x0113, 0x12d: 0x0112, 0x12e: 0x0113, 0x12f: 0x0112, - 0x130: 0x0d0a, 0x131: 0x0e0b, 0x132: 0x0f09, 0x133: 0x100a, 0x134: 0x0113, 0x135: 0x0112, - 0x136: 0x2353, 0x137: 0x4453, 0x138: 0x0113, 0x139: 0x0112, 0x13a: 0x0113, 0x13b: 0x0112, - 0x13c: 0x0113, 0x13d: 0x0112, 0x13e: 0x0113, 0x13f: 0x0112, - // Block 0x5, offset 0x140 - 0x140: 0x136a, 0x141: 0x0313, 0x142: 0x0312, 0x143: 0x0853, 0x144: 0x4753, 0x145: 0x4a53, - 0x146: 0x0113, 0x147: 0x0112, 0x148: 0x0113, 0x149: 0x0112, 0x14a: 0x0113, 0x14b: 0x0112, - 0x14c: 0x0113, 0x14d: 0x0112, 0x14e: 0x0113, 0x14f: 0x0112, 0x150: 0x140a, 0x151: 0x14aa, - 0x152: 0x154a, 0x153: 0x0b52, 0x154: 0x0b52, 0x155: 0x0012, 0x156: 0x0e52, 0x157: 0x1152, - 0x158: 0x0012, 0x159: 0x1752, 0x15a: 0x0012, 0x15b: 0x1a52, 0x15c: 0x15ea, 0x15d: 0x0012, - 0x15e: 0x0012, 0x15f: 0x0012, 0x160: 0x1d52, 0x161: 0x168a, 0x162: 0x0012, 0x163: 0x2052, - 0x164: 0x0012, 0x165: 0x172a, 0x166: 0x17ca, 0x167: 0x0012, 0x168: 0x2652, 0x169: 0x2652, - 0x16a: 0x186a, 0x16b: 0x190a, 0x16c: 0x19aa, 0x16d: 0x0012, 0x16e: 0x0012, 0x16f: 0x1d52, - 0x170: 0x0012, 0x171: 0x1a4a, 0x172: 0x2c52, 0x173: 0x0012, 0x174: 0x0012, 0x175: 0x3252, - 0x176: 0x0012, 0x177: 0x0012, 0x178: 0x0012, 0x179: 0x0012, 0x17a: 0x0012, 0x17b: 0x0012, - 0x17c: 0x0012, 0x17d: 0x1aea, 0x17e: 0x0012, 0x17f: 0x0012, - // Block 0x6, offset 0x180 - 0x180: 0x3552, 0x181: 0x0012, 0x182: 0x0012, 0x183: 0x3852, 0x184: 0x0012, 0x185: 0x0012, - 0x186: 0x0012, 0x187: 0x1b8a, 0x188: 0x3552, 0x189: 0x4752, 0x18a: 0x3b52, 0x18b: 0x3e52, - 0x18c: 0x4a52, 0x18d: 0x0012, 0x18e: 0x0012, 0x18f: 0x0012, 0x190: 0x0012, 0x191: 0x0012, - 0x192: 0x4152, 0x193: 0x0012, 0x194: 0x0010, 0x195: 0x0012, 0x196: 0x0012, 0x197: 0x0012, - 0x198: 0x0012, 0x199: 0x0012, 0x19a: 0x0012, 0x19b: 0x0012, 0x19c: 0x0012, 0x19d: 0x1c2a, - 0x19e: 0x1cca, 0x19f: 0x0012, 0x1a0: 0x0012, 0x1a1: 0x0012, 0x1a2: 0x0012, 0x1a3: 0x0012, - 0x1a4: 0x0012, 0x1a5: 0x0012, 0x1a6: 0x0012, 0x1a7: 0x0012, 0x1a8: 0x0012, 0x1a9: 0x0012, - 0x1aa: 0x0012, 0x1ab: 0x0012, 0x1ac: 0x0012, 0x1ad: 0x0012, 0x1ae: 0x0012, 0x1af: 0x0012, - 0x1b0: 0x0015, 0x1b1: 0x0015, 0x1b2: 0x0015, 0x1b3: 0x0015, 0x1b4: 0x0015, 0x1b5: 0x0015, - 0x1b6: 0x0015, 0x1b7: 0x0015, 0x1b8: 0x0015, 0x1b9: 0x0014, 0x1ba: 0x0014, 0x1bb: 0x0014, - 0x1bc: 0x0014, 0x1bd: 0x0014, 0x1be: 0x0014, 0x1bf: 0x0014, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0024, 0x1c1: 0x0024, 0x1c2: 0x0024, 0x1c3: 0x0024, 0x1c4: 0x0024, 0x1c5: 0x1d6d, - 0x1c6: 0x0024, 0x1c7: 0x0034, 0x1c8: 0x0034, 0x1c9: 0x0034, 0x1ca: 0x0024, 0x1cb: 0x0024, - 0x1cc: 0x0024, 0x1cd: 0x0034, 0x1ce: 0x0034, 0x1cf: 0x0014, 0x1d0: 0x0024, 0x1d1: 0x0024, - 0x1d2: 0x0024, 0x1d3: 0x0034, 0x1d4: 0x0034, 0x1d5: 0x0034, 0x1d6: 0x0034, 0x1d7: 0x0024, - 0x1d8: 0x0034, 0x1d9: 0x0034, 0x1da: 0x0034, 0x1db: 0x0024, 0x1dc: 0x0034, 0x1dd: 0x0034, - 0x1de: 0x0034, 0x1df: 0x0034, 0x1e0: 0x0034, 0x1e1: 0x0034, 0x1e2: 0x0034, 0x1e3: 0x0024, - 0x1e4: 0x0024, 0x1e5: 0x0024, 0x1e6: 0x0024, 0x1e7: 0x0024, 0x1e8: 0x0024, 0x1e9: 0x0024, - 0x1ea: 0x0024, 0x1eb: 0x0024, 0x1ec: 0x0024, 0x1ed: 0x0024, 0x1ee: 0x0024, 0x1ef: 0x0024, - 0x1f0: 0x0113, 0x1f1: 0x0112, 0x1f2: 0x0113, 0x1f3: 0x0112, 0x1f4: 0x0014, 0x1f5: 0x0004, - 0x1f6: 0x0113, 0x1f7: 0x0112, 0x1fa: 0x0015, 0x1fb: 0x4d52, - 0x1fc: 0x5052, 0x1fd: 0x5052, 0x1ff: 0x5353, - // Block 0x8, offset 0x200 - 0x204: 0x0004, 0x205: 0x0004, - 0x206: 0x2a13, 0x207: 0x0054, 0x208: 0x2513, 0x209: 0x2713, 0x20a: 0x2513, - 0x20c: 0x5653, 0x20e: 0x5953, 0x20f: 0x5c53, 0x210: 0x1e2a, 0x211: 0x2013, - 0x212: 0x2013, 0x213: 0x2013, 0x214: 0x2013, 0x215: 0x2013, 0x216: 0x2013, 0x217: 0x2013, - 0x218: 0x2013, 0x219: 0x2013, 0x21a: 0x2013, 0x21b: 0x2013, 0x21c: 0x2013, 0x21d: 0x2013, - 0x21e: 0x2013, 0x21f: 0x2013, 0x220: 0x5f53, 0x221: 0x5f53, 0x223: 0x5f53, - 0x224: 0x5f53, 0x225: 0x5f53, 0x226: 0x5f53, 0x227: 0x5f53, 0x228: 0x5f53, 0x229: 0x5f53, - 0x22a: 0x5f53, 0x22b: 0x5f53, 0x22c: 0x2a12, 0x22d: 0x2512, 0x22e: 0x2712, 0x22f: 0x2512, - 0x230: 0x1fea, 0x231: 0x2012, 0x232: 0x2012, 0x233: 0x2012, 0x234: 0x2012, 0x235: 0x2012, - 0x236: 0x2012, 0x237: 0x2012, 0x238: 0x2012, 0x239: 0x2012, 0x23a: 0x2012, 0x23b: 0x2012, - 0x23c: 0x2012, 0x23d: 0x2012, 0x23e: 0x2012, 0x23f: 0x2012, - // Block 0x9, offset 0x240 - 0x240: 0x5f52, 0x241: 0x5f52, 0x242: 0x21aa, 0x243: 0x5f52, 0x244: 0x5f52, 0x245: 0x5f52, - 0x246: 0x5f52, 0x247: 0x5f52, 0x248: 0x5f52, 0x249: 0x5f52, 0x24a: 0x5f52, 0x24b: 0x5f52, - 0x24c: 0x5652, 0x24d: 0x5952, 0x24e: 0x5c52, 0x24f: 0x1813, 0x250: 0x226a, 0x251: 0x232a, - 0x252: 0x0013, 0x253: 0x0013, 0x254: 0x0013, 0x255: 0x23ea, 0x256: 0x24aa, 0x257: 0x1812, - 0x258: 0x0113, 0x259: 0x0112, 0x25a: 0x0113, 0x25b: 0x0112, 0x25c: 0x0113, 0x25d: 0x0112, - 0x25e: 0x0113, 0x25f: 0x0112, 0x260: 0x0113, 0x261: 0x0112, 0x262: 0x0113, 0x263: 0x0112, - 0x264: 0x0113, 0x265: 0x0112, 0x266: 0x0113, 0x267: 0x0112, 0x268: 0x0113, 0x269: 0x0112, - 0x26a: 0x0113, 0x26b: 0x0112, 0x26c: 0x0113, 0x26d: 0x0112, 0x26e: 0x0113, 0x26f: 0x0112, - 0x270: 0x256a, 0x271: 0x262a, 0x272: 0x0b12, 0x273: 0x5352, 0x274: 0x6253, 0x275: 0x26ea, - 0x277: 0x0f13, 0x278: 0x0f12, 0x279: 0x0b13, 0x27a: 0x0113, 0x27b: 0x0112, - 0x27c: 0x0012, 0x27d: 0x4d53, 0x27e: 0x5053, 0x27f: 0x5053, - // Block 0xa, offset 0x280 - 0x280: 0x0812, 0x281: 0x0812, 0x282: 0x0812, 0x283: 0x0812, 0x284: 0x0812, 0x285: 0x0812, - 0x288: 0x0813, 0x289: 0x0813, 0x28a: 0x0813, 0x28b: 0x0813, - 0x28c: 0x0813, 0x28d: 0x0813, 0x290: 0x372a, 0x291: 0x0812, - 0x292: 0x386a, 0x293: 0x0812, 0x294: 0x3a2a, 0x295: 0x0812, 0x296: 0x3bea, 0x297: 0x0812, - 0x299: 0x0813, 0x29b: 0x0813, 0x29d: 0x0813, - 0x29f: 0x0813, 0x2a0: 0x0812, 0x2a1: 0x0812, 0x2a2: 0x0812, 0x2a3: 0x0812, - 0x2a4: 0x0812, 0x2a5: 0x0812, 0x2a6: 0x0812, 0x2a7: 0x0812, 0x2a8: 0x0813, 0x2a9: 0x0813, - 0x2aa: 0x0813, 0x2ab: 0x0813, 0x2ac: 0x0813, 0x2ad: 0x0813, 0x2ae: 0x0813, 0x2af: 0x0813, - 0x2b0: 0x8b52, 0x2b1: 0x8b52, 0x2b2: 0x8e52, 0x2b3: 0x8e52, 0x2b4: 0x9152, 0x2b5: 0x9152, - 0x2b6: 0x9452, 0x2b7: 0x9452, 0x2b8: 0x9752, 0x2b9: 0x9752, 0x2ba: 0x9a52, 0x2bb: 0x9a52, - 0x2bc: 0x4d52, 0x2bd: 0x4d52, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x3daa, 0x2c1: 0x3f8a, 0x2c2: 0x416a, 0x2c3: 0x434a, 0x2c4: 0x452a, 0x2c5: 0x470a, - 0x2c6: 0x48ea, 0x2c7: 0x4aca, 0x2c8: 0x4ca9, 0x2c9: 0x4e89, 0x2ca: 0x5069, 0x2cb: 0x5249, - 0x2cc: 0x5429, 0x2cd: 0x5609, 0x2ce: 0x57e9, 0x2cf: 0x59c9, 0x2d0: 0x5baa, 0x2d1: 0x5d8a, - 0x2d2: 0x5f6a, 0x2d3: 0x614a, 0x2d4: 0x632a, 0x2d5: 0x650a, 0x2d6: 0x66ea, 0x2d7: 0x68ca, - 0x2d8: 0x6aa9, 0x2d9: 0x6c89, 0x2da: 0x6e69, 0x2db: 0x7049, 0x2dc: 0x7229, 0x2dd: 0x7409, - 0x2de: 0x75e9, 0x2df: 0x77c9, 0x2e0: 0x79aa, 0x2e1: 0x7b8a, 0x2e2: 0x7d6a, 0x2e3: 0x7f4a, - 0x2e4: 0x812a, 0x2e5: 0x830a, 0x2e6: 0x84ea, 0x2e7: 0x86ca, 0x2e8: 0x88a9, 0x2e9: 0x8a89, - 0x2ea: 0x8c69, 0x2eb: 0x8e49, 0x2ec: 0x9029, 0x2ed: 0x9209, 0x2ee: 0x93e9, 0x2ef: 0x95c9, - 0x2f0: 0x0812, 0x2f1: 0x0812, 0x2f2: 0x97aa, 0x2f3: 0x99ca, 0x2f4: 0x9b6a, - 0x2f6: 0x9d2a, 0x2f7: 0x9e6a, 0x2f8: 0x0813, 0x2f9: 0x0813, 0x2fa: 0x8b53, 0x2fb: 0x8b53, - 0x2fc: 0xa0e9, 0x2fd: 0x0004, 0x2fe: 0xa28a, 0x2ff: 0x0004, - // Block 0xc, offset 0x300 - 0x300: 0x0004, 0x301: 0x0004, 0x302: 0xa34a, 0x303: 0xa56a, 0x304: 0xa70a, - 0x306: 0xa8ca, 0x307: 0xaa0a, 0x308: 0x8e53, 0x309: 0x8e53, 0x30a: 0x9153, 0x30b: 0x9153, - 0x30c: 0xac89, 0x30d: 0x0004, 0x30e: 0x0004, 0x30f: 0x0004, 0x310: 0x0812, 0x311: 0x0812, - 0x312: 0xae2a, 0x313: 0xafea, 0x316: 0xb1aa, 0x317: 0xb2ea, - 0x318: 0x0813, 0x319: 0x0813, 0x31a: 0x9453, 0x31b: 0x9453, 0x31d: 0x0004, - 0x31e: 0x0004, 0x31f: 0x0004, 0x320: 0x0812, 0x321: 0x0812, 0x322: 0xb4aa, 0x323: 0xb66a, - 0x324: 0xb82a, 0x325: 0x0912, 0x326: 0xb96a, 0x327: 0xbaaa, 0x328: 0x0813, 0x329: 0x0813, - 0x32a: 0x9a53, 0x32b: 0x9a53, 0x32c: 0x0913, 0x32d: 0x0004, 0x32e: 0x0004, 0x32f: 0x0004, - 0x332: 0xbc6a, 0x333: 0xbe8a, 0x334: 0xc02a, - 0x336: 0xc1ea, 0x337: 0xc32a, 0x338: 0x9753, 0x339: 0x9753, 0x33a: 0x4d53, 0x33b: 0x4d53, - 0x33c: 0xc5a9, 0x33d: 0x0004, 0x33e: 0x0004, - // Block 0xd, offset 0x340 - 0x342: 0x0013, - 0x347: 0x0013, 0x34a: 0x0012, 0x34b: 0x0013, - 0x34c: 0x0013, 0x34d: 0x0013, 0x34e: 0x0012, 0x34f: 0x0012, 0x350: 0x0013, 0x351: 0x0013, - 0x352: 0x0013, 0x353: 0x0012, 0x355: 0x0013, - 0x359: 0x0013, 0x35a: 0x0013, 0x35b: 0x0013, 0x35c: 0x0013, 0x35d: 0x0013, - 0x364: 0x0013, 0x366: 0xc74b, 0x368: 0x0013, - 0x36a: 0xc80b, 0x36b: 0xc88b, 0x36c: 0x0013, 0x36d: 0x0013, 0x36f: 0x0012, - 0x370: 0x0013, 0x371: 0x0013, 0x372: 0x9d53, 0x373: 0x0013, 0x374: 0x0012, 0x375: 0x0010, - 0x376: 0x0010, 0x377: 0x0010, 0x378: 0x0010, 0x379: 0x0012, - 0x37c: 0x0012, 0x37d: 0x0012, 0x37e: 0x0013, 0x37f: 0x0013, - // Block 0xe, offset 0x380 - 0x380: 0x1a13, 0x381: 0x1a13, 0x382: 0x1e13, 0x383: 0x1e13, 0x384: 0x1a13, 0x385: 0x1a13, - 0x386: 0x2613, 0x387: 0x2613, 0x388: 0x2a13, 0x389: 0x2a13, 0x38a: 0x2e13, 0x38b: 0x2e13, - 0x38c: 0x2a13, 0x38d: 0x2a13, 0x38e: 0x2613, 0x38f: 0x2613, 0x390: 0xa052, 0x391: 0xa052, - 0x392: 0xa352, 0x393: 0xa352, 0x394: 0xa652, 0x395: 0xa652, 0x396: 0xa352, 0x397: 0xa352, - 0x398: 0xa052, 0x399: 0xa052, 0x39a: 0x1a12, 0x39b: 0x1a12, 0x39c: 0x1e12, 0x39d: 0x1e12, - 0x39e: 0x1a12, 0x39f: 0x1a12, 0x3a0: 0x2612, 0x3a1: 0x2612, 0x3a2: 0x2a12, 0x3a3: 0x2a12, - 0x3a4: 0x2e12, 0x3a5: 0x2e12, 0x3a6: 0x2a12, 0x3a7: 0x2a12, 0x3a8: 0x2612, 0x3a9: 0x2612, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x6552, 0x3c1: 0x6552, 0x3c2: 0x6552, 0x3c3: 0x6552, 0x3c4: 0x6552, 0x3c5: 0x6552, - 0x3c6: 0x6552, 0x3c7: 0x6552, 0x3c8: 0x6552, 0x3c9: 0x6552, 0x3ca: 0x6552, 0x3cb: 0x6552, - 0x3cc: 0x6552, 0x3cd: 0x6552, 0x3ce: 0x6552, 0x3cf: 0x6552, 0x3d0: 0xa952, 0x3d1: 0xa952, - 0x3d2: 0xa952, 0x3d3: 0xa952, 0x3d4: 0xa952, 0x3d5: 0xa952, 0x3d6: 0xa952, 0x3d7: 0xa952, - 0x3d8: 0xa952, 0x3d9: 0xa952, 0x3da: 0xa952, 0x3db: 0xa952, 0x3dc: 0xa952, 0x3dd: 0xa952, - 0x3de: 0xa952, 0x3e0: 0x0113, 0x3e1: 0x0112, 0x3e2: 0xc94b, 0x3e3: 0x8853, - 0x3e4: 0xca0b, 0x3e5: 0xcaca, 0x3e6: 0xcb4a, 0x3e7: 0x0f13, 0x3e8: 0x0f12, 0x3e9: 0x0313, - 0x3ea: 0x0312, 0x3eb: 0x0713, 0x3ec: 0x0712, 0x3ed: 0xcbcb, 0x3ee: 0xcc8b, 0x3ef: 0xcd4b, - 0x3f0: 0xce0b, 0x3f1: 0x0012, 0x3f2: 0x0113, 0x3f3: 0x0112, 0x3f4: 0x0012, 0x3f5: 0x0313, - 0x3f6: 0x0312, 0x3f7: 0x0012, 0x3f8: 0x0012, 0x3f9: 0x0012, 0x3fa: 0x0012, 0x3fb: 0x0012, - 0x3fc: 0x0015, 0x3fd: 0x0015, 0x3fe: 0xcecb, 0x3ff: 0xcf8b, - // Block 0x10, offset 0x400 - 0x400: 0x0113, 0x401: 0x0112, 0x402: 0x0113, 0x403: 0x0112, 0x404: 0x0113, 0x405: 0x0112, - 0x406: 0x0113, 0x407: 0x0112, 0x408: 0x0014, 0x409: 0x0004, 0x40a: 0x0004, 0x40b: 0x0713, - 0x40c: 0x0712, 0x40d: 0xd04b, 0x40e: 0x0012, 0x40f: 0x0010, 0x410: 0x0113, 0x411: 0x0112, - 0x412: 0x0113, 0x413: 0x0112, 0x414: 0x0012, 0x415: 0x0012, 0x416: 0x0113, 0x417: 0x0112, - 0x418: 0x0113, 0x419: 0x0112, 0x41a: 0x0113, 0x41b: 0x0112, 0x41c: 0x0113, 0x41d: 0x0112, - 0x41e: 0x0113, 0x41f: 0x0112, 0x420: 0x0113, 0x421: 0x0112, 0x422: 0x0113, 0x423: 0x0112, - 0x424: 0x0113, 0x425: 0x0112, 0x426: 0x0113, 0x427: 0x0112, 0x428: 0x0113, 0x429: 0x0112, - 0x42a: 0xd10b, 0x42b: 0xd1cb, 0x42c: 0xd28b, 0x42d: 0xd34b, 0x42e: 0xd40b, - 0x430: 0xd4cb, 0x431: 0xd58b, 0x432: 0xd64b, 0x433: 0xac53, 0x434: 0x0113, 0x435: 0x0112, - 0x436: 0x0113, 0x437: 0x0112, - // Block 0x11, offset 0x440 - 0x440: 0xd70a, 0x441: 0xd80a, 0x442: 0xd90a, 0x443: 0xda0a, 0x444: 0xdb6a, 0x445: 0xdcca, - 0x446: 0xddca, - 0x453: 0xdeca, 0x454: 0xe08a, 0x455: 0xe24a, 0x456: 0xe40a, 0x457: 0xe5ca, - 0x45d: 0x0010, - 0x45e: 0x0034, 0x45f: 0x0010, 0x460: 0x0010, 0x461: 0x0010, 0x462: 0x0010, 0x463: 0x0010, - 0x464: 0x0010, 0x465: 0x0010, 0x466: 0x0010, 0x467: 0x0010, 0x468: 0x0010, - 0x46a: 0x0010, 0x46b: 0x0010, 0x46c: 0x0010, 0x46d: 0x0010, 0x46e: 0x0010, 0x46f: 0x0010, - 0x470: 0x0010, 0x471: 0x0010, 0x472: 0x0010, 0x473: 0x0010, 0x474: 0x0010, 0x475: 0x0010, - 0x476: 0x0010, 0x478: 0x0010, 0x479: 0x0010, 0x47a: 0x0010, 0x47b: 0x0010, - 0x47c: 0x0010, 0x47e: 0x0010, - // Block 0x12, offset 0x480 - 0x480: 0x2213, 0x481: 0x2213, 0x482: 0x2613, 0x483: 0x2613, 0x484: 0x2213, 0x485: 0x2213, - 0x486: 0x2e13, 0x487: 0x2e13, 0x488: 0x2213, 0x489: 0x2213, 0x48a: 0x2613, 0x48b: 0x2613, - 0x48c: 0x2213, 0x48d: 0x2213, 0x48e: 0x3e13, 0x48f: 0x3e13, 0x490: 0x2213, 0x491: 0x2213, - 0x492: 0x2613, 0x493: 0x2613, 0x494: 0x2213, 0x495: 0x2213, 0x496: 0x2e13, 0x497: 0x2e13, - 0x498: 0x2213, 0x499: 0x2213, 0x49a: 0x2613, 0x49b: 0x2613, 0x49c: 0x2213, 0x49d: 0x2213, - 0x49e: 0xb553, 0x49f: 0xb553, 0x4a0: 0xb853, 0x4a1: 0xb853, 0x4a2: 0x2212, 0x4a3: 0x2212, - 0x4a4: 0x2612, 0x4a5: 0x2612, 0x4a6: 0x2212, 0x4a7: 0x2212, 0x4a8: 0x2e12, 0x4a9: 0x2e12, - 0x4aa: 0x2212, 0x4ab: 0x2212, 0x4ac: 0x2612, 0x4ad: 0x2612, 0x4ae: 0x2212, 0x4af: 0x2212, - 0x4b0: 0x3e12, 0x4b1: 0x3e12, 0x4b2: 0x2212, 0x4b3: 0x2212, 0x4b4: 0x2612, 0x4b5: 0x2612, - 0x4b6: 0x2212, 0x4b7: 0x2212, 0x4b8: 0x2e12, 0x4b9: 0x2e12, 0x4ba: 0x2212, 0x4bb: 0x2212, - 0x4bc: 0x2612, 0x4bd: 0x2612, 0x4be: 0x2212, 0x4bf: 0x2212, - // Block 0x13, offset 0x4c0 - 0x4c2: 0x0010, - 0x4c7: 0x0010, 0x4c9: 0x0010, 0x4cb: 0x0010, - 0x4cd: 0x0010, 0x4ce: 0x0010, 0x4cf: 0x0010, 0x4d1: 0x0010, - 0x4d2: 0x0010, 0x4d4: 0x0010, 0x4d7: 0x0010, - 0x4d9: 0x0010, 0x4db: 0x0010, 0x4dd: 0x0010, - 0x4df: 0x0010, 0x4e1: 0x0010, 0x4e2: 0x0010, - 0x4e4: 0x0010, 0x4e7: 0x0010, 0x4e8: 0x0010, 0x4e9: 0x0010, - 0x4ea: 0x0010, 0x4ec: 0x0010, 0x4ed: 0x0010, 0x4ee: 0x0010, 0x4ef: 0x0010, - 0x4f0: 0x0010, 0x4f1: 0x0010, 0x4f2: 0x0010, 0x4f4: 0x0010, 0x4f5: 0x0010, - 0x4f6: 0x0010, 0x4f7: 0x0010, 0x4f9: 0x0010, 0x4fa: 0x0010, 0x4fb: 0x0010, - 0x4fc: 0x0010, 0x4fe: 0x0010, -} - -// caseIndex: 25 blocks, 1600 entries, 3200 bytes -// Block 0 is the zero block. -var caseIndex = [1600]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x12, 0xc3: 0x13, 0xc4: 0x14, 0xc5: 0x15, 0xc6: 0x01, 0xc7: 0x02, - 0xc8: 0x16, 0xc9: 0x03, 0xca: 0x04, 0xcb: 0x17, 0xcc: 0x18, 0xcd: 0x05, 0xce: 0x06, 0xcf: 0x07, - 0xd0: 0x19, 0xd1: 0x1a, 0xd2: 0x1b, 0xd3: 0x1c, 0xd4: 0x1d, 0xd5: 0x1e, 0xd6: 0x1f, 0xd7: 0x20, - 0xd8: 0x21, 0xd9: 0x22, 0xda: 0x23, 0xdb: 0x24, 0xdc: 0x25, 0xdd: 0x26, 0xde: 0x27, 0xdf: 0x28, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, - 0xea: 0x06, 0xeb: 0x07, 0xec: 0x07, 0xed: 0x08, 0xef: 0x09, - 0xf0: 0x14, 0xf3: 0x16, - // Block 0x4, offset 0x100 - 0x120: 0x29, 0x121: 0x2a, 0x122: 0x2b, 0x123: 0x2c, 0x124: 0x2d, 0x125: 0x2e, 0x126: 0x2f, 0x127: 0x30, - 0x128: 0x31, 0x129: 0x32, 0x12a: 0x33, 0x12b: 0x34, 0x12c: 0x35, 0x12d: 0x36, 0x12e: 0x37, 0x12f: 0x38, - 0x130: 0x39, 0x131: 0x3a, 0x132: 0x3b, 0x133: 0x3c, 0x134: 0x3d, 0x135: 0x3e, 0x136: 0x3f, 0x137: 0x40, - 0x138: 0x41, 0x139: 0x42, 0x13a: 0x43, 0x13b: 0x44, 0x13c: 0x45, 0x13d: 0x46, 0x13e: 0x47, 0x13f: 0x48, - // Block 0x5, offset 0x140 - 0x140: 0x49, 0x141: 0x4a, 0x142: 0x4b, 0x143: 0x4c, 0x144: 0x23, 0x145: 0x23, 0x146: 0x23, 0x147: 0x23, - 0x148: 0x23, 0x149: 0x4d, 0x14a: 0x4e, 0x14b: 0x4f, 0x14c: 0x50, 0x14d: 0x51, 0x14e: 0x52, 0x14f: 0x53, - 0x150: 0x54, 0x151: 0x23, 0x152: 0x23, 0x153: 0x23, 0x154: 0x23, 0x155: 0x23, 0x156: 0x23, 0x157: 0x23, - 0x158: 0x23, 0x159: 0x55, 0x15a: 0x56, 0x15b: 0x57, 0x15c: 0x58, 0x15d: 0x59, 0x15e: 0x5a, 0x15f: 0x5b, - 0x160: 0x5c, 0x161: 0x5d, 0x162: 0x5e, 0x163: 0x5f, 0x164: 0x60, 0x165: 0x61, 0x167: 0x62, - 0x168: 0x63, 0x169: 0x64, 0x16a: 0x65, 0x16c: 0x66, 0x16d: 0x67, 0x16e: 0x68, 0x16f: 0x69, - 0x170: 0x6a, 0x171: 0x6b, 0x172: 0x6c, 0x173: 0x6d, 0x174: 0x6e, 0x175: 0x6f, 0x176: 0x70, 0x177: 0x71, - 0x178: 0x72, 0x179: 0x72, 0x17a: 0x73, 0x17b: 0x72, 0x17c: 0x74, 0x17d: 0x08, 0x17e: 0x09, 0x17f: 0x0a, - // Block 0x6, offset 0x180 - 0x180: 0x75, 0x181: 0x76, 0x182: 0x77, 0x183: 0x78, 0x184: 0x0b, 0x185: 0x79, 0x186: 0x7a, - 0x192: 0x7b, 0x193: 0x0c, - 0x1b0: 0x7c, 0x1b1: 0x0d, 0x1b2: 0x72, 0x1b3: 0x7d, 0x1b4: 0x7e, 0x1b5: 0x7f, 0x1b6: 0x80, 0x1b7: 0x81, - 0x1b8: 0x82, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x83, 0x1c2: 0x84, 0x1c3: 0x85, 0x1c4: 0x86, 0x1c5: 0x23, 0x1c6: 0x87, - // Block 0x8, offset 0x200 - 0x200: 0x88, 0x201: 0x23, 0x202: 0x23, 0x203: 0x23, 0x204: 0x23, 0x205: 0x23, 0x206: 0x23, 0x207: 0x23, - 0x208: 0x23, 0x209: 0x23, 0x20a: 0x23, 0x20b: 0x23, 0x20c: 0x23, 0x20d: 0x23, 0x20e: 0x23, 0x20f: 0x23, - 0x210: 0x23, 0x211: 0x23, 0x212: 0x89, 0x213: 0x8a, 0x214: 0x23, 0x215: 0x23, 0x216: 0x23, 0x217: 0x23, - 0x218: 0x8b, 0x219: 0x8c, 0x21a: 0x8d, 0x21b: 0x8e, 0x21c: 0x8f, 0x21d: 0x90, 0x21e: 0x0e, 0x21f: 0x91, - 0x220: 0x92, 0x221: 0x93, 0x222: 0x23, 0x223: 0x94, 0x224: 0x95, 0x225: 0x96, 0x226: 0x97, 0x227: 0x98, - 0x228: 0x99, 0x229: 0x9a, 0x22a: 0x9b, 0x22b: 0x9c, 0x22c: 0x9d, 0x22d: 0x9e, 0x22e: 0x9f, 0x22f: 0xa0, - 0x230: 0x23, 0x231: 0x23, 0x232: 0x23, 0x233: 0x23, 0x234: 0x23, 0x235: 0x23, 0x236: 0x23, 0x237: 0x23, - 0x238: 0x23, 0x239: 0x23, 0x23a: 0x23, 0x23b: 0x23, 0x23c: 0x23, 0x23d: 0x23, 0x23e: 0x23, 0x23f: 0x23, - // Block 0x9, offset 0x240 - 0x240: 0x23, 0x241: 0x23, 0x242: 0x23, 0x243: 0x23, 0x244: 0x23, 0x245: 0x23, 0x246: 0x23, 0x247: 0x23, - 0x248: 0x23, 0x249: 0x23, 0x24a: 0x23, 0x24b: 0x23, 0x24c: 0x23, 0x24d: 0x23, 0x24e: 0x23, 0x24f: 0x23, - 0x250: 0x23, 0x251: 0x23, 0x252: 0x23, 0x253: 0x23, 0x254: 0x23, 0x255: 0x23, 0x256: 0x23, 0x257: 0x23, - 0x258: 0x23, 0x259: 0x23, 0x25a: 0x23, 0x25b: 0x23, 0x25c: 0x23, 0x25d: 0x23, 0x25e: 0x23, 0x25f: 0x23, - 0x260: 0x23, 0x261: 0x23, 0x262: 0x23, 0x263: 0x23, 0x264: 0x23, 0x265: 0x23, 0x266: 0x23, 0x267: 0x23, - 0x268: 0x23, 0x269: 0x23, 0x26a: 0x23, 0x26b: 0x23, 0x26c: 0x23, 0x26d: 0x23, 0x26e: 0x23, 0x26f: 0x23, - 0x270: 0x23, 0x271: 0x23, 0x272: 0x23, 0x273: 0x23, 0x274: 0x23, 0x275: 0x23, 0x276: 0x23, 0x277: 0x23, - 0x278: 0x23, 0x279: 0x23, 0x27a: 0x23, 0x27b: 0x23, 0x27c: 0x23, 0x27d: 0x23, 0x27e: 0x23, 0x27f: 0x23, - // Block 0xa, offset 0x280 - 0x280: 0x23, 0x281: 0x23, 0x282: 0x23, 0x283: 0x23, 0x284: 0x23, 0x285: 0x23, 0x286: 0x23, 0x287: 0x23, - 0x288: 0x23, 0x289: 0x23, 0x28a: 0x23, 0x28b: 0x23, 0x28c: 0x23, 0x28d: 0x23, 0x28e: 0x23, 0x28f: 0x23, - 0x290: 0x23, 0x291: 0x23, 0x292: 0x23, 0x293: 0x23, 0x294: 0x23, 0x295: 0x23, 0x296: 0x23, 0x297: 0x23, - 0x298: 0x23, 0x299: 0x23, 0x29a: 0x23, 0x29b: 0x23, 0x29c: 0x23, 0x29d: 0x23, 0x29e: 0xa1, 0x29f: 0xa2, - // Block 0xb, offset 0x2c0 - 0x2ec: 0x0f, 0x2ed: 0xa3, 0x2ee: 0xa4, 0x2ef: 0xa5, - 0x2f0: 0x23, 0x2f1: 0x23, 0x2f2: 0x23, 0x2f3: 0x23, 0x2f4: 0xa6, 0x2f5: 0xa7, 0x2f6: 0xa8, 0x2f7: 0xa9, - 0x2f8: 0xaa, 0x2f9: 0xab, 0x2fa: 0x23, 0x2fb: 0xac, 0x2fc: 0xad, 0x2fd: 0xae, 0x2fe: 0xaf, 0x2ff: 0xb0, - // Block 0xc, offset 0x300 - 0x300: 0xb1, 0x301: 0xb2, 0x302: 0x23, 0x303: 0xb3, 0x305: 0xb4, 0x307: 0xb5, - 0x30a: 0xb6, 0x30b: 0xb7, 0x30c: 0xb8, 0x30d: 0xb9, 0x30e: 0xba, 0x30f: 0xbb, - 0x310: 0xbc, 0x311: 0xbd, 0x312: 0xbe, 0x313: 0xbf, 0x314: 0xc0, 0x315: 0xc1, - 0x318: 0x23, 0x319: 0x23, 0x31a: 0x23, 0x31b: 0x23, 0x31c: 0xc2, 0x31d: 0xc3, - 0x320: 0xc4, 0x321: 0xc5, 0x322: 0xc6, 0x323: 0xc7, 0x324: 0xc8, 0x326: 0xc9, - 0x328: 0xca, 0x329: 0xcb, 0x32a: 0xcc, 0x32b: 0xcd, 0x32c: 0x5f, 0x32d: 0xce, 0x32e: 0xcf, - 0x330: 0x23, 0x331: 0xd0, 0x332: 0xd1, 0x333: 0xd2, - // Block 0xd, offset 0x340 - 0x340: 0xd3, 0x341: 0xd4, 0x342: 0xd5, 0x343: 0xd6, 0x344: 0xd7, 0x345: 0xd8, 0x346: 0xd9, 0x347: 0xda, - 0x348: 0xdb, 0x34a: 0xdc, 0x34b: 0xdd, 0x34c: 0xde, 0x34d: 0xdf, - 0x350: 0xe0, 0x351: 0xe1, 0x352: 0xe2, 0x353: 0xe3, 0x356: 0xe4, 0x357: 0xe5, - 0x358: 0xe6, 0x359: 0xe7, 0x35a: 0xe8, 0x35b: 0xe9, 0x35c: 0xea, - 0x362: 0xeb, 0x363: 0xec, - 0x36b: 0xed, - 0x370: 0xee, 0x371: 0xef, 0x372: 0xf0, - // Block 0xe, offset 0x380 - 0x380: 0x23, 0x381: 0x23, 0x382: 0x23, 0x383: 0x23, 0x384: 0x23, 0x385: 0x23, 0x386: 0x23, 0x387: 0x23, - 0x388: 0x23, 0x389: 0x23, 0x38a: 0x23, 0x38b: 0x23, 0x38c: 0x23, 0x38d: 0x23, 0x38e: 0xf1, - 0x390: 0x23, 0x391: 0xf2, 0x392: 0x23, 0x393: 0x23, 0x394: 0x23, 0x395: 0xf3, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x23, 0x3c1: 0x23, 0x3c2: 0x23, 0x3c3: 0x23, 0x3c4: 0x23, 0x3c5: 0x23, 0x3c6: 0x23, 0x3c7: 0x23, - 0x3c8: 0x23, 0x3c9: 0x23, 0x3ca: 0x23, 0x3cb: 0x23, 0x3cc: 0x23, 0x3cd: 0x23, 0x3ce: 0x23, 0x3cf: 0x23, - 0x3d0: 0xf2, - // Block 0x10, offset 0x400 - 0x410: 0x23, 0x411: 0x23, 0x412: 0x23, 0x413: 0x23, 0x414: 0x23, 0x415: 0x23, 0x416: 0x23, 0x417: 0x23, - 0x418: 0x23, 0x419: 0xf4, - // Block 0x11, offset 0x440 - 0x460: 0x23, 0x461: 0x23, 0x462: 0x23, 0x463: 0x23, 0x464: 0x23, 0x465: 0x23, 0x466: 0x23, 0x467: 0x23, - 0x468: 0xed, 0x469: 0xf5, 0x46b: 0xf6, 0x46c: 0xf7, 0x46d: 0xf8, 0x46e: 0xf9, - 0x47c: 0x23, 0x47d: 0xfa, 0x47e: 0xfb, 0x47f: 0xfc, - // Block 0x12, offset 0x480 - 0x4b0: 0x23, 0x4b1: 0xfd, 0x4b2: 0xfe, - // Block 0x13, offset 0x4c0 - 0x4c5: 0xff, 0x4c6: 0x100, - 0x4c9: 0x101, - 0x4d0: 0x102, 0x4d1: 0x103, 0x4d2: 0x104, 0x4d3: 0x105, 0x4d4: 0x106, 0x4d5: 0x107, 0x4d6: 0x108, 0x4d7: 0x109, - 0x4d8: 0x10a, 0x4d9: 0x10b, 0x4da: 0x10c, 0x4db: 0x10d, 0x4dc: 0x10e, 0x4dd: 0x10f, 0x4de: 0x110, 0x4df: 0x111, - 0x4e8: 0x112, 0x4e9: 0x113, 0x4ea: 0x114, - // Block 0x14, offset 0x500 - 0x500: 0x115, - 0x520: 0x23, 0x521: 0x23, 0x522: 0x23, 0x523: 0x116, 0x524: 0x10, 0x525: 0x117, - 0x538: 0x118, 0x539: 0x11, 0x53a: 0x119, - // Block 0x15, offset 0x540 - 0x544: 0x11a, 0x545: 0x11b, 0x546: 0x11c, - 0x54f: 0x11d, - // Block 0x16, offset 0x580 - 0x590: 0x0a, 0x591: 0x0b, 0x592: 0x0c, 0x593: 0x0d, 0x594: 0x0e, 0x596: 0x0f, - 0x59b: 0x10, 0x59d: 0x11, 0x59e: 0x12, 0x59f: 0x13, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x11e, 0x5c1: 0x11f, 0x5c4: 0x11f, 0x5c5: 0x11f, 0x5c6: 0x11f, 0x5c7: 0x120, - // Block 0x18, offset 0x600 - 0x620: 0x15, -} - -// sparseOffsets: 272 entries, 544 bytes -var sparseOffsets = []uint16{0x0, 0x9, 0xf, 0x18, 0x24, 0x2e, 0x3a, 0x3d, 0x41, 0x44, 0x48, 0x52, 0x54, 0x59, 0x69, 0x70, 0x75, 0x83, 0x84, 0x92, 0xa1, 0xab, 0xae, 0xb4, 0xbc, 0xbe, 0xc0, 0xce, 0xd4, 0xe2, 0xed, 0xf8, 0x103, 0x10f, 0x119, 0x124, 0x12f, 0x13b, 0x147, 0x14f, 0x157, 0x161, 0x16c, 0x178, 0x17e, 0x189, 0x18e, 0x196, 0x199, 0x19e, 0x1a2, 0x1a6, 0x1ad, 0x1b6, 0x1be, 0x1bf, 0x1c8, 0x1cf, 0x1d7, 0x1dd, 0x1e3, 0x1e8, 0x1ec, 0x1ef, 0x1f1, 0x1f4, 0x1f9, 0x1fa, 0x1fc, 0x1fe, 0x200, 0x207, 0x20c, 0x210, 0x219, 0x21c, 0x21f, 0x225, 0x226, 0x231, 0x232, 0x233, 0x238, 0x245, 0x24d, 0x255, 0x25e, 0x267, 0x270, 0x275, 0x278, 0x281, 0x28e, 0x290, 0x297, 0x299, 0x2a4, 0x2a5, 0x2b0, 0x2b8, 0x2c0, 0x2c6, 0x2c7, 0x2d5, 0x2da, 0x2dd, 0x2e2, 0x2e6, 0x2ec, 0x2f1, 0x2f4, 0x2f9, 0x2fe, 0x2ff, 0x305, 0x307, 0x308, 0x30a, 0x30c, 0x30f, 0x310, 0x312, 0x315, 0x31b, 0x31f, 0x321, 0x327, 0x32e, 0x332, 0x33b, 0x33c, 0x344, 0x348, 0x34d, 0x355, 0x35b, 0x361, 0x36b, 0x370, 0x379, 0x37f, 0x386, 0x38a, 0x392, 0x394, 0x396, 0x399, 0x39b, 0x39d, 0x39e, 0x39f, 0x3a1, 0x3a3, 0x3a9, 0x3ae, 0x3b0, 0x3b6, 0x3b9, 0x3bb, 0x3c1, 0x3c6, 0x3c8, 0x3c9, 0x3ca, 0x3cb, 0x3cd, 0x3cf, 0x3d1, 0x3d4, 0x3d6, 0x3d9, 0x3e1, 0x3e4, 0x3e8, 0x3f0, 0x3f2, 0x3f3, 0x3f4, 0x3f6, 0x3fc, 0x3fe, 0x3ff, 0x401, 0x403, 0x405, 0x412, 0x413, 0x414, 0x418, 0x41a, 0x41b, 0x41c, 0x41d, 0x41e, 0x422, 0x426, 0x42c, 0x42e, 0x435, 0x438, 0x43c, 0x442, 0x44b, 0x451, 0x457, 0x461, 0x46b, 0x46d, 0x474, 0x47a, 0x480, 0x486, 0x489, 0x48f, 0x492, 0x49a, 0x49b, 0x4a2, 0x4a3, 0x4a6, 0x4a7, 0x4ad, 0x4b0, 0x4b8, 0x4b9, 0x4ba, 0x4bb, 0x4bc, 0x4be, 0x4c0, 0x4c2, 0x4c6, 0x4c7, 0x4c9, 0x4ca, 0x4cb, 0x4cd, 0x4d2, 0x4d7, 0x4db, 0x4dc, 0x4df, 0x4e3, 0x4ee, 0x4f2, 0x4fa, 0x4ff, 0x503, 0x506, 0x50a, 0x50d, 0x510, 0x515, 0x519, 0x51d, 0x521, 0x525, 0x527, 0x529, 0x52c, 0x531, 0x533, 0x538, 0x541, 0x546, 0x547, 0x54a, 0x54b, 0x54c, 0x54e, 0x54f, 0x550} - -// sparseValues: 1360 entries, 5440 bytes -var sparseValues = [1360]valueRange{ - // Block 0x0, offset 0x0 - {value: 0x0004, lo: 0xa8, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xaa}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0004, lo: 0xaf, hi: 0xaf}, - {value: 0x0004, lo: 0xb4, hi: 0xb4}, - {value: 0x002a, lo: 0xb5, hi: 0xb5}, - {value: 0x0054, lo: 0xb7, hi: 0xb7}, - {value: 0x0004, lo: 0xb8, hi: 0xb8}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - // Block 0x1, offset 0x9 - {value: 0x2013, lo: 0x80, hi: 0x96}, - {value: 0x2013, lo: 0x98, hi: 0x9e}, - {value: 0x00ea, lo: 0x9f, hi: 0x9f}, - {value: 0x2012, lo: 0xa0, hi: 0xb6}, - {value: 0x2012, lo: 0xb8, hi: 0xbe}, - {value: 0x0252, lo: 0xbf, hi: 0xbf}, - // Block 0x2, offset 0xf - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x01eb, lo: 0xb0, hi: 0xb0}, - {value: 0x02ea, lo: 0xb1, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb7}, - {value: 0x0012, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x0553, lo: 0xbf, hi: 0xbf}, - // Block 0x3, offset 0x18 - {value: 0x0552, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x034a, lo: 0x89, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xb7}, - {value: 0x0253, lo: 0xb8, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x0316, lo: 0xbd, hi: 0xbe}, - {value: 0x044a, lo: 0xbf, hi: 0xbf}, - // Block 0x4, offset 0x24 - {value: 0x0117, lo: 0x80, hi: 0x9f}, - {value: 0x2f53, lo: 0xa0, hi: 0xa0}, - {value: 0x0012, lo: 0xa1, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xb3}, - {value: 0x0012, lo: 0xb4, hi: 0xb9}, - {value: 0x10cb, lo: 0xba, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x2953, lo: 0xbd, hi: 0xbd}, - {value: 0x11cb, lo: 0xbe, hi: 0xbe}, - {value: 0x12ca, lo: 0xbf, hi: 0xbf}, - // Block 0x5, offset 0x2e - {value: 0x0015, lo: 0x80, hi: 0x81}, - {value: 0x0004, lo: 0x82, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x91}, - {value: 0x0004, lo: 0x92, hi: 0x96}, - {value: 0x0054, lo: 0x97, hi: 0x97}, - {value: 0x0004, lo: 0x98, hi: 0x9f}, - {value: 0x0015, lo: 0xa0, hi: 0xa4}, - {value: 0x0004, lo: 0xa5, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xac}, - {value: 0x0004, lo: 0xad, hi: 0xad}, - {value: 0x0014, lo: 0xae, hi: 0xae}, - {value: 0x0004, lo: 0xaf, hi: 0xbf}, - // Block 0x6, offset 0x3a - {value: 0x0024, lo: 0x80, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbf}, - // Block 0x7, offset 0x3d - {value: 0x6553, lo: 0x80, hi: 0x8f}, - {value: 0x2013, lo: 0x90, hi: 0x9f}, - {value: 0x5f53, lo: 0xa0, hi: 0xaf}, - {value: 0x2012, lo: 0xb0, hi: 0xbf}, - // Block 0x8, offset 0x41 - {value: 0x5f52, lo: 0x80, hi: 0x8f}, - {value: 0x6552, lo: 0x90, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x9, offset 0x44 - {value: 0x0117, lo: 0x80, hi: 0x81}, - {value: 0x0024, lo: 0x83, hi: 0x87}, - {value: 0x0014, lo: 0x88, hi: 0x89}, - {value: 0x0117, lo: 0x8a, hi: 0xbf}, - // Block 0xa, offset 0x48 - {value: 0x0f13, lo: 0x80, hi: 0x80}, - {value: 0x0316, lo: 0x81, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0316, lo: 0x85, hi: 0x86}, - {value: 0x0f16, lo: 0x87, hi: 0x88}, - {value: 0x0316, lo: 0x89, hi: 0x8a}, - {value: 0x0716, lo: 0x8b, hi: 0x8c}, - {value: 0x0316, lo: 0x8d, hi: 0x8e}, - {value: 0x0f12, lo: 0x8f, hi: 0x8f}, - {value: 0x0117, lo: 0x90, hi: 0xbf}, - // Block 0xb, offset 0x52 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x6553, lo: 0xb1, hi: 0xbf}, - // Block 0xc, offset 0x54 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6853, lo: 0x90, hi: 0x96}, - {value: 0x0014, lo: 0x99, hi: 0x99}, - {value: 0x6552, lo: 0xa1, hi: 0xaf}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0xd, offset 0x59 - {value: 0x6852, lo: 0x80, hi: 0x86}, - {value: 0x27aa, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0024, lo: 0x92, hi: 0x95}, - {value: 0x0034, lo: 0x96, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x99}, - {value: 0x0034, lo: 0x9a, hi: 0x9b}, - {value: 0x0024, lo: 0x9c, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa7}, - {value: 0x0024, lo: 0xa8, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xbd}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xe, offset 0x69 - {value: 0x0034, lo: 0x81, hi: 0x82}, - {value: 0x0024, lo: 0x84, hi: 0x84}, - {value: 0x0034, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb3}, - {value: 0x0054, lo: 0xb4, hi: 0xb4}, - // Block 0xf, offset 0x70 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0024, lo: 0x90, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0014, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x10, offset 0x75 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x8a}, - {value: 0x0034, lo: 0x8b, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9c}, - {value: 0x0024, lo: 0x9d, hi: 0x9e}, - {value: 0x0034, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0034, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x11, offset 0x83 - {value: 0x0010, lo: 0x80, hi: 0xbf}, - // Block 0x12, offset 0x84 - {value: 0x0010, lo: 0x80, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0024, lo: 0x9f, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xaa, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x13, offset 0x92 - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0034, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0034, lo: 0xb1, hi: 0xb1}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbc}, - {value: 0x0024, lo: 0xbd, hi: 0xbd}, - {value: 0x0034, lo: 0xbe, hi: 0xbe}, - {value: 0x0024, lo: 0xbf, hi: 0xbf}, - // Block 0x14, offset 0xa1 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0024, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x88}, - {value: 0x0024, lo: 0x89, hi: 0x8a}, - {value: 0x0010, lo: 0x8d, hi: 0xbf}, - // Block 0x15, offset 0xab - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x16, offset 0xae - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0024, lo: 0xab, hi: 0xb1}, - {value: 0x0034, lo: 0xb2, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - // Block 0x17, offset 0xb4 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0024, lo: 0x96, hi: 0x99}, - {value: 0x0014, lo: 0x9a, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0xa3}, - {value: 0x0014, lo: 0xa4, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xad}, - // Block 0x18, offset 0xbc - {value: 0x0010, lo: 0x80, hi: 0x98}, - {value: 0x0034, lo: 0x99, hi: 0x9b}, - // Block 0x19, offset 0xbe - {value: 0x0010, lo: 0xa0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbd}, - // Block 0x1a, offset 0xc0 - {value: 0x0024, lo: 0x94, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0034, lo: 0xa3, hi: 0xa3}, - {value: 0x0024, lo: 0xa4, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0024, lo: 0xaa, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xb2}, - {value: 0x0024, lo: 0xb3, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbf}, - // Block 0x1b, offset 0xce - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1c, offset 0xd4 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0024, lo: 0x93, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x98, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0x1d, offset 0xe2 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb6, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x1e, offset 0xed - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xb1}, - // Block 0x1f, offset 0xf8 - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x20, offset 0x103 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x91, hi: 0x91}, - {value: 0x0010, lo: 0x99, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x21, offset 0x10f - {value: 0x0014, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x22, offset 0x119 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x85}, - {value: 0x0014, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x89, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - // Block 0x23, offset 0x124 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x24, offset 0x12f - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9c, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - // Block 0x25, offset 0x13b - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8a}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - {value: 0x0010, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0010, lo: 0xa8, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x26, offset 0x147 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x82}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x27, offset 0x14f - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb9}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbf}, - // Block 0x28, offset 0x157 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x88}, - {value: 0x0014, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0034, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - // Block 0x29, offset 0x161 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x2a, offset 0x16c - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x95, hi: 0x96}, - {value: 0x0010, lo: 0x9e, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb1, hi: 0xb2}, - // Block 0x2b, offset 0x178 - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0xba}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x2c, offset 0x17e - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8e, hi: 0x8e}, - {value: 0x0010, lo: 0x94, hi: 0x97}, - {value: 0x0010, lo: 0x9f, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa3}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xba, hi: 0xbf}, - // Block 0x2d, offset 0x189 - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x96}, - {value: 0x0010, lo: 0x9a, hi: 0xb1}, - {value: 0x0010, lo: 0xb3, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x2e, offset 0x18e - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x8f, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x94}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9f}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - // Block 0x2f, offset 0x196 - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xba}, - // Block 0x30, offset 0x199 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x87}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x31, offset 0x19e - {value: 0x0014, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb4, hi: 0xb7}, - {value: 0x0034, lo: 0xb8, hi: 0xb9}, - {value: 0x0014, lo: 0xbb, hi: 0xbc}, - // Block 0x32, offset 0x1a2 - {value: 0x0004, lo: 0x86, hi: 0x86}, - {value: 0x0034, lo: 0x88, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x33, offset 0x1a6 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0034, lo: 0x98, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0034, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x34, offset 0x1ad - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xac}, - {value: 0x0034, lo: 0xb1, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xba, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x35, offset 0x1b6 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0024, lo: 0x82, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0024, lo: 0x86, hi: 0x87}, - {value: 0x0010, lo: 0x88, hi: 0x8c}, - {value: 0x0014, lo: 0x8d, hi: 0x97}, - {value: 0x0014, lo: 0x99, hi: 0xbc}, - // Block 0x36, offset 0x1be - {value: 0x0034, lo: 0x86, hi: 0x86}, - // Block 0x37, offset 0x1bf - {value: 0x0010, lo: 0xab, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - {value: 0x0010, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbe}, - // Block 0x38, offset 0x1c8 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x96, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x99}, - {value: 0x0014, lo: 0x9e, hi: 0xa0}, - {value: 0x0010, lo: 0xa2, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xad}, - {value: 0x0014, lo: 0xb1, hi: 0xb4}, - // Block 0x39, offset 0x1cf - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x6c53, lo: 0xa0, hi: 0xbf}, - // Block 0x3a, offset 0x1d7 - {value: 0x7053, lo: 0x80, hi: 0x85}, - {value: 0x7053, lo: 0x87, hi: 0x87}, - {value: 0x7053, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xba}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x3b, offset 0x1dd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x9a, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x3c, offset 0x1e3 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x3d, offset 0x1e8 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x82, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3e, offset 0x1ec - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0010, lo: 0x92, hi: 0x95}, - {value: 0x0010, lo: 0x98, hi: 0xbf}, - // Block 0x3f, offset 0x1ef - {value: 0x0010, lo: 0x80, hi: 0x9a}, - {value: 0x0024, lo: 0x9d, hi: 0x9f}, - // Block 0x40, offset 0x1f1 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x7453, lo: 0xa0, hi: 0xaf}, - {value: 0x7853, lo: 0xb0, hi: 0xbf}, - // Block 0x41, offset 0x1f4 - {value: 0x7c53, lo: 0x80, hi: 0x8f}, - {value: 0x8053, lo: 0x90, hi: 0x9f}, - {value: 0x7c53, lo: 0xa0, hi: 0xaf}, - {value: 0x0813, lo: 0xb0, hi: 0xb5}, - {value: 0x0892, lo: 0xb8, hi: 0xbd}, - // Block 0x42, offset 0x1f9 - {value: 0x0010, lo: 0x81, hi: 0xbf}, - // Block 0x43, offset 0x1fa - {value: 0x0010, lo: 0x80, hi: 0xac}, - {value: 0x0010, lo: 0xaf, hi: 0xbf}, - // Block 0x44, offset 0x1fc - {value: 0x0010, lo: 0x81, hi: 0x9a}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x45, offset 0x1fe - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xae, hi: 0xb8}, - // Block 0x46, offset 0x200 - {value: 0x0010, lo: 0x80, hi: 0x8c}, - {value: 0x0010, lo: 0x8e, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0034, lo: 0x94, hi: 0x94}, - {value: 0x0010, lo: 0xa0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - // Block 0x47, offset 0x207 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0014, lo: 0x92, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xac}, - {value: 0x0010, lo: 0xae, hi: 0xb0}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - // Block 0x48, offset 0x20c - {value: 0x0014, lo: 0xb4, hi: 0xb5}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0x49, offset 0x210 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0014, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0014, lo: 0x89, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x92}, - {value: 0x0014, lo: 0x93, hi: 0x93}, - {value: 0x0004, lo: 0x97, hi: 0x97}, - {value: 0x0024, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0x4a, offset 0x219 - {value: 0x0014, lo: 0x8b, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x4b, offset 0x21c - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb7}, - // Block 0x4c, offset 0x21f - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x4d, offset 0x225 - {value: 0x0010, lo: 0x80, hi: 0xb5}, - // Block 0x4e, offset 0x226 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xb9}, - {value: 0x0024, lo: 0xba, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbb}, - // Block 0x4f, offset 0x231 - {value: 0x0010, lo: 0x86, hi: 0x8f}, - // Block 0x50, offset 0x232 - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x51, offset 0x233 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0024, lo: 0x97, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x98}, - {value: 0x0010, lo: 0x99, hi: 0x9a}, - {value: 0x0014, lo: 0x9b, hi: 0x9b}, - // Block 0x52, offset 0x238 - {value: 0x0010, lo: 0x95, hi: 0x95}, - {value: 0x0014, lo: 0x96, hi: 0x96}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0014, lo: 0x98, hi: 0x9e}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa2}, - {value: 0x0010, lo: 0xa3, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xac}, - {value: 0x0010, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0024, lo: 0xb5, hi: 0xbc}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x53, offset 0x245 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xa7, hi: 0xa7}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - {value: 0x0034, lo: 0xb5, hi: 0xba}, - {value: 0x0024, lo: 0xbb, hi: 0xbc}, - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0x54, offset 0x24d - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x55, offset 0x255 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x83}, - {value: 0x0030, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x8b}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xab, hi: 0xab}, - {value: 0x0034, lo: 0xac, hi: 0xac}, - {value: 0x0024, lo: 0xad, hi: 0xb3}, - // Block 0x56, offset 0x25e - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0030, lo: 0xaa, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xbf}, - // Block 0x57, offset 0x267 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa9}, - {value: 0x0010, lo: 0xaa, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0030, lo: 0xb2, hi: 0xb3}, - // Block 0x58, offset 0x270 - {value: 0x0010, lo: 0x80, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0x59, offset 0x275 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8d, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x5a, offset 0x278 - {value: 0x296a, lo: 0x80, hi: 0x80}, - {value: 0x2a2a, lo: 0x81, hi: 0x81}, - {value: 0x2aea, lo: 0x82, hi: 0x82}, - {value: 0x2baa, lo: 0x83, hi: 0x83}, - {value: 0x2c6a, lo: 0x84, hi: 0x84}, - {value: 0x2d2a, lo: 0x85, hi: 0x85}, - {value: 0x2dea, lo: 0x86, hi: 0x86}, - {value: 0x2eaa, lo: 0x87, hi: 0x87}, - {value: 0x2f6a, lo: 0x88, hi: 0x88}, - // Block 0x5b, offset 0x281 - {value: 0x0024, lo: 0x90, hi: 0x92}, - {value: 0x0034, lo: 0x94, hi: 0x99}, - {value: 0x0024, lo: 0x9a, hi: 0x9b}, - {value: 0x0034, lo: 0x9c, hi: 0x9f}, - {value: 0x0024, lo: 0xa0, hi: 0xa0}, - {value: 0x0010, lo: 0xa1, hi: 0xa1}, - {value: 0x0034, lo: 0xa2, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xb3}, - {value: 0x0024, lo: 0xb4, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb6}, - {value: 0x0024, lo: 0xb8, hi: 0xb9}, - // Block 0x5c, offset 0x28e - {value: 0x0012, lo: 0x80, hi: 0xab}, - {value: 0x0015, lo: 0xac, hi: 0xbf}, - // Block 0x5d, offset 0x290 - {value: 0x0015, lo: 0x80, hi: 0xaa}, - {value: 0x0012, lo: 0xab, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb8}, - {value: 0x8452, lo: 0xb9, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbc}, - {value: 0x8852, lo: 0xbd, hi: 0xbd}, - {value: 0x0012, lo: 0xbe, hi: 0xbf}, - // Block 0x5e, offset 0x297 - {value: 0x0012, lo: 0x80, hi: 0x9a}, - {value: 0x0015, lo: 0x9b, hi: 0xbf}, - // Block 0x5f, offset 0x299 - {value: 0x0024, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0024, lo: 0x83, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0024, lo: 0x8b, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x90}, - {value: 0x0024, lo: 0x91, hi: 0xb5}, - {value: 0x0024, lo: 0xbb, hi: 0xbb}, - {value: 0x0034, lo: 0xbc, hi: 0xbd}, - {value: 0x0024, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x60, offset 0x2a4 - {value: 0x0117, lo: 0x80, hi: 0xbf}, - // Block 0x61, offset 0x2a5 - {value: 0x0117, lo: 0x80, hi: 0x95}, - {value: 0x306a, lo: 0x96, hi: 0x96}, - {value: 0x316a, lo: 0x97, hi: 0x97}, - {value: 0x326a, lo: 0x98, hi: 0x98}, - {value: 0x336a, lo: 0x99, hi: 0x99}, - {value: 0x346a, lo: 0x9a, hi: 0x9a}, - {value: 0x356a, lo: 0x9b, hi: 0x9b}, - {value: 0x0012, lo: 0x9c, hi: 0x9d}, - {value: 0x366b, lo: 0x9e, hi: 0x9e}, - {value: 0x0012, lo: 0x9f, hi: 0x9f}, - {value: 0x0117, lo: 0xa0, hi: 0xbf}, - // Block 0x62, offset 0x2b0 - {value: 0x0812, lo: 0x80, hi: 0x87}, - {value: 0x0813, lo: 0x88, hi: 0x8f}, - {value: 0x0812, lo: 0x90, hi: 0x95}, - {value: 0x0813, lo: 0x98, hi: 0x9d}, - {value: 0x0812, lo: 0xa0, hi: 0xa7}, - {value: 0x0813, lo: 0xa8, hi: 0xaf}, - {value: 0x0812, lo: 0xb0, hi: 0xb7}, - {value: 0x0813, lo: 0xb8, hi: 0xbf}, - // Block 0x63, offset 0x2b8 - {value: 0x0004, lo: 0x8b, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8f}, - {value: 0x0054, lo: 0x98, hi: 0x99}, - {value: 0x0054, lo: 0xa4, hi: 0xa4}, - {value: 0x0054, lo: 0xa7, hi: 0xa7}, - {value: 0x0014, lo: 0xaa, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xaf}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x64, offset 0x2c0 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x94, hi: 0x94}, - {value: 0x0014, lo: 0xa0, hi: 0xa4}, - {value: 0x0014, lo: 0xa6, hi: 0xaf}, - {value: 0x0015, lo: 0xb1, hi: 0xb1}, - {value: 0x0015, lo: 0xbf, hi: 0xbf}, - // Block 0x65, offset 0x2c6 - {value: 0x0015, lo: 0x90, hi: 0x9c}, - // Block 0x66, offset 0x2c7 - {value: 0x0024, lo: 0x90, hi: 0x91}, - {value: 0x0034, lo: 0x92, hi: 0x93}, - {value: 0x0024, lo: 0x94, hi: 0x97}, - {value: 0x0034, lo: 0x98, hi: 0x9a}, - {value: 0x0024, lo: 0x9b, hi: 0x9c}, - {value: 0x0014, lo: 0x9d, hi: 0xa0}, - {value: 0x0024, lo: 0xa1, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa4}, - {value: 0x0034, lo: 0xa5, hi: 0xa6}, - {value: 0x0024, lo: 0xa7, hi: 0xa7}, - {value: 0x0034, lo: 0xa8, hi: 0xa8}, - {value: 0x0024, lo: 0xa9, hi: 0xa9}, - {value: 0x0034, lo: 0xaa, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - // Block 0x67, offset 0x2d5 - {value: 0x0016, lo: 0x85, hi: 0x86}, - {value: 0x0012, lo: 0x87, hi: 0x89}, - {value: 0x9d52, lo: 0x8e, hi: 0x8e}, - {value: 0x1013, lo: 0xa0, hi: 0xaf}, - {value: 0x1012, lo: 0xb0, hi: 0xbf}, - // Block 0x68, offset 0x2da - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0716, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x88}, - // Block 0x69, offset 0x2dd - {value: 0xa053, lo: 0xb6, hi: 0xb7}, - {value: 0xa353, lo: 0xb8, hi: 0xb9}, - {value: 0xa653, lo: 0xba, hi: 0xbb}, - {value: 0xa353, lo: 0xbc, hi: 0xbd}, - {value: 0xa053, lo: 0xbe, hi: 0xbf}, - // Block 0x6a, offset 0x2e2 - {value: 0x3013, lo: 0x80, hi: 0x8f}, - {value: 0x6553, lo: 0x90, hi: 0x9f}, - {value: 0xa953, lo: 0xa0, hi: 0xae}, - {value: 0x3012, lo: 0xb0, hi: 0xbf}, - // Block 0x6b, offset 0x2e6 - {value: 0x0117, lo: 0x80, hi: 0xa3}, - {value: 0x0012, lo: 0xa4, hi: 0xa4}, - {value: 0x0716, lo: 0xab, hi: 0xac}, - {value: 0x0316, lo: 0xad, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xb3}, - // Block 0x6c, offset 0x2ec - {value: 0x6c52, lo: 0x80, hi: 0x9f}, - {value: 0x7052, lo: 0xa0, hi: 0xa5}, - {value: 0x7052, lo: 0xa7, hi: 0xa7}, - {value: 0x7052, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x6d, offset 0x2f1 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0x6e, offset 0x2f4 - {value: 0x0010, lo: 0x80, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0010, lo: 0xb0, hi: 0xb6}, - {value: 0x0010, lo: 0xb8, hi: 0xbe}, - // Block 0x6f, offset 0x2f9 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x8e}, - {value: 0x0010, lo: 0x90, hi: 0x96}, - {value: 0x0010, lo: 0x98, hi: 0x9e}, - {value: 0x0024, lo: 0xa0, hi: 0xbf}, - // Block 0x70, offset 0x2fe - {value: 0x0014, lo: 0xaf, hi: 0xaf}, - // Block 0x71, offset 0x2ff - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0xaa, hi: 0xad}, - {value: 0x0030, lo: 0xae, hi: 0xaf}, - {value: 0x0004, lo: 0xb1, hi: 0xb5}, - {value: 0x0014, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - // Block 0x72, offset 0x305 - {value: 0x0034, lo: 0x99, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9e}, - // Block 0x73, offset 0x307 - {value: 0x0004, lo: 0xbc, hi: 0xbe}, - // Block 0x74, offset 0x308 - {value: 0x0010, lo: 0x85, hi: 0xad}, - {value: 0x0010, lo: 0xb1, hi: 0xbf}, - // Block 0x75, offset 0x30a - {value: 0x0010, lo: 0x80, hi: 0x8e}, - {value: 0x0010, lo: 0xa0, hi: 0xba}, - // Block 0x76, offset 0x30c - {value: 0x0010, lo: 0x80, hi: 0x94}, - {value: 0x0014, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0x96, hi: 0xbf}, - // Block 0x77, offset 0x30f - {value: 0x0010, lo: 0x80, hi: 0x8c}, - // Block 0x78, offset 0x310 - {value: 0x0010, lo: 0x90, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - // Block 0x79, offset 0x312 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0xab}, - // Block 0x7a, offset 0x315 - {value: 0x0117, lo: 0x80, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xae}, - {value: 0x0024, lo: 0xaf, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb2}, - {value: 0x0024, lo: 0xb4, hi: 0xbd}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x7b, offset 0x31b - {value: 0x0117, lo: 0x80, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9d}, - {value: 0x0024, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0x7c, offset 0x31f - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb1}, - // Block 0x7d, offset 0x321 - {value: 0x0004, lo: 0x80, hi: 0x96}, - {value: 0x0014, lo: 0x97, hi: 0x9f}, - {value: 0x0004, lo: 0xa0, hi: 0xa1}, - {value: 0x0117, lo: 0xa2, hi: 0xaf}, - {value: 0x0012, lo: 0xb0, hi: 0xb1}, - {value: 0x0117, lo: 0xb2, hi: 0xbf}, - // Block 0x7e, offset 0x327 - {value: 0x0117, lo: 0x80, hi: 0xaf}, - {value: 0x0015, lo: 0xb0, hi: 0xb0}, - {value: 0x0012, lo: 0xb1, hi: 0xb8}, - {value: 0x0316, lo: 0xb9, hi: 0xba}, - {value: 0x0716, lo: 0xbb, hi: 0xbc}, - {value: 0x8453, lo: 0xbd, hi: 0xbd}, - {value: 0x0117, lo: 0xbe, hi: 0xbf}, - // Block 0x7f, offset 0x32e - {value: 0x0010, lo: 0xb7, hi: 0xb7}, - {value: 0x0015, lo: 0xb8, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbf}, - // Block 0x80, offset 0x332 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0014, lo: 0x82, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8b}, - {value: 0x0010, lo: 0x8c, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa6}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - // Block 0x81, offset 0x33b - {value: 0x0010, lo: 0x80, hi: 0xb3}, - // Block 0x82, offset 0x33c - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0034, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x85, hi: 0x85}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0024, lo: 0xa0, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb7}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x83, offset 0x344 - {value: 0x0010, lo: 0x80, hi: 0xa5}, - {value: 0x0014, lo: 0xa6, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x84, offset 0x348 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0014, lo: 0x87, hi: 0x91}, - {value: 0x0010, lo: 0x92, hi: 0x92}, - {value: 0x0030, lo: 0x93, hi: 0x93}, - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0x85, offset 0x34d - {value: 0x0014, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xb9}, - {value: 0x0010, lo: 0xba, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0x86, offset 0x355 - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0004, lo: 0xa6, hi: 0xa6}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x87, offset 0x35b - {value: 0x0010, lo: 0x80, hi: 0xa8}, - {value: 0x0014, lo: 0xa9, hi: 0xae}, - {value: 0x0010, lo: 0xaf, hi: 0xb0}, - {value: 0x0014, lo: 0xb1, hi: 0xb2}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0x88, offset 0x361 - {value: 0x0010, lo: 0x80, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x8b}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0010, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbd}, - // Block 0x89, offset 0x36b - {value: 0x0024, lo: 0xb0, hi: 0xb0}, - {value: 0x0024, lo: 0xb2, hi: 0xb3}, - {value: 0x0034, lo: 0xb4, hi: 0xb4}, - {value: 0x0024, lo: 0xb7, hi: 0xb8}, - {value: 0x0024, lo: 0xbe, hi: 0xbf}, - // Block 0x8a, offset 0x370 - {value: 0x0024, lo: 0x81, hi: 0x81}, - {value: 0x0004, lo: 0x9d, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xab}, - {value: 0x0014, lo: 0xac, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb2, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - // Block 0x8b, offset 0x379 - {value: 0x0010, lo: 0x81, hi: 0x86}, - {value: 0x0010, lo: 0x89, hi: 0x8e}, - {value: 0x0010, lo: 0x91, hi: 0x96}, - {value: 0x0010, lo: 0xa0, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0x8c, offset 0x37f - {value: 0x0012, lo: 0x80, hi: 0x92}, - {value: 0xac52, lo: 0x93, hi: 0x93}, - {value: 0x0012, lo: 0x94, hi: 0x9a}, - {value: 0x0004, lo: 0x9b, hi: 0x9b}, - {value: 0x0015, lo: 0x9c, hi: 0x9f}, - {value: 0x0012, lo: 0xa0, hi: 0xa5}, - {value: 0x74d2, lo: 0xb0, hi: 0xbf}, - // Block 0x8d, offset 0x386 - {value: 0x78d2, lo: 0x80, hi: 0x8f}, - {value: 0x7cd2, lo: 0x90, hi: 0x9f}, - {value: 0x80d2, lo: 0xa0, hi: 0xaf}, - {value: 0x7cd2, lo: 0xb0, hi: 0xbf}, - // Block 0x8e, offset 0x38a - {value: 0x0010, lo: 0x80, hi: 0xa4}, - {value: 0x0014, lo: 0xa5, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa7}, - {value: 0x0014, lo: 0xa8, hi: 0xa8}, - {value: 0x0010, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0034, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0x8f, offset 0x392 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0x90, offset 0x394 - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x8b, hi: 0xbb}, - // Block 0x91, offset 0x396 - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x86, hi: 0xbf}, - // Block 0x92, offset 0x399 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0004, lo: 0xb2, hi: 0xbf}, - // Block 0x93, offset 0x39b - {value: 0x0004, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x93, hi: 0xbf}, - // Block 0x94, offset 0x39d - {value: 0x0010, lo: 0x80, hi: 0xbd}, - // Block 0x95, offset 0x39e - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0x96, offset 0x39f - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0xbf}, - // Block 0x97, offset 0x3a1 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0xb0, hi: 0xbb}, - // Block 0x98, offset 0x3a3 - {value: 0x0014, lo: 0x80, hi: 0x8f}, - {value: 0x0054, lo: 0x93, hi: 0x93}, - {value: 0x0024, lo: 0xa0, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xad}, - {value: 0x0024, lo: 0xae, hi: 0xaf}, - {value: 0x0010, lo: 0xb3, hi: 0xb4}, - // Block 0x99, offset 0x3a9 - {value: 0x0010, lo: 0x8d, hi: 0x8f}, - {value: 0x0054, lo: 0x92, hi: 0x92}, - {value: 0x0054, lo: 0x95, hi: 0x95}, - {value: 0x0010, lo: 0xb0, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0x9a, offset 0x3ae - {value: 0x0010, lo: 0x80, hi: 0xbc}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0x9b, offset 0x3b0 - {value: 0x0054, lo: 0x87, hi: 0x87}, - {value: 0x0054, lo: 0x8e, hi: 0x8e}, - {value: 0x0054, lo: 0x9a, hi: 0x9a}, - {value: 0x5f53, lo: 0xa1, hi: 0xba}, - {value: 0x0004, lo: 0xbe, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0x9c, offset 0x3b6 - {value: 0x0004, lo: 0x80, hi: 0x80}, - {value: 0x5f52, lo: 0x81, hi: 0x9a}, - {value: 0x0004, lo: 0xb0, hi: 0xb0}, - // Block 0x9d, offset 0x3b9 - {value: 0x0014, lo: 0x9e, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xbe}, - // Block 0x9e, offset 0x3bb - {value: 0x0010, lo: 0x82, hi: 0x87}, - {value: 0x0010, lo: 0x8a, hi: 0x8f}, - {value: 0x0010, lo: 0x92, hi: 0x97}, - {value: 0x0010, lo: 0x9a, hi: 0x9c}, - {value: 0x0004, lo: 0xa3, hi: 0xa3}, - {value: 0x0014, lo: 0xb9, hi: 0xbb}, - // Block 0x9f, offset 0x3c1 - {value: 0x0010, lo: 0x80, hi: 0x8b}, - {value: 0x0010, lo: 0x8d, hi: 0xa6}, - {value: 0x0010, lo: 0xa8, hi: 0xba}, - {value: 0x0010, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xa0, offset 0x3c6 - {value: 0x0010, lo: 0x80, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x9d}, - // Block 0xa1, offset 0x3c8 - {value: 0x0010, lo: 0x80, hi: 0xba}, - // Block 0xa2, offset 0x3c9 - {value: 0x0010, lo: 0x80, hi: 0xb4}, - // Block 0xa3, offset 0x3ca - {value: 0x0034, lo: 0xbd, hi: 0xbd}, - // Block 0xa4, offset 0x3cb - {value: 0x0010, lo: 0x80, hi: 0x9c}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa5, offset 0x3cd - {value: 0x0010, lo: 0x80, hi: 0x90}, - {value: 0x0034, lo: 0xa0, hi: 0xa0}, - // Block 0xa6, offset 0x3cf - {value: 0x0010, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xa7, offset 0x3d1 - {value: 0x0010, lo: 0x80, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0xb5}, - {value: 0x0024, lo: 0xb6, hi: 0xba}, - // Block 0xa8, offset 0x3d4 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xbf}, - // Block 0xa9, offset 0x3d6 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x91, hi: 0x95}, - // Block 0xaa, offset 0x3d9 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x97}, - {value: 0xaf53, lo: 0x98, hi: 0x9f}, - {value: 0xb253, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbf}, - // Block 0xab, offset 0x3e1 - {value: 0xaf52, lo: 0x80, hi: 0x87}, - {value: 0xb252, lo: 0x88, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0xbf}, - // Block 0xac, offset 0x3e4 - {value: 0x0010, lo: 0x80, hi: 0x9d}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0xb253, lo: 0xb0, hi: 0xb7}, - {value: 0xaf53, lo: 0xb8, hi: 0xbf}, - // Block 0xad, offset 0x3e8 - {value: 0x2813, lo: 0x80, hi: 0x87}, - {value: 0x3813, lo: 0x88, hi: 0x8f}, - {value: 0x2813, lo: 0x90, hi: 0x93}, - {value: 0xb252, lo: 0x98, hi: 0x9f}, - {value: 0xaf52, lo: 0xa0, hi: 0xa7}, - {value: 0x2812, lo: 0xa8, hi: 0xaf}, - {value: 0x3812, lo: 0xb0, hi: 0xb7}, - {value: 0x2812, lo: 0xb8, hi: 0xbb}, - // Block 0xae, offset 0x3f0 - {value: 0x0010, lo: 0x80, hi: 0xa7}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xaf, offset 0x3f2 - {value: 0x0010, lo: 0x80, hi: 0xa3}, - // Block 0xb0, offset 0x3f3 - {value: 0x0010, lo: 0x80, hi: 0xb6}, - // Block 0xb1, offset 0x3f4 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xa7}, - // Block 0xb2, offset 0x3f6 - {value: 0x0010, lo: 0x80, hi: 0x85}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xb5}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0010, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xb3, offset 0x3fc - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb6}, - // Block 0xb4, offset 0x3fe - {value: 0x0010, lo: 0x80, hi: 0x9e}, - // Block 0xb5, offset 0x3ff - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb5}, - // Block 0xb6, offset 0x401 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb9}, - // Block 0xb7, offset 0x403 - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0010, lo: 0xbe, hi: 0xbf}, - // Block 0xb8, offset 0x405 - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x83}, - {value: 0x0014, lo: 0x85, hi: 0x86}, - {value: 0x0014, lo: 0x8c, hi: 0x8c}, - {value: 0x0034, lo: 0x8d, hi: 0x8d}, - {value: 0x0014, lo: 0x8e, hi: 0x8e}, - {value: 0x0024, lo: 0x8f, hi: 0x8f}, - {value: 0x0010, lo: 0x90, hi: 0x93}, - {value: 0x0010, lo: 0x95, hi: 0x97}, - {value: 0x0010, lo: 0x99, hi: 0xb3}, - {value: 0x0024, lo: 0xb8, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xb9, offset 0x412 - {value: 0x0010, lo: 0xa0, hi: 0xbc}, - // Block 0xba, offset 0x413 - {value: 0x0010, lo: 0x80, hi: 0x9c}, - // Block 0xbb, offset 0x414 - {value: 0x0010, lo: 0x80, hi: 0x87}, - {value: 0x0010, lo: 0x89, hi: 0xa4}, - {value: 0x0024, lo: 0xa5, hi: 0xa5}, - {value: 0x0034, lo: 0xa6, hi: 0xa6}, - // Block 0xbc, offset 0x418 - {value: 0x0010, lo: 0x80, hi: 0x95}, - {value: 0x0010, lo: 0xa0, hi: 0xb2}, - // Block 0xbd, offset 0x41a - {value: 0x0010, lo: 0x80, hi: 0x91}, - // Block 0xbe, offset 0x41b - {value: 0x0010, lo: 0x80, hi: 0x88}, - // Block 0xbf, offset 0x41c - {value: 0x5653, lo: 0x80, hi: 0xb2}, - // Block 0xc0, offset 0x41d - {value: 0x5652, lo: 0x80, hi: 0xb2}, - // Block 0xc1, offset 0x41e - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xc2, offset 0x422 - {value: 0x0014, lo: 0x80, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0xa6, hi: 0xaf}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xc3, offset 0x426 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb6}, - {value: 0x0010, lo: 0xb7, hi: 0xb8}, - {value: 0x0034, lo: 0xb9, hi: 0xba}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - // Block 0xc4, offset 0x42c - {value: 0x0010, lo: 0x90, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xc5, offset 0x42e - {value: 0x0024, lo: 0x80, hi: 0x82}, - {value: 0x0010, lo: 0x83, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb4}, - {value: 0x0010, lo: 0xb6, hi: 0xbf}, - // Block 0xc6, offset 0x435 - {value: 0x0010, lo: 0x90, hi: 0xb2}, - {value: 0x0034, lo: 0xb3, hi: 0xb3}, - {value: 0x0010, lo: 0xb6, hi: 0xb6}, - // Block 0xc7, offset 0x438 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0xb5}, - {value: 0x0014, lo: 0xb6, hi: 0xbe}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xc8, offset 0x43c - {value: 0x0030, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0014, lo: 0x8b, hi: 0x8c}, - {value: 0x0010, lo: 0x90, hi: 0x9a}, - {value: 0x0010, lo: 0x9c, hi: 0x9c}, - // Block 0xc9, offset 0x442 - {value: 0x0010, lo: 0x80, hi: 0x91}, - {value: 0x0010, lo: 0x93, hi: 0xae}, - {value: 0x0014, lo: 0xaf, hi: 0xb1}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0014, lo: 0xb4, hi: 0xb4}, - {value: 0x0030, lo: 0xb5, hi: 0xb5}, - {value: 0x0034, lo: 0xb6, hi: 0xb6}, - {value: 0x0014, lo: 0xb7, hi: 0xb7}, - {value: 0x0014, lo: 0xbe, hi: 0xbe}, - // Block 0xca, offset 0x44b - {value: 0x0010, lo: 0x80, hi: 0x86}, - {value: 0x0010, lo: 0x88, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0x8d}, - {value: 0x0010, lo: 0x8f, hi: 0x9d}, - {value: 0x0010, lo: 0x9f, hi: 0xa8}, - {value: 0x0010, lo: 0xb0, hi: 0xbf}, - // Block 0xcb, offset 0x451 - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0014, lo: 0x9f, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa2}, - {value: 0x0014, lo: 0xa3, hi: 0xa8}, - {value: 0x0034, lo: 0xa9, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xcc, offset 0x457 - {value: 0x0014, lo: 0x80, hi: 0x81}, - {value: 0x0010, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x8c}, - {value: 0x0010, lo: 0x8f, hi: 0x90}, - {value: 0x0010, lo: 0x93, hi: 0xa8}, - {value: 0x0010, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb5, hi: 0xb9}, - {value: 0x0034, lo: 0xbc, hi: 0xbc}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xcd, offset 0x461 - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x84}, - {value: 0x0010, lo: 0x87, hi: 0x88}, - {value: 0x0010, lo: 0x8b, hi: 0x8c}, - {value: 0x0030, lo: 0x8d, hi: 0x8d}, - {value: 0x0010, lo: 0x90, hi: 0x90}, - {value: 0x0010, lo: 0x97, hi: 0x97}, - {value: 0x0010, lo: 0x9d, hi: 0xa3}, - {value: 0x0024, lo: 0xa6, hi: 0xac}, - {value: 0x0024, lo: 0xb0, hi: 0xb4}, - // Block 0xce, offset 0x46b - {value: 0x0010, lo: 0x80, hi: 0xb7}, - {value: 0x0014, lo: 0xb8, hi: 0xbf}, - // Block 0xcf, offset 0x46d - {value: 0x0010, lo: 0x80, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x82}, - {value: 0x0014, lo: 0x83, hi: 0x84}, - {value: 0x0010, lo: 0x85, hi: 0x85}, - {value: 0x0034, lo: 0x86, hi: 0x86}, - {value: 0x0010, lo: 0x87, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd0, offset 0x474 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xb8}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0014, lo: 0xba, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbe}, - {value: 0x0014, lo: 0xbf, hi: 0xbf}, - // Block 0xd1, offset 0x47a - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x81, hi: 0x81}, - {value: 0x0034, lo: 0x82, hi: 0x83}, - {value: 0x0010, lo: 0x84, hi: 0x85}, - {value: 0x0010, lo: 0x87, hi: 0x87}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd2, offset 0x480 - {value: 0x0010, lo: 0x80, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb5}, - {value: 0x0010, lo: 0xb8, hi: 0xbb}, - {value: 0x0014, lo: 0xbc, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd3, offset 0x486 - {value: 0x0034, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x98, hi: 0x9b}, - {value: 0x0014, lo: 0x9c, hi: 0x9d}, - // Block 0xd4, offset 0x489 - {value: 0x0010, lo: 0x80, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0010, lo: 0xbb, hi: 0xbc}, - {value: 0x0014, lo: 0xbd, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xd5, offset 0x48f - {value: 0x0014, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x84, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0xd6, offset 0x492 - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0014, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xac, hi: 0xac}, - {value: 0x0014, lo: 0xad, hi: 0xad}, - {value: 0x0010, lo: 0xae, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb5}, - {value: 0x0030, lo: 0xb6, hi: 0xb6}, - {value: 0x0034, lo: 0xb7, hi: 0xb7}, - // Block 0xd7, offset 0x49a - {value: 0x0010, lo: 0x80, hi: 0x89}, - // Block 0xd8, offset 0x49b - {value: 0x0014, lo: 0x9d, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa1}, - {value: 0x0014, lo: 0xa2, hi: 0xa5}, - {value: 0x0010, lo: 0xa6, hi: 0xa6}, - {value: 0x0014, lo: 0xa7, hi: 0xaa}, - {value: 0x0034, lo: 0xab, hi: 0xab}, - {value: 0x0010, lo: 0xb0, hi: 0xb9}, - // Block 0xd9, offset 0x4a2 - {value: 0x5f53, lo: 0xa0, hi: 0xbf}, - // Block 0xda, offset 0x4a3 - {value: 0x5f52, lo: 0x80, hi: 0x9f}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - {value: 0x0010, lo: 0xbf, hi: 0xbf}, - // Block 0xdb, offset 0x4a6 - {value: 0x0010, lo: 0x80, hi: 0xb8}, - // Block 0xdc, offset 0x4a7 - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x8a, hi: 0xaf}, - {value: 0x0014, lo: 0xb0, hi: 0xb6}, - {value: 0x0014, lo: 0xb8, hi: 0xbd}, - {value: 0x0010, lo: 0xbe, hi: 0xbe}, - {value: 0x0034, lo: 0xbf, hi: 0xbf}, - // Block 0xdd, offset 0x4ad - {value: 0x0010, lo: 0x80, hi: 0x80}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xb2, hi: 0xbf}, - // Block 0xde, offset 0x4b0 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - {value: 0x0014, lo: 0x92, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xa9}, - {value: 0x0014, lo: 0xaa, hi: 0xb0}, - {value: 0x0010, lo: 0xb1, hi: 0xb1}, - {value: 0x0014, lo: 0xb2, hi: 0xb3}, - {value: 0x0010, lo: 0xb4, hi: 0xb4}, - {value: 0x0014, lo: 0xb5, hi: 0xb6}, - // Block 0xdf, offset 0x4b8 - {value: 0x0010, lo: 0x80, hi: 0x99}, - // Block 0xe0, offset 0x4b9 - {value: 0x0010, lo: 0x80, hi: 0xae}, - // Block 0xe1, offset 0x4ba - {value: 0x0010, lo: 0x80, hi: 0x83}, - // Block 0xe2, offset 0x4bb - {value: 0x0010, lo: 0x80, hi: 0x86}, - // Block 0xe3, offset 0x4bc - {value: 0x0010, lo: 0x80, hi: 0x9e}, - {value: 0x0010, lo: 0xa0, hi: 0xa9}, - // Block 0xe4, offset 0x4be - {value: 0x0010, lo: 0x90, hi: 0xad}, - {value: 0x0034, lo: 0xb0, hi: 0xb4}, - // Block 0xe5, offset 0x4c0 - {value: 0x0010, lo: 0x80, hi: 0xaf}, - {value: 0x0024, lo: 0xb0, hi: 0xb6}, - // Block 0xe6, offset 0x4c2 - {value: 0x0014, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0010, lo: 0xa3, hi: 0xb7}, - {value: 0x0010, lo: 0xbd, hi: 0xbf}, - // Block 0xe7, offset 0x4c6 - {value: 0x0010, lo: 0x80, hi: 0x8f}, - // Block 0xe8, offset 0x4c7 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0010, lo: 0x90, hi: 0xbe}, - // Block 0xe9, offset 0x4c9 - {value: 0x0014, lo: 0x8f, hi: 0x9f}, - // Block 0xea, offset 0x4ca - {value: 0x0014, lo: 0xa0, hi: 0xa0}, - // Block 0xeb, offset 0x4cb - {value: 0x0010, lo: 0x80, hi: 0xaa}, - {value: 0x0010, lo: 0xb0, hi: 0xbc}, - // Block 0xec, offset 0x4cd - {value: 0x0010, lo: 0x80, hi: 0x88}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - {value: 0x0014, lo: 0x9d, hi: 0x9d}, - {value: 0x0034, lo: 0x9e, hi: 0x9e}, - {value: 0x0014, lo: 0xa0, hi: 0xa3}, - // Block 0xed, offset 0x4d2 - {value: 0x0030, lo: 0xa5, hi: 0xa6}, - {value: 0x0034, lo: 0xa7, hi: 0xa9}, - {value: 0x0030, lo: 0xad, hi: 0xb2}, - {value: 0x0014, lo: 0xb3, hi: 0xba}, - {value: 0x0034, lo: 0xbb, hi: 0xbf}, - // Block 0xee, offset 0x4d7 - {value: 0x0034, lo: 0x80, hi: 0x82}, - {value: 0x0024, lo: 0x85, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8b}, - {value: 0x0024, lo: 0xaa, hi: 0xad}, - // Block 0xef, offset 0x4db - {value: 0x0024, lo: 0x82, hi: 0x84}, - // Block 0xf0, offset 0x4dc - {value: 0x0013, lo: 0x80, hi: 0x99}, - {value: 0x0012, lo: 0x9a, hi: 0xb3}, - {value: 0x0013, lo: 0xb4, hi: 0xbf}, - // Block 0xf1, offset 0x4df - {value: 0x0013, lo: 0x80, hi: 0x8d}, - {value: 0x0012, lo: 0x8e, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0xa7}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xf2, offset 0x4e3 - {value: 0x0013, lo: 0x80, hi: 0x81}, - {value: 0x0012, lo: 0x82, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0x9c}, - {value: 0x0013, lo: 0x9e, hi: 0x9f}, - {value: 0x0013, lo: 0xa2, hi: 0xa2}, - {value: 0x0013, lo: 0xa5, hi: 0xa6}, - {value: 0x0013, lo: 0xa9, hi: 0xac}, - {value: 0x0013, lo: 0xae, hi: 0xb5}, - {value: 0x0012, lo: 0xb6, hi: 0xb9}, - {value: 0x0012, lo: 0xbb, hi: 0xbb}, - {value: 0x0012, lo: 0xbd, hi: 0xbf}, - // Block 0xf3, offset 0x4ee - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0012, lo: 0x85, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xf4, offset 0x4f2 - {value: 0x0012, lo: 0x80, hi: 0x83}, - {value: 0x0013, lo: 0x84, hi: 0x85}, - {value: 0x0013, lo: 0x87, hi: 0x8a}, - {value: 0x0013, lo: 0x8d, hi: 0x94}, - {value: 0x0013, lo: 0x96, hi: 0x9c}, - {value: 0x0012, lo: 0x9e, hi: 0xb7}, - {value: 0x0013, lo: 0xb8, hi: 0xb9}, - {value: 0x0013, lo: 0xbb, hi: 0xbe}, - // Block 0xf5, offset 0x4fa - {value: 0x0013, lo: 0x80, hi: 0x84}, - {value: 0x0013, lo: 0x86, hi: 0x86}, - {value: 0x0013, lo: 0x8a, hi: 0x90}, - {value: 0x0012, lo: 0x92, hi: 0xab}, - {value: 0x0013, lo: 0xac, hi: 0xbf}, - // Block 0xf6, offset 0x4ff - {value: 0x0013, lo: 0x80, hi: 0x85}, - {value: 0x0012, lo: 0x86, hi: 0x9f}, - {value: 0x0013, lo: 0xa0, hi: 0xb9}, - {value: 0x0012, lo: 0xba, hi: 0xbf}, - // Block 0xf7, offset 0x503 - {value: 0x0012, lo: 0x80, hi: 0x93}, - {value: 0x0013, lo: 0x94, hi: 0xad}, - {value: 0x0012, lo: 0xae, hi: 0xbf}, - // Block 0xf8, offset 0x506 - {value: 0x0012, lo: 0x80, hi: 0x87}, - {value: 0x0013, lo: 0x88, hi: 0xa1}, - {value: 0x0012, lo: 0xa2, hi: 0xbb}, - {value: 0x0013, lo: 0xbc, hi: 0xbf}, - // Block 0xf9, offset 0x50a - {value: 0x0013, lo: 0x80, hi: 0x95}, - {value: 0x0012, lo: 0x96, hi: 0xaf}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0xfa, offset 0x50d - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0012, lo: 0x8a, hi: 0xa5}, - {value: 0x0013, lo: 0xa8, hi: 0xbf}, - // Block 0xfb, offset 0x510 - {value: 0x0013, lo: 0x80, hi: 0x80}, - {value: 0x0012, lo: 0x82, hi: 0x9a}, - {value: 0x0012, lo: 0x9c, hi: 0xa1}, - {value: 0x0013, lo: 0xa2, hi: 0xba}, - {value: 0x0012, lo: 0xbc, hi: 0xbf}, - // Block 0xfc, offset 0x515 - {value: 0x0012, lo: 0x80, hi: 0x94}, - {value: 0x0012, lo: 0x96, hi: 0x9b}, - {value: 0x0013, lo: 0x9c, hi: 0xb4}, - {value: 0x0012, lo: 0xb6, hi: 0xbf}, - // Block 0xfd, offset 0x519 - {value: 0x0012, lo: 0x80, hi: 0x8e}, - {value: 0x0012, lo: 0x90, hi: 0x95}, - {value: 0x0013, lo: 0x96, hi: 0xae}, - {value: 0x0012, lo: 0xb0, hi: 0xbf}, - // Block 0xfe, offset 0x51d - {value: 0x0012, lo: 0x80, hi: 0x88}, - {value: 0x0012, lo: 0x8a, hi: 0x8f}, - {value: 0x0013, lo: 0x90, hi: 0xa8}, - {value: 0x0012, lo: 0xaa, hi: 0xbf}, - // Block 0xff, offset 0x521 - {value: 0x0012, lo: 0x80, hi: 0x82}, - {value: 0x0012, lo: 0x84, hi: 0x89}, - {value: 0x0017, lo: 0x8a, hi: 0x8b}, - {value: 0x0010, lo: 0x8e, hi: 0xbf}, - // Block 0x100, offset 0x525 - {value: 0x0014, lo: 0x80, hi: 0xb6}, - {value: 0x0014, lo: 0xbb, hi: 0xbf}, - // Block 0x101, offset 0x527 - {value: 0x0014, lo: 0x80, hi: 0xac}, - {value: 0x0014, lo: 0xb5, hi: 0xb5}, - // Block 0x102, offset 0x529 - {value: 0x0014, lo: 0x84, hi: 0x84}, - {value: 0x0014, lo: 0x9b, hi: 0x9f}, - {value: 0x0014, lo: 0xa1, hi: 0xaf}, - // Block 0x103, offset 0x52c - {value: 0x0024, lo: 0x80, hi: 0x86}, - {value: 0x0024, lo: 0x88, hi: 0x98}, - {value: 0x0024, lo: 0x9b, hi: 0xa1}, - {value: 0x0024, lo: 0xa3, hi: 0xa4}, - {value: 0x0024, lo: 0xa6, hi: 0xaa}, - // Block 0x104, offset 0x531 - {value: 0x0010, lo: 0x80, hi: 0x84}, - {value: 0x0034, lo: 0x90, hi: 0x96}, - // Block 0x105, offset 0x533 - {value: 0xb552, lo: 0x80, hi: 0x81}, - {value: 0xb852, lo: 0x82, hi: 0x83}, - {value: 0x0024, lo: 0x84, hi: 0x89}, - {value: 0x0034, lo: 0x8a, hi: 0x8a}, - {value: 0x0010, lo: 0x90, hi: 0x99}, - // Block 0x106, offset 0x538 - {value: 0x0010, lo: 0x80, hi: 0x83}, - {value: 0x0010, lo: 0x85, hi: 0x9f}, - {value: 0x0010, lo: 0xa1, hi: 0xa2}, - {value: 0x0010, lo: 0xa4, hi: 0xa4}, - {value: 0x0010, lo: 0xa7, hi: 0xa7}, - {value: 0x0010, lo: 0xa9, hi: 0xb2}, - {value: 0x0010, lo: 0xb4, hi: 0xb7}, - {value: 0x0010, lo: 0xb9, hi: 0xb9}, - {value: 0x0010, lo: 0xbb, hi: 0xbb}, - // Block 0x107, offset 0x541 - {value: 0x0010, lo: 0x80, hi: 0x89}, - {value: 0x0010, lo: 0x8b, hi: 0x9b}, - {value: 0x0010, lo: 0xa1, hi: 0xa3}, - {value: 0x0010, lo: 0xa5, hi: 0xa9}, - {value: 0x0010, lo: 0xab, hi: 0xbb}, - // Block 0x108, offset 0x546 - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x109, offset 0x547 - {value: 0x0013, lo: 0x80, hi: 0x89}, - {value: 0x0013, lo: 0x90, hi: 0xa9}, - {value: 0x0013, lo: 0xb0, hi: 0xbf}, - // Block 0x10a, offset 0x54a - {value: 0x0013, lo: 0x80, hi: 0x89}, - // Block 0x10b, offset 0x54b - {value: 0x0004, lo: 0xbb, hi: 0xbf}, - // Block 0x10c, offset 0x54c - {value: 0x0014, lo: 0x81, hi: 0x81}, - {value: 0x0014, lo: 0xa0, hi: 0xbf}, - // Block 0x10d, offset 0x54e - {value: 0x0014, lo: 0x80, hi: 0xbf}, - // Block 0x10e, offset 0x54f - {value: 0x0014, lo: 0x80, hi: 0xaf}, -} - -// Total table size 13811 bytes (13KiB); checksum: 4CC48DA3 diff --git a/vendor/golang.org/x/text/cases/trieval.go b/vendor/golang.org/x/text/cases/trieval.go deleted file mode 100644 index fb221f84..00000000 --- a/vendor/golang.org/x/text/cases/trieval.go +++ /dev/null @@ -1,215 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package cases - -// This file contains definitions for interpreting the trie value of the case -// trie generated by "go run gen*.go". It is shared by both the generator -// program and the resultant package. Sharing is achieved by the generator -// copying gen_trieval.go to trieval.go and changing what's above this comment. - -// info holds case information for a single rune. It is the value returned -// by a trie lookup. Most mapping information can be stored in a single 16-bit -// value. If not, for example when a rune is mapped to multiple runes, the value -// stores some basic case data and an index into an array with additional data. -// -// The per-rune values have the following format: -// -// if (exception) { -// 15..5 unsigned exception index -// 4 unused -// } else { -// 15..8 XOR pattern or index to XOR pattern for case mapping -// Only 13..8 are used for XOR patterns. -// 7 inverseFold (fold to upper, not to lower) -// 6 index: interpret the XOR pattern as an index -// or isMid if case mode is cIgnorableUncased. -// 5..4 CCC: zero (normal or break), above or other -// } -// 3 exception: interpret this value as an exception index -// (TODO: is this bit necessary? Probably implied from case mode.) -// 2..0 case mode -// -// For the non-exceptional cases, a rune must be either uncased, lowercase or -// uppercase. If the rune is cased, the XOR pattern maps either a lowercase -// rune to uppercase or an uppercase rune to lowercase (applied to the 10 -// least-significant bits of the rune). -// -// See the definitions below for a more detailed description of the various -// bits. -type info uint16 - -const ( - casedMask = 0x0003 - fullCasedMask = 0x0007 - ignorableMask = 0x0006 - ignorableValue = 0x0004 - - inverseFoldBit = 1 << 7 - isMidBit = 1 << 6 - - exceptionBit = 1 << 3 - exceptionShift = 5 - numExceptionBits = 11 - - xorIndexBit = 1 << 6 - xorShift = 8 - - // There is no mapping if all xor bits and the exception bit are zero. - hasMappingMask = 0xff80 | exceptionBit -) - -// The case mode bits encodes the case type of a rune. This includes uncased, -// title, upper and lower case and case ignorable. (For a definition of these -// terms see Chapter 3 of The Unicode Standard Core Specification.) In some rare -// cases, a rune can be both cased and case-ignorable. This is encoded by -// cIgnorableCased. A rune of this type is always lower case. Some runes are -// cased while not having a mapping. -// -// A common pattern for scripts in the Unicode standard is for upper and lower -// case runes to alternate for increasing rune values (e.g. the accented Latin -// ranges starting from U+0100 and U+1E00 among others and some Cyrillic -// characters). We use this property by defining a cXORCase mode, where the case -// mode (always upper or lower case) is derived from the rune value. As the XOR -// pattern for case mappings is often identical for successive runes, using -// cXORCase can result in large series of identical trie values. This, in turn, -// allows us to better compress the trie blocks. -const ( - cUncased info = iota // 000 - cTitle // 001 - cLower // 010 - cUpper // 011 - cIgnorableUncased // 100 - cIgnorableCased // 101 // lower case if mappings exist - cXORCase // 11x // case is cLower | ((rune&1) ^ x) - - maxCaseMode = cUpper -) - -func (c info) isCased() bool { - return c&casedMask != 0 -} - -func (c info) isCaseIgnorable() bool { - return c&ignorableMask == ignorableValue -} - -func (c info) isNotCasedAndNotCaseIgnorable() bool { - return c&fullCasedMask == 0 -} - -func (c info) isCaseIgnorableAndNotCased() bool { - return c&fullCasedMask == cIgnorableUncased -} - -func (c info) isMid() bool { - return c&(fullCasedMask|isMidBit) == isMidBit|cIgnorableUncased -} - -// The case mapping implementation will need to know about various Canonical -// Combining Class (CCC) values. We encode two of these in the trie value: -// cccZero (0) and cccAbove (230). If the value is cccOther, it means that -// CCC(r) > 0, but not 230. A value of cccBreak means that CCC(r) == 0 and that -// the rune also has the break category Break (see below). -const ( - cccBreak info = iota << 4 - cccZero - cccAbove - cccOther - - cccMask = cccBreak | cccZero | cccAbove | cccOther -) - -const ( - starter = 0 - above = 230 - iotaSubscript = 240 -) - -// The exceptions slice holds data that does not fit in a normal info entry. -// The entry is pointed to by the exception index in an entry. It has the -// following format: -// -// Header -// byte 0: -// 7..6 unused -// 5..4 CCC type (same bits as entry) -// 3 unused -// 2..0 length of fold -// -// byte 1: -// 7..6 unused -// 5..3 length of 1st mapping of case type -// 2..0 length of 2nd mapping of case type -// -// case 1st 2nd -// lower -> upper, title -// upper -> lower, title -// title -> lower, upper -// -// Lengths with the value 0x7 indicate no value and implies no change. -// A length of 0 indicates a mapping to zero-length string. -// -// Body bytes: -// case folding bytes -// lowercase mapping bytes -// uppercase mapping bytes -// titlecase mapping bytes -// closure mapping bytes (for NFKC_Casefold). (TODO) -// -// Fallbacks: -// missing fold -> lower -// missing title -> upper -// all missing -> original rune -// -// exceptions starts with a dummy byte to enforce that there is no zero index -// value. -const ( - lengthMask = 0x07 - lengthBits = 3 - noChange = 0 -) - -// References to generated trie. - -var trie = newCaseTrie(0) - -var sparse = sparseBlocks{ - values: sparseValues[:], - offsets: sparseOffsets[:], -} - -// Sparse block lookup code. - -// valueRange is an entry in a sparse block. -type valueRange struct { - value uint16 - lo, hi byte -} - -type sparseBlocks struct { - values []valueRange - offsets []uint16 -} - -// lookup returns the value from values block n for byte b using binary search. -func (s *sparseBlocks) lookup(n uint32, b byte) uint16 { - lo := s.offsets[n] - hi := s.offsets[n+1] - for lo < hi { - m := lo + (hi-lo)/2 - r := s.values[m] - if r.lo <= b && b <= r.hi { - return r.value - } - if b < r.lo { - hi = m - } else { - lo = m + 1 - } - } - return 0 -} - -// lastRuneForTesting is the last rune used for testing. Everything after this -// is boring. -const lastRuneForTesting = rune(0x1FFFF) diff --git a/vendor/golang.org/x/text/internal/gen.go b/vendor/golang.org/x/text/internal/gen.go deleted file mode 100644 index 1d678af5..00000000 --- a/vendor/golang.org/x/text/internal/gen.go +++ /dev/null @@ -1,52 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -import ( - "log" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/language" - "golang.org/x/text/unicode/cldr" -) - -func main() { - r := gen.OpenCLDRCoreZip() - defer r.Close() - - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - if err != nil { - log.Fatalf("DecodeZip: %v", err) - } - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "internal") - - // Create parents table. - parents := make([]uint16, language.NumCompactTags) - for _, loc := range data.Locales() { - tag := language.MustParse(loc) - index, ok := language.CompactIndex(tag) - if !ok { - continue - } - parentIndex := 0 // und - for p := tag.Parent(); p != language.Und; p = p.Parent() { - if x, ok := language.CompactIndex(p); ok { - parentIndex = x - break - } - } - parents[index] = uint16(parentIndex) - } - - w.WriteComment(` - Parent maps a compact index of a tag to the compact index of the parent of - this tag.`) - w.WriteVar("Parent", parents) -} diff --git a/vendor/golang.org/x/text/internal/internal.go b/vendor/golang.org/x/text/internal/internal.go deleted file mode 100644 index b39dc212..00000000 --- a/vendor/golang.org/x/text/internal/internal.go +++ /dev/null @@ -1,51 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go - -// Package internal contains non-exported functionality that are used by -// packages in the text repository. -package internal - -import ( - "sort" - - "golang.org/x/text/language" -) - -// SortTags sorts tags in place. -func SortTags(tags []language.Tag) { - sort.Sort(sorter(tags)) -} - -type sorter []language.Tag - -func (s sorter) Len() int { - return len(s) -} - -func (s sorter) Swap(i, j int) { - s[i], s[j] = s[j], s[i] -} - -func (s sorter) Less(i, j int) bool { - return s[i].String() < s[j].String() -} - -// UniqueTags sorts and filters duplicate tags in place and returns a slice with -// only unique tags. -func UniqueTags(tags []language.Tag) []language.Tag { - if len(tags) <= 1 { - return tags - } - SortTags(tags) - k := 0 - for i := 1; i < len(tags); i++ { - if tags[k].String() < tags[i].String() { - k++ - tags[k] = tags[i] - } - } - return tags[:k+1] -} diff --git a/vendor/golang.org/x/text/internal/match.go b/vendor/golang.org/x/text/internal/match.go deleted file mode 100644 index a67fcaca..00000000 --- a/vendor/golang.org/x/text/internal/match.go +++ /dev/null @@ -1,67 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package internal - -// This file contains matchers that implement CLDR inheritance. -// -// See http://unicode.org/reports/tr35/#Locale_Inheritance. -// -// Some of the inheritance described in this document is already handled by -// the cldr package. - -import ( - "golang.org/x/text/language" -) - -// TODO: consider if (some of the) matching algorithm needs to be public after -// getting some feel about what is generic and what is specific. - -// NewInheritanceMatcher returns a matcher that matches based on the inheritance -// chain. -// -// The matcher uses canonicalization and the parent relationship to find a -// match. The resulting match will always be either Und or a language with the -// same language and script as the requested language. It will not match -// languages for which there is understood to be mutual or one-directional -// intelligibility. -// -// A Match will indicate an Exact match if the language matches after -// canonicalization and High if the matched tag is a parent. -func NewInheritanceMatcher(t []language.Tag) *InheritanceMatcher { - tags := &InheritanceMatcher{make(map[language.Tag]int)} - for i, tag := range t { - ct, err := language.All.Canonicalize(tag) - if err != nil { - ct = tag - } - tags.index[ct] = i - } - return tags -} - -type InheritanceMatcher struct { - index map[language.Tag]int -} - -func (m InheritanceMatcher) Match(want ...language.Tag) (language.Tag, int, language.Confidence) { - for _, t := range want { - ct, err := language.All.Canonicalize(t) - if err != nil { - ct = t - } - conf := language.Exact - for { - if index, ok := m.index[ct]; ok { - return ct, index, conf - } - if ct == language.Und { - break - } - ct = ct.Parent() - conf = language.High - } - } - return language.Und, 0, language.No -} diff --git a/vendor/golang.org/x/text/internal/tables.go b/vendor/golang.org/x/text/internal/tables.go deleted file mode 100644 index a53042aa..00000000 --- a/vendor/golang.org/x/text/internal/tables.go +++ /dev/null @@ -1,117 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package internal - -// Parent maps a compact index of a tag to the compact index of the parent of -// this tag. -var Parent = []uint16{ // 754 elements - // Entry 0 - 3F - 0x0000, 0x0053, 0x00e5, 0x0000, 0x0003, 0x0003, 0x0000, 0x0006, - 0x0000, 0x0008, 0x0000, 0x000a, 0x0000, 0x000c, 0x000c, 0x000c, - 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, - 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, - 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, 0x000c, - 0x000c, 0x0000, 0x0000, 0x002a, 0x0000, 0x002c, 0x0000, 0x002e, - 0x0000, 0x0000, 0x0031, 0x0030, 0x0030, 0x0000, 0x0035, 0x0000, - 0x0037, 0x0000, 0x0039, 0x0000, 0x003b, 0x0000, 0x003d, 0x0000, - // Entry 40 - 7F - 0x0000, 0x0040, 0x0000, 0x0042, 0x0042, 0x0000, 0x0045, 0x0045, - 0x0000, 0x0048, 0x0000, 0x004a, 0x0000, 0x0000, 0x004d, 0x004c, - 0x004c, 0x0000, 0x0051, 0x0051, 0x0051, 0x0051, 0x0000, 0x0056, - 0x0000, 0x0058, 0x0000, 0x005a, 0x0000, 0x005c, 0x005c, 0x0000, - 0x005f, 0x0000, 0x0061, 0x0000, 0x0063, 0x0000, 0x0065, 0x0065, - 0x0000, 0x0068, 0x0000, 0x006a, 0x006a, 0x006a, 0x006a, 0x006a, - 0x006a, 0x006a, 0x0000, 0x0072, 0x0000, 0x0074, 0x0000, 0x0076, - 0x0000, 0x0000, 0x0079, 0x0000, 0x007b, 0x0000, 0x007d, 0x0000, - // Entry 80 - BF - 0x007f, 0x007f, 0x0000, 0x0082, 0x0082, 0x0000, 0x0085, 0x0086, - 0x0086, 0x0086, 0x0085, 0x0087, 0x0086, 0x0086, 0x0086, 0x0085, - 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, - 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0087, 0x0086, 0x0086, - 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, - 0x0086, 0x0086, 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, - 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, - 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0086, 0x0085, 0x0086, - // Entry C0 - FF - 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, - 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, - 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0087, 0x0086, 0x0086, - 0x0087, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, - 0x0086, 0x0086, 0x0086, 0x0086, 0x0085, 0x0085, 0x0086, 0x0086, - 0x0085, 0x0086, 0x0086, 0x0086, 0x0086, 0x0086, 0x0000, 0x00ee, - 0x0000, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, - 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, 0x00f0, 0x00f0, 0x00f1, - // Entry 100 - 13F - 0x00f1, 0x00f0, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f0, 0x00f1, - 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x00f1, 0x0000, 0x010d, 0x0000, - 0x010f, 0x0000, 0x0111, 0x0000, 0x0113, 0x0113, 0x0000, 0x0116, - 0x0116, 0x0116, 0x0116, 0x0000, 0x011b, 0x0000, 0x011d, 0x0000, - 0x011f, 0x011f, 0x0000, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, - 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, - 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, - 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, - // Entry 140 - 17F - 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, - 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, 0x0122, - 0x0122, 0x0000, 0x0151, 0x0000, 0x0153, 0x0000, 0x0155, 0x0000, - 0x0157, 0x0000, 0x0159, 0x0000, 0x015b, 0x015b, 0x015b, 0x0000, - 0x015f, 0x0000, 0x0000, 0x0162, 0x0000, 0x0164, 0x0000, 0x0166, - 0x0166, 0x0166, 0x0000, 0x016a, 0x0000, 0x016c, 0x0000, 0x016e, - 0x0000, 0x0170, 0x0170, 0x0000, 0x0173, 0x0000, 0x0175, 0x0000, - 0x0177, 0x0000, 0x0179, 0x0000, 0x017b, 0x0000, 0x017d, 0x0000, - // Entry 180 - 1BF - 0x017f, 0x0000, 0x0181, 0x0181, 0x0181, 0x0181, 0x0000, 0x0000, - 0x0187, 0x0000, 0x0000, 0x018a, 0x0000, 0x018c, 0x0000, 0x0000, - 0x018f, 0x0000, 0x0191, 0x0000, 0x0000, 0x0194, 0x0000, 0x0000, - 0x0197, 0x0000, 0x0199, 0x0000, 0x019b, 0x0000, 0x019d, 0x0000, - 0x019f, 0x0000, 0x01a1, 0x0000, 0x01a3, 0x0000, 0x01a5, 0x0000, - 0x01a7, 0x0000, 0x01a9, 0x0000, 0x01ab, 0x01ab, 0x0000, 0x01ae, - 0x0000, 0x01b0, 0x0000, 0x01b2, 0x0000, 0x01b4, 0x0000, 0x01b6, - 0x0000, 0x0000, 0x01b9, 0x0000, 0x01bb, 0x0000, 0x01bd, 0x0000, - // Entry 1C0 - 1FF - 0x01bf, 0x0000, 0x01c1, 0x0000, 0x01c3, 0x0000, 0x01c5, 0x01c5, - 0x01c5, 0x01c5, 0x0000, 0x01ca, 0x0000, 0x01cc, 0x01cc, 0x0000, - 0x01cf, 0x0000, 0x01d1, 0x0000, 0x01d3, 0x0000, 0x01d5, 0x0000, - 0x01d7, 0x0000, 0x01d9, 0x01d9, 0x0000, 0x01dc, 0x0000, 0x01de, - 0x0000, 0x01e0, 0x0000, 0x01e2, 0x0000, 0x01e4, 0x0000, 0x01e6, - 0x0000, 0x01e8, 0x0000, 0x01ea, 0x0000, 0x01ec, 0x0000, 0x01ee, - 0x01ee, 0x01ee, 0x0000, 0x01f2, 0x0000, 0x01f4, 0x0000, 0x01f6, - 0x0000, 0x01f8, 0x0000, 0x0000, 0x01fb, 0x0000, 0x01fd, 0x01fd, - // Entry 200 - 23F - 0x0000, 0x0200, 0x0000, 0x0202, 0x0202, 0x0000, 0x0205, 0x0205, - 0x0000, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, 0x0208, - 0x0000, 0x0210, 0x0000, 0x0212, 0x0000, 0x0214, 0x0000, 0x0000, - 0x0000, 0x0000, 0x0000, 0x021a, 0x0000, 0x0000, 0x021d, 0x0000, - 0x021f, 0x021f, 0x0000, 0x0222, 0x0000, 0x0224, 0x0224, 0x0000, - 0x0000, 0x0228, 0x0227, 0x0227, 0x0000, 0x0000, 0x022d, 0x0000, - 0x022f, 0x0000, 0x0231, 0x0000, 0x023d, 0x0233, 0x023d, 0x023d, - 0x023d, 0x023d, 0x023d, 0x023d, 0x023d, 0x0233, 0x023d, 0x023d, - // Entry 240 - 27F - 0x0000, 0x0240, 0x0240, 0x0240, 0x0000, 0x0244, 0x0000, 0x0246, - 0x0000, 0x0248, 0x0248, 0x0000, 0x024b, 0x0000, 0x024d, 0x024d, - 0x024d, 0x024d, 0x024d, 0x024d, 0x0000, 0x0254, 0x0000, 0x0256, - 0x0000, 0x0258, 0x0000, 0x025a, 0x0000, 0x025c, 0x0000, 0x0000, - 0x025f, 0x025f, 0x025f, 0x0000, 0x0263, 0x0000, 0x0265, 0x0000, - 0x0267, 0x0000, 0x0000, 0x026a, 0x0269, 0x0269, 0x0000, 0x026e, - 0x0000, 0x0270, 0x0000, 0x0272, 0x0000, 0x0000, 0x0000, 0x0000, - 0x0277, 0x0000, 0x0000, 0x027a, 0x0000, 0x027c, 0x027c, 0x027c, - // Entry 280 - 2BF - 0x027c, 0x0000, 0x0281, 0x0281, 0x0281, 0x0000, 0x0285, 0x0285, - 0x0285, 0x0285, 0x0285, 0x0000, 0x028b, 0x028b, 0x028b, 0x028b, - 0x0000, 0x0000, 0x0000, 0x0000, 0x0293, 0x0293, 0x0293, 0x0000, - 0x0297, 0x0297, 0x0297, 0x0297, 0x0000, 0x0000, 0x029d, 0x029d, - 0x029d, 0x029d, 0x0000, 0x02a2, 0x0000, 0x02a4, 0x02a4, 0x0000, - 0x02a7, 0x0000, 0x02a9, 0x02a9, 0x0000, 0x0000, 0x02ad, 0x0000, - 0x0000, 0x02b0, 0x0000, 0x02b2, 0x02b2, 0x0000, 0x0000, 0x02b6, - 0x0000, 0x02b8, 0x0000, 0x02ba, 0x0000, 0x02bc, 0x0000, 0x02be, - // Entry 2C0 - 2FF - 0x02be, 0x0000, 0x0000, 0x02c2, 0x0000, 0x02c4, 0x02c1, 0x02c1, - 0x0000, 0x0000, 0x02c9, 0x02c8, 0x02c8, 0x0000, 0x0000, 0x02ce, - 0x0000, 0x02d0, 0x0000, 0x02d2, 0x0000, 0x0000, 0x02d5, 0x0000, - 0x0000, 0x0000, 0x02d9, 0x0000, 0x02db, 0x0000, 0x02dd, 0x0000, - 0x02df, 0x02df, 0x0000, 0x02e2, 0x0000, 0x02e4, 0x0000, 0x02e6, - 0x02e6, 0x02e6, 0x02e6, 0x02e6, 0x0000, 0x02ec, 0x02ed, 0x02ec, - 0x0000, 0x02f0, -} // Size: 1532 bytes - -// Total table size 1532 bytes (1KiB); checksum: 90718A2 diff --git a/vendor/golang.org/x/text/internal/tag/tag.go b/vendor/golang.org/x/text/internal/tag/tag.go deleted file mode 100644 index 2cf4ecd2..00000000 --- a/vendor/golang.org/x/text/internal/tag/tag.go +++ /dev/null @@ -1,100 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package tag contains functionality handling tags and related data. -package tag - -import "sort" - -// An Index converts tags to a compact numeric value. -// -// All elements are of size 4. Tags may be up to 4 bytes long. Excess bytes can -// be used to store additional information about the tag. -type Index string - -// Elem returns the element data at the given index. -func (s Index) Elem(x int) string { - return string(s[x*4 : x*4+4]) -} - -// Index reports the index of the given key or -1 if it could not be found. -// Only the first len(key) bytes from the start of the 4-byte entries will be -// considered for the search and the first match in Index will be returned. -func (s Index) Index(key []byte) int { - n := len(key) - // search the index of the first entry with an equal or higher value than - // key in s. - index := sort.Search(len(s)/4, func(i int) bool { - return cmp(s[i*4:i*4+n], key) != -1 - }) - i := index * 4 - if cmp(s[i:i+len(key)], key) != 0 { - return -1 - } - return index -} - -// Next finds the next occurrence of key after index x, which must have been -// obtained from a call to Index using the same key. It returns x+1 or -1. -func (s Index) Next(key []byte, x int) int { - if x++; x*4 < len(s) && cmp(s[x*4:x*4+len(key)], key) == 0 { - return x - } - return -1 -} - -// cmp returns an integer comparing a and b lexicographically. -func cmp(a Index, b []byte) int { - n := len(a) - if len(b) < n { - n = len(b) - } - for i, c := range b[:n] { - switch { - case a[i] > c: - return 1 - case a[i] < c: - return -1 - } - } - switch { - case len(a) < len(b): - return -1 - case len(a) > len(b): - return 1 - } - return 0 -} - -// Compare returns an integer comparing a and b lexicographically. -func Compare(a string, b []byte) int { - return cmp(Index(a), b) -} - -// FixCase reformats b to the same pattern of cases as form. -// If returns false if string b is malformed. -func FixCase(form string, b []byte) bool { - if len(form) != len(b) { - return false - } - for i, c := range b { - if form[i] <= 'Z' { - if c >= 'a' { - c -= 'z' - 'Z' - } - if c < 'A' || 'Z' < c { - return false - } - } else { - if c <= 'Z' { - c += 'z' - 'Z' - } - if c < 'a' || 'z' < c { - return false - } - } - b[i] = c - } - return true -} diff --git a/vendor/golang.org/x/text/language/Makefile b/vendor/golang.org/x/text/language/Makefile deleted file mode 100644 index 79f00578..00000000 --- a/vendor/golang.org/x/text/language/Makefile +++ /dev/null @@ -1,16 +0,0 @@ -# Copyright 2013 The Go Authors. All rights reserved. -# Use of this source code is governed by a BSD-style -# license that can be found in the LICENSE file. - -CLEANFILES+=maketables - -maketables: maketables.go - go build $^ - -tables: maketables - ./maketables > tables.go - gofmt -w -s tables.go - -# Build (but do not run) maketables during testing, -# just to make sure it still compiles. -testshort: maketables diff --git a/vendor/golang.org/x/text/language/common.go b/vendor/golang.org/x/text/language/common.go deleted file mode 100644 index 9d86e185..00000000 --- a/vendor/golang.org/x/text/language/common.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// This file contains code common to the maketables.go and the package code. - -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 - -const ( - langDeprecated langAliasType = iota - langMacro - langLegacy - - langAliasTypeUnknown langAliasType = -1 -) diff --git a/vendor/golang.org/x/text/language/coverage.go b/vendor/golang.org/x/text/language/coverage.go deleted file mode 100644 index 101fd23c..00000000 --- a/vendor/golang.org/x/text/language/coverage.go +++ /dev/null @@ -1,197 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "fmt" - "sort" -) - -// The Coverage interface is used to define the level of coverage of an -// internationalization service. Note that not all types are supported by all -// services. As lists may be generated on the fly, it is recommended that users -// of a Coverage cache the results. -type Coverage interface { - // Tags returns the list of supported tags. - Tags() []Tag - - // BaseLanguages returns the list of supported base languages. - BaseLanguages() []Base - - // Scripts returns the list of supported scripts. - Scripts() []Script - - // Regions returns the list of supported regions. - Regions() []Region -} - -var ( - // Supported defines a Coverage that lists all supported subtags. Tags - // always returns nil. - Supported Coverage = allSubtags{} -) - -// TODO: -// - Support Variants, numbering systems. -// - CLDR coverage levels. -// - Set of common tags defined in this package. - -type allSubtags struct{} - -// Regions returns the list of supported regions. As all regions are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" region is not returned. -func (s allSubtags) Regions() []Region { - reg := make([]Region, numRegions) - for i := range reg { - reg[i] = Region{regionID(i + 1)} - } - return reg -} - -// Scripts returns the list of supported scripts. As all scripts are in a -// consecutive range, it simply returns a slice of numbers in increasing order. -// The "undefined" script is not returned. -func (s allSubtags) Scripts() []Script { - scr := make([]Script, numScripts) - for i := range scr { - scr[i] = Script{scriptID(i + 1)} - } - return scr -} - -// BaseLanguages returns the list of all supported base languages. It generates -// the list by traversing the internal structures. -func (s allSubtags) BaseLanguages() []Base { - base := make([]Base, 0, numLanguages) - for i := 0; i < langNoIndexOffset; i++ { - // We included "und" already for the value 0. - if i != nonCanonicalUnd { - base = append(base, Base{langID(i)}) - } - } - i := langNoIndexOffset - for _, v := range langNoIndex { - for k := 0; k < 8; k++ { - if v&1 == 1 { - base = append(base, Base{langID(i)}) - } - v >>= 1 - i++ - } - } - return base -} - -// Tags always returns nil. -func (s allSubtags) Tags() []Tag { - return nil -} - -// coverage is used used by NewCoverage which is used as a convenient way for -// creating Coverage implementations for partially defined data. Very often a -// package will only need to define a subset of slices. coverage provides a -// convenient way to do this. Moreover, packages using NewCoverage, instead of -// their own implementation, will not break if later new slice types are added. -type coverage struct { - tags func() []Tag - bases func() []Base - scripts func() []Script - regions func() []Region -} - -func (s *coverage) Tags() []Tag { - if s.tags == nil { - return nil - } - return s.tags() -} - -// bases implements sort.Interface and is used to sort base languages. -type bases []Base - -func (b bases) Len() int { - return len(b) -} - -func (b bases) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bases) Less(i, j int) bool { - return b[i].langID < b[j].langID -} - -// BaseLanguages returns the result from calling s.bases if it is specified or -// otherwise derives the set of supported base languages from tags. -func (s *coverage) BaseLanguages() []Base { - if s.bases == nil { - tags := s.Tags() - if len(tags) == 0 { - return nil - } - a := make([]Base, len(tags)) - for i, t := range tags { - a[i] = Base{langID(t.lang)} - } - sort.Sort(bases(a)) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - k++ - a[k] = a[i] - } - } - return a[:k+1] - } - return s.bases() -} - -func (s *coverage) Scripts() []Script { - if s.scripts == nil { - return nil - } - return s.scripts() -} - -func (s *coverage) Regions() []Region { - if s.regions == nil { - return nil - } - return s.regions() -} - -// NewCoverage returns a Coverage for the given lists. It is typically used by -// packages providing internationalization services to define their level of -// coverage. A list may be of type []T or func() []T, where T is either Tag, -// Base, Script or Region. The returned Coverage derives the value for Bases -// from Tags if no func or slice for []Base is specified. For other unspecified -// types the returned Coverage will return nil for the respective methods. -func NewCoverage(list ...interface{}) Coverage { - s := &coverage{} - for _, x := range list { - switch v := x.(type) { - case func() []Base: - s.bases = v - case func() []Script: - s.scripts = v - case func() []Region: - s.regions = v - case func() []Tag: - s.tags = v - case []Base: - s.bases = func() []Base { return v } - case []Script: - s.scripts = func() []Script { return v } - case []Region: - s.regions = func() []Region { return v } - case []Tag: - s.tags = func() []Tag { return v } - default: - panic(fmt.Sprintf("language: unsupported set type %T", v)) - } - } - return s -} diff --git a/vendor/golang.org/x/text/language/gen.go b/vendor/golang.org/x/text/language/gen.go deleted file mode 100644 index 153269bc..00000000 --- a/vendor/golang.org/x/text/language/gen.go +++ /dev/null @@ -1,1699 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -// Language tag table generator. -// Data read from the web. - -package main - -import ( - "bufio" - "flag" - "fmt" - "io" - "io/ioutil" - "log" - "math" - "reflect" - "regexp" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/tag" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", - false, - "test existing tables; can be used to compare web data with package data.") - outputFile = flag.String("output", - "tables.go", - "output file for generated tables") -) - -var comment = []string{ - ` -lang holds an alphabetically sorted list of ISO-639 language identifiers. -All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -For 2-byte language identifiers, the two successive bytes have the following meaning: - - if the first letter of the 2- and 3-letter ISO codes are the same: - the second and third letter of the 3-letter ISO code. - - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -For 3-byte language identifiers the 4th byte is 0.`, - ` -langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -in lookup tables. The language ids for these language codes are derived directly -from the letters and are not consecutive.`, - ` -altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -to 2-letter language codes that cannot be derived using the method described above. -Each 3-letter code is followed by its 1-byte langID.`, - ` -altLangIndex is used to convert indexes in altLangISO3 to langIDs.`, - ` -langAliasMap maps langIDs to their suggested replacements.`, - ` -script is an alphabetically sorted list of ISO 15924 codes. The index -of the script in the string, divided by 4, is the internal scriptID.`, - ` -isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -the UN.M49 codes used for groups.)`, - ` -regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -Each 2-letter codes is followed by two bytes with the following meaning: - - [A-Z}{2}: the first letter of the 2-letter code plus these two - letters form the 3-letter ISO code. - - 0, n: index into altRegionISO3.`, - ` -regionTypes defines the status of a region for various standards.`, - ` -m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -codes indicating collections of regions.`, - ` -m49Index gives indexes into fromM49 based on the three most significant bits -of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in - fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -The region code is stored in the 9 lsb of the indexed value.`, - ` -fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details.`, - ` -altRegionISO3 holds a list of 3-letter region codes that cannot be -mapped to 2-letter codes using the default algorithm. This is a short list.`, - ` -altRegionIDs holds a list of regionIDs the positions of which match those -of the 3-letter ISO codes in altRegionISO3.`, - ` -variantNumSpecialized is the number of specialized variants in variants.`, - ` -suppressScript is an index from langID to the dominant script for that language, -if it exists. If a script is given, it should be suppressed from the language tag.`, - ` -likelyLang is a lookup table, indexed by langID, for the most likely -scripts and regions given incomplete information. If more entries exist for a -given language, region and script are the index and size respectively -of the list in likelyLangList.`, - ` -likelyLangList holds lists info associated with likelyLang.`, - ` -likelyRegion is a lookup table, indexed by regionID, for the most likely -languages and scripts given incomplete information. If more entries exist -for a given regionID, lang and script are the index and size respectively -of the list in likelyRegionList. -TODO: exclude containers and user-definable regions from the list.`, - ` -likelyRegionList holds lists info associated with likelyRegion.`, - ` -likelyScript is a lookup table, indexed by scriptID, for the most likely -languages and regions given a script.`, - ` -matchLang holds pairs of langIDs of base languages that are typically -mutually intelligible. Each pair is associated with a confidence and -whether the intelligibility goes one or both ways.`, - ` -matchScript holds pairs of scriptIDs where readers of one script -can typically also read the other. Each is associated with a confidence.`, - ` -nRegionGroups is the number of region groups.`, - ` -regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -where each set holds all groupings that are directly connected in a region -containment graph.`, - ` -regionInclusionBits is an array of bit vectors where every vector represents -a set of region groupings. These sets are used to compute the distance -between two regions for the purpose of language matching.`, - ` -regionInclusionNext marks, for each entry in regionInclusionBits, the set of -all groups that are reachable from the groups set in the respective entry.`, -} - -// TODO: consider changing some of these structures to tries. This can reduce -// memory, but may increase the need for memory allocations. This could be -// mitigated if we can piggyback on language tags for common cases. - -func failOnError(e error) { - if e != nil { - log.Panic(e) - } -} - -type setType int - -const ( - Indexed setType = 1 + iota // all elements must be of same size - Linear -) - -type stringSet struct { - s []string - sorted, frozen bool - - // We often need to update values after the creation of an index is completed. - // We include a convenience map for keeping track of this. - update map[string]string - typ setType // used for checking. -} - -func (ss *stringSet) clone() stringSet { - c := *ss - c.s = append([]string(nil), c.s...) - return c -} - -func (ss *stringSet) setType(t setType) { - if ss.typ != t && ss.typ != 0 { - log.Panicf("type %d cannot be assigned as it was already %d", t, ss.typ) - } -} - -// parse parses a whitespace-separated string and initializes ss with its -// components. -func (ss *stringSet) parse(s string) { - scan := bufio.NewScanner(strings.NewReader(s)) - scan.Split(bufio.ScanWords) - for scan.Scan() { - ss.add(scan.Text()) - } -} - -func (ss *stringSet) assertChangeable() { - if ss.frozen { - log.Panic("attempt to modify a frozen stringSet") - } -} - -func (ss *stringSet) add(s string) { - ss.assertChangeable() - ss.s = append(ss.s, s) - ss.sorted = ss.frozen -} - -func (ss *stringSet) freeze() { - ss.compact() - ss.frozen = true -} - -func (ss *stringSet) compact() { - if ss.sorted { - return - } - a := ss.s - sort.Strings(a) - k := 0 - for i := 1; i < len(a); i++ { - if a[k] != a[i] { - a[k+1] = a[i] - k++ - } - } - ss.s = a[:k+1] - ss.sorted = ss.frozen -} - -type funcSorter struct { - fn func(a, b string) bool - sort.StringSlice -} - -func (s funcSorter) Less(i, j int) bool { - return s.fn(s.StringSlice[i], s.StringSlice[j]) -} - -func (ss *stringSet) sortFunc(f func(a, b string) bool) { - ss.compact() - sort.Sort(funcSorter{f, sort.StringSlice(ss.s)}) -} - -func (ss *stringSet) remove(s string) { - ss.assertChangeable() - if i, ok := ss.find(s); ok { - copy(ss.s[i:], ss.s[i+1:]) - ss.s = ss.s[:len(ss.s)-1] - } -} - -func (ss *stringSet) replace(ol, nu string) { - ss.s[ss.index(ol)] = nu - ss.sorted = ss.frozen -} - -func (ss *stringSet) index(s string) int { - ss.setType(Indexed) - i, ok := ss.find(s) - if !ok { - if i < len(ss.s) { - log.Panicf("find: item %q is not in list. Closest match is %q.", s, ss.s[i]) - } - log.Panicf("find: item %q is not in list", s) - - } - return i -} - -func (ss *stringSet) find(s string) (int, bool) { - ss.compact() - i := sort.SearchStrings(ss.s, s) - return i, i != len(ss.s) && ss.s[i] == s -} - -func (ss *stringSet) slice() []string { - ss.compact() - return ss.s -} - -func (ss *stringSet) updateLater(v, key string) { - if ss.update == nil { - ss.update = map[string]string{} - } - ss.update[v] = key -} - -// join joins the string and ensures that all entries are of the same length. -func (ss *stringSet) join() string { - ss.setType(Indexed) - n := len(ss.s[0]) - for _, s := range ss.s { - if len(s) != n { - log.Panicf("join: not all entries are of the same length: %q", s) - } - } - ss.s = append(ss.s, strings.Repeat("\xff", n)) - return strings.Join(ss.s, "") -} - -// ianaEntry holds information for an entry in the IANA Language Subtag Repository. -// All types use the same entry. -// See http://tools.ietf.org/html/bcp47#section-5.1 for a description of the various -// fields. -type ianaEntry struct { - typ string - description []string - scope string - added string - preferred string - deprecated string - suppressScript string - macro string - prefix []string -} - -type builder struct { - w *gen.CodeWriter - hw io.Writer // MultiWriter for w and w.Hash - data *cldr.CLDR - supp *cldr.SupplementalData - - // indices - locale stringSet // common locales - lang stringSet // canonical language ids (2 or 3 letter ISO codes) with data - langNoIndex stringSet // 3-letter ISO codes with no associated data - script stringSet // 4-letter ISO codes - region stringSet // 2-letter ISO or 3-digit UN M49 codes - variant stringSet // 4-8-alphanumeric variant code. - - // Region codes that are groups with their corresponding group IDs. - groups map[int]index - - // langInfo - registry map[string]*ianaEntry -} - -type index uint - -func newBuilder(w *gen.CodeWriter) *builder { - r := gen.OpenCLDRCoreZip() - defer r.Close() - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - failOnError(err) - b := builder{ - w: w, - hw: io.MultiWriter(w, w.Hash), - data: data, - supp: data.Supplemental(), - } - b.parseRegistry() - return &b -} - -func (b *builder) parseRegistry() { - r := gen.OpenIANAFile("assignments/language-subtag-registry") - defer r.Close() - b.registry = make(map[string]*ianaEntry) - - scan := bufio.NewScanner(r) - scan.Split(bufio.ScanWords) - var record *ianaEntry - for more := scan.Scan(); more; { - key := scan.Text() - more = scan.Scan() - value := scan.Text() - switch key { - case "Type:": - record = &ianaEntry{typ: value} - case "Subtag:", "Tag:": - if s := strings.SplitN(value, "..", 2); len(s) > 1 { - for a := s[0]; a <= s[1]; a = inc(a) { - b.addToRegistry(a, record) - } - } else { - b.addToRegistry(value, record) - } - case "Suppress-Script:": - record.suppressScript = value - case "Added:": - record.added = value - case "Deprecated:": - record.deprecated = value - case "Macrolanguage:": - record.macro = value - case "Preferred-Value:": - record.preferred = value - case "Prefix:": - record.prefix = append(record.prefix, value) - case "Scope:": - record.scope = value - case "Description:": - buf := []byte(value) - for more = scan.Scan(); more; more = scan.Scan() { - b := scan.Bytes() - if b[0] == '%' || b[len(b)-1] == ':' { - break - } - buf = append(buf, ' ') - buf = append(buf, b...) - } - record.description = append(record.description, string(buf)) - continue - default: - continue - } - more = scan.Scan() - } - if scan.Err() != nil { - log.Panic(scan.Err()) - } -} - -func (b *builder) addToRegistry(key string, entry *ianaEntry) { - if info, ok := b.registry[key]; ok { - if info.typ != "language" || entry.typ != "extlang" { - log.Fatalf("parseRegistry: tag %q already exists", key) - } - } else { - b.registry[key] = entry - } -} - -var commentIndex = make(map[string]string) - -func init() { - for _, s := range comment { - key := strings.TrimSpace(strings.SplitN(s, " ", 2)[0]) - commentIndex[key] = s - } -} - -func (b *builder) comment(name string) { - if s := commentIndex[name]; len(s) > 0 { - b.w.WriteComment(s) - } else { - fmt.Fprintln(b.w) - } -} - -func (b *builder) pf(f string, x ...interface{}) { - fmt.Fprintf(b.hw, f, x...) - fmt.Fprint(b.hw, "\n") -} - -func (b *builder) p(x ...interface{}) { - fmt.Fprintln(b.hw, x...) -} - -func (b *builder) addSize(s int) { - b.w.Size += s - b.pf("// Size: %d bytes", s) -} - -func (b *builder) writeConst(name string, x interface{}) { - b.comment(name) - b.w.WriteConst(name, x) -} - -// writeConsts computes f(v) for all v in values and writes the results -// as constants named _v to a single constant block. -func (b *builder) writeConsts(f func(string) int, values ...string) { - b.pf("const (") - for _, v := range values { - b.pf("\t_%s = %v", v, f(v)) - } - b.pf(")") -} - -// writeType writes the type of the given value, which must be a struct. -func (b *builder) writeType(value interface{}) { - b.comment(reflect.TypeOf(value).Name()) - b.w.WriteType(value) -} - -func (b *builder) writeSlice(name string, ss interface{}) { - b.writeSliceAddSize(name, 0, ss) -} - -func (b *builder) writeSliceAddSize(name string, extraSize int, ss interface{}) { - b.comment(name) - b.w.Size += extraSize - v := reflect.ValueOf(ss) - t := v.Type().Elem() - b.pf("// Size: %d bytes, %d elements", v.Len()*int(t.Size())+extraSize, v.Len()) - - fmt.Fprintf(b.w, "var %s = ", name) - b.w.WriteArray(ss) - b.p() -} - -type fromTo struct { - from, to uint16 -} - -func (b *builder) writeSortedMap(name string, ss *stringSet, index func(s string) uint16) { - ss.sortFunc(func(a, b string) bool { - return index(a) < index(b) - }) - m := []fromTo{} - for _, s := range ss.s { - m = append(m, fromTo{index(s), index(ss.update[s])}) - } - b.writeSlice(name, m) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s string) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -func (b *builder) writeBitVector(name string, ss []string) { - vec := make([]uint8, int(math.Ceil(math.Pow(base, float64(len(ss[0])))/8))) - for _, s := range ss { - v := strToInt(s) - vec[v/8] |= 1 << (v % 8) - } - b.writeSlice(name, vec) -} - -// TODO: convert this type into a list or two-stage trie. -func (b *builder) writeMapFunc(name string, m map[string]string, f func(string) uint16) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size())) - for _, k := range m { - sz += len(k) - } - b.addSize(sz) - keys := []string{} - b.pf(`var %s = map[string]uint16{`, name) - for k := range m { - keys = append(keys, k) - } - sort.Strings(keys) - for _, k := range keys { - b.pf("\t%q: %v,", k, f(m[k])) - } - b.p("}") -} - -func (b *builder) writeMap(name string, m interface{}) { - b.comment(name) - v := reflect.ValueOf(m) - sz := v.Len() * (2 + int(v.Type().Key().Size()) + int(v.Type().Elem().Size())) - b.addSize(sz) - f := strings.FieldsFunc(fmt.Sprintf("%#v", m), func(r rune) bool { - return strings.IndexRune("{}, ", r) != -1 - }) - sort.Strings(f[1:]) - b.pf(`var %s = %s{`, name, f[0]) - for _, kv := range f[1:] { - b.pf("\t%s,", kv) - } - b.p("}") -} - -func (b *builder) langIndex(s string) uint16 { - if s == "und" { - return 0 - } - if i, ok := b.lang.find(s); ok { - return uint16(i) - } - return uint16(strToInt(s)) + uint16(len(b.lang.s)) -} - -// inc advances the string to its lexicographical successor. -func inc(s string) string { - const maxTagLength = 4 - var buf [maxTagLength]byte - intToStr(strToInt(strings.ToLower(s))+1, buf[:len(s)]) - for i := 0; i < len(s); i++ { - if s[i] <= 'Z' { - buf[i] -= 'a' - 'A' - } - } - return string(buf[:len(s)]) -} - -func (b *builder) parseIndices() { - meta := b.supp.Metadata - - for k, v := range b.registry { - var ss *stringSet - switch v.typ { - case "language": - if len(k) == 2 || v.suppressScript != "" || v.scope == "special" { - b.lang.add(k) - continue - } else { - ss = &b.langNoIndex - } - case "region": - ss = &b.region - case "script": - ss = &b.script - case "variant": - ss = &b.variant - default: - continue - } - ss.add(k) - } - // Include any language for which there is data. - for _, lang := range b.data.Locales() { - if x := b.data.RawLDML(lang); false || - x.LocaleDisplayNames != nil || - x.Characters != nil || - x.Delimiters != nil || - x.Measurement != nil || - x.Dates != nil || - x.Numbers != nil || - x.Units != nil || - x.ListPatterns != nil || - x.Collations != nil || - x.Segmentations != nil || - x.Rbnf != nil || - x.Annotations != nil || - x.Metadata != nil { - - from := strings.Split(lang, "_") - if lang := from[0]; lang != "root" { - b.lang.add(lang) - } - } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range b.data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - if lang = strings.Split(lang, "_")[0]; lang != "root" { - b.lang.add(lang) - } - } - } - } - // Include languages in likely subtags. - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - b.lang.add(from[0]) - } - // Include ISO-639 alpha-3 bibliographic entries. - for _, a := range meta.Alias.LanguageAlias { - if a.Reason == "bibliographic" { - b.langNoIndex.add(a.Type) - } - } - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 { - b.region.add(reg.Type) - } - } - - for _, s := range b.lang.s { - if len(s) == 3 { - b.langNoIndex.remove(s) - } - } - b.writeConst("numLanguages", len(b.lang.slice())+len(b.langNoIndex.slice())) - b.writeConst("numScripts", len(b.script.slice())) - b.writeConst("numRegions", len(b.region.slice())) - - // Add dummy codes at the start of each list to represent "unspecified". - b.lang.add("---") - b.script.add("----") - b.region.add("---") - - // common locales - b.locale.parse(meta.DefaultContent.Locales) -} - -// TODO: region inclusion data will probably not be use used in future matchers. - -func (b *builder) computeRegionGroups() { - b.groups = make(map[int]index) - - // Create group indices. - for i := 1; b.region.s[i][0] < 'A'; i++ { // Base M49 indices on regionID. - b.groups[i] = index(len(b.groups)) - } - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - if _, ok := b.groups[group]; !ok { - b.groups[group] = index(len(b.groups)) - } - } - if len(b.groups) > 32 { - log.Fatalf("only 32 groups supported, found %d", len(b.groups)) - } - b.writeConst("nRegionGroups", len(b.groups)) -} - -var langConsts = []string{ - "af", "am", "ar", "az", "bg", "bn", "ca", "cs", "da", "de", "el", "en", "es", - "et", "fa", "fi", "fil", "fr", "gu", "he", "hi", "hr", "hu", "hy", "id", "is", - "it", "ja", "ka", "kk", "km", "kn", "ko", "ky", "lo", "lt", "lv", "mk", "ml", - "mn", "mo", "mr", "ms", "mul", "my", "nb", "ne", "nl", "no", "pa", "pl", "pt", - "ro", "ru", "sh", "si", "sk", "sl", "sq", "sr", "sv", "sw", "ta", "te", "th", - "tl", "tn", "tr", "uk", "ur", "uz", "vi", "zh", "zu", - - // constants for grandfathered tags (if not already defined) - "jbo", "ami", "bnn", "hak", "tlh", "lb", "nv", "pwn", "tao", "tay", "tsu", - "nn", "sfb", "vgt", "sgg", "cmn", "nan", "hsn", -} - -// writeLanguage generates all tables needed for language canonicalization. -func (b *builder) writeLanguage() { - meta := b.supp.Metadata - - b.writeConst("nonCanonicalUnd", b.lang.index("und")) - b.writeConsts(func(s string) int { return int(b.langIndex(s)) }, langConsts...) - b.writeConst("langPrivateStart", b.langIndex("qaa")) - b.writeConst("langPrivateEnd", b.langIndex("qtz")) - - // Get language codes that need to be mapped (overlong 3-letter codes, - // deprecated 2-letter codes, legacy and grandfathered tags.) - langAliasMap := stringSet{} - aliasTypeMap := map[string]langAliasType{} - - // altLangISO3 get the alternative ISO3 names that need to be mapped. - altLangISO3 := stringSet{} - // Add dummy start to avoid the use of index 0. - altLangISO3.add("---") - altLangISO3.updateLater("---", "aa") - - lang := b.lang.clone() - for _, a := range meta.Alias.LanguageAlias { - if a.Replacement == "" { - a.Replacement = "und" - } - // TODO: support mapping to tags - repl := strings.SplitN(a.Replacement, "_", 2)[0] - if a.Reason == "overlong" { - if len(a.Replacement) == 2 && len(a.Type) == 3 { - lang.updateLater(a.Replacement, a.Type) - } - } else if len(a.Type) <= 3 { - switch a.Reason { - case "macrolanguage": - aliasTypeMap[a.Type] = langMacro - case "deprecated": - // handled elsewhere - continue - case "bibliographic", "legacy": - if a.Type == "no" { - continue - } - aliasTypeMap[a.Type] = langLegacy - default: - log.Fatalf("new %s alias: %s", a.Reason, a.Type) - } - langAliasMap.add(a.Type) - langAliasMap.updateLater(a.Type, repl) - } - } - // Manually add the mapping of "nb" (Norwegian) to its macro language. - // This can be removed if CLDR adopts this change. - langAliasMap.add("nb") - langAliasMap.updateLater("nb", "no") - aliasTypeMap["nb"] = langMacro - - for k, v := range b.registry { - // Also add deprecated values for 3-letter ISO codes, which CLDR omits. - if v.typ == "language" && v.deprecated != "" && v.preferred != "" { - langAliasMap.add(k) - langAliasMap.updateLater(k, v.preferred) - aliasTypeMap[k] = langDeprecated - } - } - // Fix CLDR mappings. - lang.updateLater("tl", "tgl") - lang.updateLater("sh", "hbs") - lang.updateLater("mo", "mol") - lang.updateLater("no", "nor") - lang.updateLater("tw", "twi") - lang.updateLater("nb", "nob") - lang.updateLater("ak", "aka") - lang.updateLater("bh", "bih") - - // Ensure that each 2-letter code is matched with a 3-letter code. - for _, v := range lang.s[1:] { - s, ok := lang.update[v] - if !ok { - if s, ok = lang.update[langAliasMap.update[v]]; !ok { - continue - } - lang.update[v] = s - } - if v[0] != s[0] { - altLangISO3.add(s) - altLangISO3.updateLater(s, v) - } - } - - // Complete canonicalized language tags. - lang.freeze() - for i, v := range lang.s { - // We can avoid these manual entries by using the IANA registry directly. - // Seems easier to update the list manually, as changes are rare. - // The panic in this loop will trigger if we miss an entry. - add := "" - if s, ok := lang.update[v]; ok { - if s[0] == v[0] { - add = s[1:] - } else { - add = string([]byte{0, byte(altLangISO3.index(s))}) - } - } else if len(v) == 3 { - add = "\x00" - } else { - log.Panicf("no data for long form of %q", v) - } - lang.s[i] += add - } - b.writeConst("lang", tag.Index(lang.join())) - - b.writeConst("langNoIndexOffset", len(b.lang.s)) - - // space of all valid 3-letter language identifiers. - b.writeBitVector("langNoIndex", b.langNoIndex.slice()) - - altLangIndex := []uint16{} - for i, s := range altLangISO3.slice() { - altLangISO3.s[i] += string([]byte{byte(len(altLangIndex))}) - if i > 0 { - idx := b.lang.index(altLangISO3.update[s]) - altLangIndex = append(altLangIndex, uint16(idx)) - } - } - b.writeConst("altLangISO3", tag.Index(altLangISO3.join())) - b.writeSlice("altLangIndex", altLangIndex) - - b.writeSortedMap("langAliasMap", &langAliasMap, b.langIndex) - types := make([]langAliasType, len(langAliasMap.s)) - for i, s := range langAliasMap.s { - types[i] = aliasTypeMap[s] - } - b.writeSlice("langAliasTypes", types) -} - -var scriptConsts = []string{ - "Latn", "Hani", "Hans", "Hant", "Qaaa", "Qaai", "Qabx", "Zinh", "Zyyy", - "Zzzz", -} - -func (b *builder) writeScript() { - b.writeConsts(b.script.index, scriptConsts...) - b.writeConst("script", tag.Index(b.script.join())) - - supp := make([]uint8, len(b.lang.slice())) - for i, v := range b.lang.slice()[1:] { - if sc := b.registry[v].suppressScript; sc != "" { - supp[i+1] = uint8(b.script.index(sc)) - } - } - b.writeSlice("suppressScript", supp) - - // There is only one deprecated script in CLDR. This value is hard-coded. - // We check here if the code must be updated. - for _, a := range b.supp.Metadata.Alias.ScriptAlias { - if a.Type != "Qaai" { - log.Panicf("unexpected deprecated stript %q", a.Type) - } - } -} - -func parseM49(s string) int16 { - if len(s) == 0 { - return 0 - } - v, err := strconv.ParseUint(s, 10, 10) - failOnError(err) - return int16(v) -} - -var regionConsts = []string{ - "001", "419", "BR", "CA", "ES", "GB", "MD", "PT", "UK", "US", - "ZZ", "XA", "XC", "XK", // Unofficial tag for Kosovo. -} - -func (b *builder) writeRegion() { - b.writeConsts(b.region.index, regionConsts...) - - isoOffset := b.region.index("AA") - m49map := make([]int16, len(b.region.slice())) - fromM49map := make(map[int16]int) - altRegionISO3 := "" - altRegionIDs := []uint16{} - - b.writeConst("isoRegionOffset", isoOffset) - - // 2-letter region lookup and mapping to numeric codes. - regionISO := b.region.clone() - regionISO.s = regionISO.s[isoOffset:] - regionISO.sorted = false - - regionTypes := make([]byte, len(b.region.s)) - - // Is the region valid BCP 47? - for s, e := range b.registry { - if len(s) == 2 && s == strings.ToUpper(s) { - i := b.region.index(s) - for _, d := range e.description { - if strings.Contains(d, "Private use") { - regionTypes[i] = iso3166UserAssigned - } - } - regionTypes[i] |= bcp47Region - } - } - - // Is the region a valid ccTLD? - r := gen.OpenIANAFile("domains/root/db") - defer r.Close() - - buf, err := ioutil.ReadAll(r) - failOnError(err) - re := regexp.MustCompile(`"/domains/root/db/([a-z]{2}).html"`) - for _, m := range re.FindAllSubmatch(buf, -1) { - i := b.region.index(strings.ToUpper(string(m[1]))) - regionTypes[i] |= ccTLD - } - - b.writeSlice("regionTypes", regionTypes) - - iso3Set := make(map[string]int) - update := func(iso2, iso3 string) { - i := regionISO.index(iso2) - if j, ok := iso3Set[iso3]; !ok && iso3[0] == iso2[0] { - regionISO.s[i] += iso3[1:] - iso3Set[iso3] = -1 - } else { - if ok && j >= 0 { - regionISO.s[i] += string([]byte{0, byte(j)}) - } else { - iso3Set[iso3] = len(altRegionISO3) - regionISO.s[i] += string([]byte{0, byte(len(altRegionISO3))}) - altRegionISO3 += iso3 - altRegionIDs = append(altRegionIDs, uint16(isoOffset+i)) - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - i := regionISO.index(tc.Type) + isoOffset - if d := m49map[i]; d != 0 { - log.Panicf("%s found as a duplicate UN.M49 code of %03d", tc.Numeric, d) - } - m49 := parseM49(tc.Numeric) - m49map[i] = m49 - if r := fromM49map[m49]; r == 0 { - fromM49map[m49] = i - } else if r != i { - dep := b.registry[regionISO.s[r-isoOffset]].deprecated - if t := b.registry[tc.Type]; t != nil && dep != "" && (t.deprecated == "" || t.deprecated > dep) { - fromM49map[m49] = i - } - } - } - for _, ta := range b.supp.Metadata.Alias.TerritoryAlias { - if len(ta.Type) == 3 && ta.Type[0] <= '9' && len(ta.Replacement) == 2 { - from := parseM49(ta.Type) - if r := fromM49map[from]; r == 0 { - fromM49map[from] = regionISO.index(ta.Replacement) + isoOffset - } - } - } - for _, tc := range b.supp.CodeMappings.TerritoryCodes { - if len(tc.Alpha3) == 3 { - update(tc.Type, tc.Alpha3) - } - } - // This entries are not included in territoryCodes. Mostly 3-letter variants - // of deleted codes and an entry for QU. - for _, m := range []struct{ iso2, iso3 string }{ - {"CT", "CTE"}, - {"DY", "DHY"}, - {"HV", "HVO"}, - {"JT", "JTN"}, - {"MI", "MID"}, - {"NH", "NHB"}, - {"NQ", "ATN"}, - {"PC", "PCI"}, - {"PU", "PUS"}, - {"PZ", "PCZ"}, - {"RH", "RHO"}, - {"VD", "VDR"}, - {"WK", "WAK"}, - // These three-letter codes are used for others as well. - {"FQ", "ATF"}, - } { - update(m.iso2, m.iso3) - } - for i, s := range regionISO.s { - if len(s) != 4 { - regionISO.s[i] = s + " " - } - } - b.writeConst("regionISO", tag.Index(regionISO.join())) - b.writeConst("altRegionISO3", altRegionISO3) - b.writeSlice("altRegionIDs", altRegionIDs) - - // Create list of deprecated regions. - // TODO: consider inserting SF -> FI. Not included by CLDR, but is the only - // Transitionally-reserved mapping not included. - regionOldMap := stringSet{} - // Include regions in territoryAlias (not all are in the IANA registry!) - for _, reg := range b.supp.Metadata.Alias.TerritoryAlias { - if len(reg.Type) == 2 && reg.Reason == "deprecated" && len(reg.Replacement) == 2 { - regionOldMap.add(reg.Type) - regionOldMap.updateLater(reg.Type, reg.Replacement) - i, _ := regionISO.find(reg.Type) - j, _ := regionISO.find(reg.Replacement) - if k := m49map[i+isoOffset]; k == 0 { - m49map[i+isoOffset] = m49map[j+isoOffset] - } - } - } - b.writeSortedMap("regionOldMap", ®ionOldMap, func(s string) uint16 { - return uint16(b.region.index(s)) - }) - // 3-digit region lookup, groupings. - for i := 1; i < isoOffset; i++ { - m := parseM49(b.region.s[i]) - m49map[i] = m - fromM49map[m] = i - } - b.writeSlice("m49", m49map) - - const ( - searchBits = 7 - regionBits = 9 - ) - if len(m49map) >= 1<<regionBits { - log.Fatalf("Maximum number of regions exceeded: %d > %d", len(m49map), 1<<regionBits) - } - m49Index := [9]int16{} - fromM49 := []uint16{} - m49 := []int{} - for k, _ := range fromM49map { - m49 = append(m49, int(k)) - } - sort.Ints(m49) - for _, k := range m49[1:] { - val := (k & (1<<searchBits - 1)) << regionBits - fromM49 = append(fromM49, uint16(val|fromM49map[int16(k)])) - m49Index[1:][k>>searchBits] = int16(len(fromM49)) - } - b.writeSlice("m49Index", m49Index) - b.writeSlice("fromM49", fromM49) -} - -const ( - // TODO: put these lists in regionTypes as user data? Could be used for - // various optimizations and refinements and could be exposed in the API. - iso3166Except = "AC CP DG EA EU FX IC SU TA UK" - iso3166Trans = "AN BU CS NT TP YU ZR" // SF is not in our set of Regions. - // DY and RH are actually not deleted, but indeterminately reserved. - iso3166DelCLDR = "CT DD DY FQ HV JT MI NH NQ PC PU PZ RH VD WK YD" -) - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func find(list []string, s string) int { - for i, t := range list { - if t == s { - return i - } - } - return -1 -} - -// writeVariants generates per-variant information and creates a map from variant -// name to index value. We assign index values such that sorting multiple -// variants by index value will result in the correct order. -// There are two types of variants: specialized and general. Specialized variants -// are only applicable to certain language or language-script pairs. Generalized -// variants apply to any language. Generalized variants always sort after -// specialized variants. We will therefore always assign a higher index value -// to a generalized variant than any other variant. Generalized variants are -// sorted alphabetically among themselves. -// Specialized variants may also sort after other specialized variants. Such -// variants will be ordered after any of the variants they may follow. -// We assume that if a variant x is followed by a variant y, then for any prefix -// p of x, p-x is a prefix of y. This allows us to order tags based on the -// maximum of the length of any of its prefixes. -// TODO: it is possible to define a set of Prefix values on variants such that -// a total order cannot be defined to the point that this algorithm breaks. -// In other words, we cannot guarantee the same order of variants for the -// future using the same algorithm or for non-compliant combinations of -// variants. For this reason, consider using simple alphabetic sorting -// of variants and ignore Prefix restrictions altogether. -func (b *builder) writeVariant() { - generalized := stringSet{} - specialized := stringSet{} - specializedExtend := stringSet{} - // Collate the variants by type and check assumptions. - for _, v := range b.variant.slice() { - e := b.registry[v] - if len(e.prefix) == 0 { - generalized.add(v) - continue - } - c := strings.Split(e.prefix[0], "-") - hasScriptOrRegion := false - if len(c) > 1 { - _, hasScriptOrRegion = b.script.find(c[1]) - if !hasScriptOrRegion { - _, hasScriptOrRegion = b.region.find(c[1]) - - } - } - if len(c) == 1 || len(c) == 2 && hasScriptOrRegion { - // Variant is preceded by a language. - specialized.add(v) - continue - } - // Variant is preceded by another variant. - specializedExtend.add(v) - prefix := c[0] + "-" - if hasScriptOrRegion { - prefix += c[1] - } - for _, p := range e.prefix { - // Verify that the prefix minus the last element is a prefix of the - // predecessor element. - i := strings.LastIndex(p, "-") - pred := b.registry[p[i+1:]] - if find(pred.prefix, p[:i]) < 0 { - log.Fatalf("prefix %q for variant %q not consistent with predecessor spec", p, v) - } - // The sorting used below does not work in the general case. It works - // if we assume that variants that may be followed by others only have - // prefixes of the same length. Verify this. - count := strings.Count(p[:i], "-") - for _, q := range pred.prefix { - if c := strings.Count(q, "-"); c != count { - log.Fatalf("variant %q preceding %q has a prefix %q of size %d; want %d", p[i+1:], v, q, c, count) - } - } - if !strings.HasPrefix(p, prefix) { - log.Fatalf("prefix %q of variant %q should start with %q", p, v, prefix) - } - } - } - - // Sort extended variants. - a := specializedExtend.s - less := func(v, w string) bool { - // Sort by the maximum number of elements. - maxCount := func(s string) (max int) { - for _, p := range b.registry[s].prefix { - if c := strings.Count(p, "-"); c > max { - max = c - } - } - return - } - if cv, cw := maxCount(v), maxCount(w); cv != cw { - return cv < cw - } - // Sort by name as tie breaker. - return v < w - } - sort.Sort(funcSorter{less, sort.StringSlice(a)}) - specializedExtend.frozen = true - - // Create index from variant name to index. - variantIndex := make(map[string]uint8) - add := func(s []string) { - for _, v := range s { - variantIndex[v] = uint8(len(variantIndex)) - } - } - add(specialized.slice()) - add(specializedExtend.s) - numSpecialized := len(variantIndex) - add(generalized.slice()) - if n := len(variantIndex); n > 255 { - log.Fatalf("maximum number of variants exceeded: was %d; want <= 255", n) - } - b.writeMap("variantIndex", variantIndex) - b.writeConst("variantNumSpecialized", numSpecialized) -} - -func (b *builder) writeLanguageInfo() { -} - -// writeLikelyData writes tables that are used both for finding parent relations and for -// language matching. Each entry contains additional bits to indicate the status of the -// data to know when it cannot be used for parent relations. -func (b *builder) writeLikelyData() { - const ( - isList = 1 << iota - scriptInFrom - regionInFrom - ) - type ( // generated types - likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 - } - likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 - } - likelyLangRegion struct { - lang uint16 - region uint16 - } - // likelyTag is used for getting likely tags for group regions, where - // the likely region might be a region contained in the group. - likelyTag struct { - lang uint16 - region uint16 - script uint8 - } - ) - var ( // generated variables - likelyRegionGroup = make([]likelyTag, len(b.groups)) - likelyLang = make([]likelyScriptRegion, len(b.lang.s)) - likelyRegion = make([]likelyLangScript, len(b.region.s)) - likelyScript = make([]likelyLangRegion, len(b.script.s)) - likelyLangList = []likelyScriptRegion{} - likelyRegionList = []likelyLangScript{} - ) - type fromTo struct { - from, to []string - } - langToOther := map[int][]fromTo{} - regionToOther := map[int][]fromTo{} - for _, m := range b.supp.LikelySubtags.LikelySubtag { - from := strings.Split(m.From, "_") - to := strings.Split(m.To, "_") - if len(to) != 3 { - log.Fatalf("invalid number of subtags in %q: found %d, want 3", m.To, len(to)) - } - if len(from) > 3 { - log.Fatalf("invalid number of subtags: found %d, want 1-3", len(from)) - } - if from[0] != to[0] && from[0] != "und" { - log.Fatalf("unexpected language change in expansion: %s -> %s", from, to) - } - if len(from) == 3 { - if from[2] != to[2] { - log.Fatalf("unexpected region change in expansion: %s -> %s", from, to) - } - if from[0] != "und" { - log.Fatalf("unexpected fully specified from tag: %s -> %s", from, to) - } - } - if len(from) == 1 || from[0] != "und" { - id := 0 - if from[0] != "und" { - id = b.lang.index(from[0]) - } - langToOther[id] = append(langToOther[id], fromTo{from, to}) - } else if len(from) == 2 && len(from[1]) == 4 { - sid := b.script.index(from[1]) - likelyScript[sid].lang = uint16(b.langIndex(to[0])) - likelyScript[sid].region = uint16(b.region.index(to[2])) - } else { - r := b.region.index(from[len(from)-1]) - if id, ok := b.groups[r]; ok { - if from[0] != "und" { - log.Fatalf("region changed unexpectedly: %s -> %s", from, to) - } - likelyRegionGroup[id].lang = uint16(b.langIndex(to[0])) - likelyRegionGroup[id].script = uint8(b.script.index(to[1])) - likelyRegionGroup[id].region = uint16(b.region.index(to[2])) - } else { - regionToOther[r] = append(regionToOther[r], fromTo{from, to}) - } - } - } - b.writeType(likelyLangRegion{}) - b.writeSlice("likelyScript", likelyScript) - - for id := range b.lang.s { - list := langToOther[id] - if len(list) == 1 { - likelyLang[id].region = uint16(b.region.index(list[0].to[2])) - likelyLang[id].script = uint8(b.script.index(list[0].to[1])) - } else if len(list) > 1 { - likelyLang[id].flags = isList - likelyLang[id].region = uint16(len(likelyLangList)) - likelyLang[id].script = uint8(len(list)) - for _, x := range list { - flags := uint8(0) - if len(x.from) > 1 { - if x.from[1] == x.to[2] { - flags = regionInFrom - } else { - flags = scriptInFrom - } - } - likelyLangList = append(likelyLangList, likelyScriptRegion{ - region: uint16(b.region.index(x.to[2])), - script: uint8(b.script.index(x.to[1])), - flags: flags, - }) - } - } - } - // TODO: merge suppressScript data with this table. - b.writeType(likelyScriptRegion{}) - b.writeSlice("likelyLang", likelyLang) - b.writeSlice("likelyLangList", likelyLangList) - - for id := range b.region.s { - list := regionToOther[id] - if len(list) == 1 { - likelyRegion[id].lang = uint16(b.langIndex(list[0].to[0])) - likelyRegion[id].script = uint8(b.script.index(list[0].to[1])) - if len(list[0].from) > 2 { - likelyRegion[id].flags = scriptInFrom - } - } else if len(list) > 1 { - likelyRegion[id].flags = isList - likelyRegion[id].lang = uint16(len(likelyRegionList)) - likelyRegion[id].script = uint8(len(list)) - for i, x := range list { - if len(x.from) == 2 && i != 0 || i > 0 && len(x.from) != 3 { - log.Fatalf("unspecified script must be first in list: %v at %d", x.from, i) - } - x := likelyLangScript{ - lang: uint16(b.langIndex(x.to[0])), - script: uint8(b.script.index(x.to[1])), - } - if len(list[0].from) > 2 { - x.flags = scriptInFrom - } - likelyRegionList = append(likelyRegionList, x) - } - } - } - b.writeType(likelyLangScript{}) - b.writeSlice("likelyRegion", likelyRegion) - b.writeSlice("likelyRegionList", likelyRegionList) - - b.writeType(likelyTag{}) - b.writeSlice("likelyRegionGroup", likelyRegionGroup) -} - -type mutualIntelligibility struct { - want, have uint16 - distance uint8 - oneway bool -} - -type scriptIntelligibility struct { - wantLang, haveLang uint16 - wantScript, haveScript uint8 - distance uint8 - // Always oneway -} - -type regionIntelligibility struct { - lang uint16 // compact language id - script uint8 // 0 means any - group uint8 // 0 means any; if bit 7 is set it means inverse - distance uint8 - // Always twoway. -} - -// writeMatchData writes tables with languages and scripts for which there is -// mutual intelligibility. The data is based on CLDR's languageMatching data. -// Note that we use a different algorithm than the one defined by CLDR and that -// we slightly modify the data. For example, we convert scores to confidence levels. -// We also drop all region-related data as we use a different algorithm to -// determine region equivalence. -func (b *builder) writeMatchData() { - lm := b.supp.LanguageMatching.LanguageMatches - cldr.MakeSlice(&lm).SelectAnyOf("type", "written_new") - - regionHierarchy := map[string][]string{} - for _, g := range b.supp.TerritoryContainment.Group { - regions := strings.Split(g.Contains, " ") - regionHierarchy[g.Type] = append(regionHierarchy[g.Type], regions...) - } - regionToGroups := make([]uint8, len(b.region.s)) - - idToIndex := map[string]uint8{} - for i, mv := range lm[0].MatchVariable { - if i > 6 { - log.Fatalf("Too many groups: %d", i) - } - idToIndex[mv.Id] = uint8(i + 1) - // TODO: also handle '-' - for _, r := range strings.Split(mv.Value, "+") { - todo := []string{r} - for k := 0; k < len(todo); k++ { - r := todo[k] - regionToGroups[b.region.index(r)] |= 1 << uint8(i) - todo = append(todo, regionHierarchy[r]...) - } - } - } - b.writeSlice("regionToGroups", regionToGroups) - - b.writeType(mutualIntelligibility{}) - b.writeType(scriptIntelligibility{}) - b.writeType(regionIntelligibility{}) - - matchLang := []mutualIntelligibility{{ - // TODO: remove once CLDR is fixed. - want: uint16(b.langIndex("sr")), - have: uint16(b.langIndex("hr")), - distance: uint8(5), - }, { - want: uint16(b.langIndex("sr")), - have: uint16(b.langIndex("bs")), - distance: uint8(5), - }} - matchScript := []scriptIntelligibility{} - matchRegion := []regionIntelligibility{} - // Convert the languageMatch entries in lists keyed by desired language. - for _, m := range lm[0].LanguageMatch { - // Different versions of CLDR use different separators. - desired := strings.Replace(m.Desired, "-", "_", -1) - supported := strings.Replace(m.Supported, "-", "_", -1) - d := strings.Split(desired, "_") - s := strings.Split(supported, "_") - if len(d) != len(s) { - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) - continue - } - distance, _ := strconv.ParseInt(m.Distance, 10, 8) - switch len(d) { - case 2: - if desired == supported && desired == "*_*" { - continue - } - // language-script pair. - matchScript = append(matchScript, scriptIntelligibility{ - wantLang: uint16(b.langIndex(d[0])), - haveLang: uint16(b.langIndex(s[0])), - wantScript: uint8(b.script.index(d[1])), - haveScript: uint8(b.script.index(s[1])), - distance: uint8(distance), - }) - if m.Oneway != "true" { - matchScript = append(matchScript, scriptIntelligibility{ - wantLang: uint16(b.langIndex(s[0])), - haveLang: uint16(b.langIndex(d[0])), - wantScript: uint8(b.script.index(s[1])), - haveScript: uint8(b.script.index(d[1])), - distance: uint8(distance), - }) - } - case 1: - if desired == supported && desired == "*" { - continue - } - if distance == 1 { - // nb == no is already handled by macro mapping. Check there - // really is only this case. - if d[0] != "no" || s[0] != "nb" { - log.Fatalf("unhandled equivalence %s == %s", s[0], d[0]) - } - continue - } - // TODO: consider dropping oneway field and just doubling the entry. - matchLang = append(matchLang, mutualIntelligibility{ - want: uint16(b.langIndex(d[0])), - have: uint16(b.langIndex(s[0])), - distance: uint8(distance), - oneway: m.Oneway == "true", - }) - case 3: - if desired == supported && desired == "*_*_*" { - continue - } - if desired != supported { // (Weird but correct.) - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) - continue - } - ri := regionIntelligibility{ - lang: b.langIndex(d[0]), - distance: uint8(distance), - } - if d[1] != "*" { - ri.script = uint8(b.script.index(d[1])) - } - switch { - case d[2] == "*": - ri.group = 0x80 // not contained in anything - case strings.HasPrefix(d[2], "$!"): - ri.group = 0x80 - d[2] = "$" + d[2][len("$!"):] - fallthrough - case strings.HasPrefix(d[2], "$"): - ri.group |= idToIndex[d[2]] - } - matchRegion = append(matchRegion, ri) - default: - log.Fatalf("not supported: desired=%q; supported=%q", desired, supported) - } - } - sort.SliceStable(matchLang, func(i, j int) bool { - return matchLang[i].distance < matchLang[j].distance - }) - b.writeSlice("matchLang", matchLang) - - sort.SliceStable(matchScript, func(i, j int) bool { - return matchScript[i].distance < matchScript[j].distance - }) - b.writeSlice("matchScript", matchScript) - - sort.SliceStable(matchRegion, func(i, j int) bool { - return matchRegion[i].distance < matchRegion[j].distance - }) - b.writeSlice("matchRegion", matchRegion) -} - -func (b *builder) writeRegionInclusionData() { - var ( - // mm holds for each group the set of groups with a distance of 1. - mm = make(map[int][]index) - - // containment holds for each group the transitive closure of - // containment of other groups. - containment = make(map[index][]index) - ) - for _, g := range b.supp.TerritoryContainment.Group { - // Skip UN and EURO zone as they are flattening the containment - // relationship. - if g.Type == "EZ" || g.Type == "UN" { - continue - } - group := b.region.index(g.Type) - groupIdx := b.groups[group] - for _, mem := range strings.Split(g.Contains, " ") { - r := b.region.index(mem) - mm[r] = append(mm[r], groupIdx) - if g, ok := b.groups[r]; ok { - mm[group] = append(mm[group], g) - containment[groupIdx] = append(containment[groupIdx], g) - } - } - } - - regionContainment := make([]uint32, len(b.groups)) - for _, g := range b.groups { - l := containment[g] - - // Compute the transitive closure of containment. - for i := 0; i < len(l); i++ { - l = append(l, containment[l[i]]...) - } - - // Compute the bitmask. - regionContainment[g] = 1 << g - for _, v := range l { - regionContainment[g] |= 1 << v - } - } - b.writeSlice("regionContainment", regionContainment) - - regionInclusion := make([]uint8, len(b.region.s)) - bvs := make(map[uint32]index) - // Make the first bitvector positions correspond with the groups. - for r, i := range b.groups { - bv := uint32(1 << i) - for _, g := range mm[r] { - bv |= 1 << g - } - bvs[bv] = i - regionInclusion[r] = uint8(bvs[bv]) - } - for r := 1; r < len(b.region.s); r++ { - if _, ok := b.groups[r]; !ok { - bv := uint32(0) - for _, g := range mm[r] { - bv |= 1 << g - } - if bv == 0 { - // Pick the world for unspecified regions. - bv = 1 << b.groups[b.region.index("001")] - } - if _, ok := bvs[bv]; !ok { - bvs[bv] = index(len(bvs)) - } - regionInclusion[r] = uint8(bvs[bv]) - } - } - b.writeSlice("regionInclusion", regionInclusion) - regionInclusionBits := make([]uint32, len(bvs)) - for k, v := range bvs { - regionInclusionBits[v] = uint32(k) - } - // Add bit vectors for increasingly large distances until a fixed point is reached. - regionInclusionNext := []uint8{} - for i := 0; i < len(regionInclusionBits); i++ { - bits := regionInclusionBits[i] - next := bits - for i := uint(0); i < uint(len(b.groups)); i++ { - if bits&(1<<i) != 0 { - next |= regionInclusionBits[i] - } - } - if _, ok := bvs[next]; !ok { - bvs[next] = index(len(bvs)) - regionInclusionBits = append(regionInclusionBits, next) - } - regionInclusionNext = append(regionInclusionNext, uint8(bvs[next])) - } - b.writeSlice("regionInclusionBits", regionInclusionBits) - b.writeSlice("regionInclusionNext", regionInclusionNext) -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -func (b *builder) writeParents() { - b.writeType(parentRel{}) - - parents := []parentRel{} - - // Construct parent overrides. - n := 0 - for _, p := range b.data.Supplemental().ParentLocales.ParentLocale { - // Skipping non-standard scripts to root is implemented using addTags. - if p.Parent == "root" { - continue - } - - sub := strings.Split(p.Parent, "_") - parent := parentRel{lang: b.langIndex(sub[0])} - if len(sub) == 2 { - // TODO: check that all undefined scripts are indeed Latn in these - // cases. - parent.maxScript = uint8(b.script.index("Latn")) - parent.toRegion = uint16(b.region.index(sub[1])) - } else { - parent.script = uint8(b.script.index(sub[1])) - parent.maxScript = parent.script - parent.toRegion = uint16(b.region.index(sub[2])) - } - for _, c := range strings.Split(p.Locales, " ") { - region := b.region.index(c[strings.LastIndex(c, "_")+1:]) - parent.fromRegion = append(parent.fromRegion, uint16(region)) - } - parents = append(parents, parent) - n += len(parent.fromRegion) - } - b.writeSliceAddSize("parents", n*2, parents) -} - -func main() { - gen.Init() - - gen.Repackage("gen_common.go", "common.go", "language") - - w := gen.NewCodeWriter() - defer w.WriteGoFile("tables.go", "language") - - fmt.Fprintln(w, `import "golang.org/x/text/internal/tag"`) - - b := newBuilder(w) - gen.WriteCLDRVersion(w) - - b.parseIndices() - b.writeType(fromTo{}) - b.writeLanguage() - b.writeScript() - b.writeRegion() - b.writeVariant() - // TODO: b.writeLocale() - b.computeRegionGroups() - b.writeLikelyData() - b.writeMatchData() - b.writeRegionInclusionData() - b.writeParents() -} diff --git a/vendor/golang.org/x/text/language/gen_common.go b/vendor/golang.org/x/text/language/gen_common.go deleted file mode 100644 index 83ce1801..00000000 --- a/vendor/golang.org/x/text/language/gen_common.go +++ /dev/null @@ -1,20 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file contains code common to the maketables.go and the package code. - -// langAliasType is the type of an alias in langAliasMap. -type langAliasType int8 - -const ( - langDeprecated langAliasType = iota - langMacro - langLegacy - - langAliasTypeUnknown langAliasType = -1 -) diff --git a/vendor/golang.org/x/text/language/gen_index.go b/vendor/golang.org/x/text/language/gen_index.go deleted file mode 100644 index eef555cd..00000000 --- a/vendor/golang.org/x/text/language/gen_index.go +++ /dev/null @@ -1,162 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This file generates derivative tables based on the language package itself. - -import ( - "bytes" - "flag" - "fmt" - "io/ioutil" - "log" - "reflect" - "sort" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/language" - "golang.org/x/text/unicode/cldr" -) - -var ( - test = flag.Bool("test", false, - "test existing tables; can be used to compare web data with package data.") - - draft = flag.String("draft", - "contributed", - `Minimal draft requirements (approved, contributed, provisional, unconfirmed).`) -) - -func main() { - gen.Init() - - // Read the CLDR zip file. - r := gen.OpenCLDRCoreZip() - defer r.Close() - - d := &cldr.Decoder{} - data, err := d.DecodeZip(r) - if err != nil { - log.Fatalf("DecodeZip: %v", err) - } - - w := gen.NewCodeWriter() - defer func() { - buf := &bytes.Buffer{} - - if _, err = w.WriteGo(buf, "language"); err != nil { - log.Fatalf("Error formatting file index.go: %v", err) - } - - // Since we're generating a table for our own package we need to rewrite - // doing the equivalent of go fmt -r 'language.b -> b'. Using - // bytes.Replace will do. - out := bytes.Replace(buf.Bytes(), []byte("language."), nil, -1) - if err := ioutil.WriteFile("index.go", out, 0600); err != nil { - log.Fatalf("Could not create file index.go: %v", err) - } - }() - - m := map[language.Tag]bool{} - for _, lang := range data.Locales() { - // We include all locales unconditionally to be consistent with en_US. - // We want en_US, even though it has no data associated with it. - - // TODO: put any of the languages for which no data exists at the end - // of the index. This allows all components based on ICU to use that - // as the cutoff point. - // if x := data.RawLDML(lang); false || - // x.LocaleDisplayNames != nil || - // x.Characters != nil || - // x.Delimiters != nil || - // x.Measurement != nil || - // x.Dates != nil || - // x.Numbers != nil || - // x.Units != nil || - // x.ListPatterns != nil || - // x.Collations != nil || - // x.Segmentations != nil || - // x.Rbnf != nil || - // x.Annotations != nil || - // x.Metadata != nil { - - // TODO: support POSIX natively, albeit non-standard. - tag := language.Make(strings.Replace(lang, "_POSIX", "-u-va-posix", 1)) - m[tag] = true - // } - } - // Include locales for plural rules, which uses a different structure. - for _, plurals := range data.Supplemental().Plurals { - for _, rules := range plurals.PluralRules { - for _, lang := range strings.Split(rules.Locales, " ") { - m[language.Make(lang)] = true - } - } - } - - var core, special []language.Tag - - for t := range m { - if x := t.Extensions(); len(x) != 0 && fmt.Sprint(x) != "[u-va-posix]" { - log.Fatalf("Unexpected extension %v in %v", x, t) - } - if len(t.Variants()) == 0 && len(t.Extensions()) == 0 { - core = append(core, t) - } else { - special = append(special, t) - } - } - - w.WriteComment(` - NumCompactTags is the number of common tags. The maximum tag is - NumCompactTags-1.`) - w.WriteConst("NumCompactTags", len(core)+len(special)) - - sort.Sort(byAlpha(special)) - w.WriteVar("specialTags", special) - - // TODO: order by frequency? - sort.Sort(byAlpha(core)) - - // Size computations are just an estimate. - w.Size += int(reflect.TypeOf(map[uint32]uint16{}).Size()) - w.Size += len(core) * 6 // size of uint32 and uint16 - - fmt.Fprintln(w) - fmt.Fprintln(w, "var coreTags = map[uint32]uint16{") - fmt.Fprintln(w, "0x0: 0, // und") - i := len(special) + 1 // Und and special tags already written. - for _, t := range core { - if t == language.Und { - continue - } - fmt.Fprint(w.Hash, t, i) - b, s, r := t.Raw() - fmt.Fprintf(w, "0x%s%s%s: %d, // %s\n", - getIndex(b, 3), // 3 is enough as it is guaranteed to be a compact number - getIndex(s, 2), - getIndex(r, 3), - i, t) - i++ - } - fmt.Fprintln(w, "}") -} - -// getIndex prints the subtag type and extracts its index of size nibble. -// If the index is less than n nibbles, the result is prefixed with 0s. -func getIndex(x interface{}, n int) string { - s := fmt.Sprintf("%#v", x) // s is of form Type{typeID: 0x00} - s = s[strings.Index(s, "0x")+2 : len(s)-1] - return strings.Repeat("0", n-len(s)) + s -} - -type byAlpha []language.Tag - -func (a byAlpha) Len() int { return len(a) } -func (a byAlpha) Swap(i, j int) { a[i], a[j] = a[j], a[i] } -func (a byAlpha) Less(i, j int) bool { return a[i].String() < a[j].String() } diff --git a/vendor/golang.org/x/text/language/go1_1.go b/vendor/golang.org/x/text/language/go1_1.go deleted file mode 100644 index 380f4c09..00000000 --- a/vendor/golang.org/x/text/language/go1_1.go +++ /dev/null @@ -1,38 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build !go1.2 - -package language - -import "sort" - -func sortStable(s sort.Interface) { - ss := stableSort{ - s: s, - pos: make([]int, s.Len()), - } - for i := range ss.pos { - ss.pos[i] = i - } - sort.Sort(&ss) -} - -type stableSort struct { - s sort.Interface - pos []int -} - -func (s *stableSort) Len() int { - return len(s.pos) -} - -func (s *stableSort) Less(i, j int) bool { - return s.s.Less(i, j) || !s.s.Less(j, i) && s.pos[i] < s.pos[j] -} - -func (s *stableSort) Swap(i, j int) { - s.s.Swap(i, j) - s.pos[i], s.pos[j] = s.pos[j], s.pos[i] -} diff --git a/vendor/golang.org/x/text/language/go1_2.go b/vendor/golang.org/x/text/language/go1_2.go deleted file mode 100644 index 38268c57..00000000 --- a/vendor/golang.org/x/text/language/go1_2.go +++ /dev/null @@ -1,11 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build go1.2 - -package language - -import "sort" - -var sortStable = sort.Stable diff --git a/vendor/golang.org/x/text/language/index.go b/vendor/golang.org/x/text/language/index.go deleted file mode 100644 index 973db9fd..00000000 --- a/vendor/golang.org/x/text/language/index.go +++ /dev/null @@ -1,769 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -// NumCompactTags is the number of common tags. The maximum tag is -// NumCompactTags-1. -const NumCompactTags = 754 - -var specialTags = []Tag{ // 2 elements - 0: {lang: 0xd7, region: 0x6d, script: 0x0, pVariant: 0x5, pExt: 0xe, str: "ca-ES-valencia"}, - 1: {lang: 0x138, region: 0x134, script: 0x0, pVariant: 0x5, pExt: 0x5, str: "en-US-u-va-posix"}, -} // Size: 72 bytes - -var coreTags = map[uint32]uint16{ - 0x0: 0, // und - 0x01600000: 3, // af - 0x016000d1: 4, // af-NA - 0x01600160: 5, // af-ZA - 0x01c00000: 6, // agq - 0x01c00051: 7, // agq-CM - 0x02100000: 8, // ak - 0x0210007f: 9, // ak-GH - 0x02700000: 10, // am - 0x0270006e: 11, // am-ET - 0x03a00000: 12, // ar - 0x03a00001: 13, // ar-001 - 0x03a00022: 14, // ar-AE - 0x03a00038: 15, // ar-BH - 0x03a00061: 16, // ar-DJ - 0x03a00066: 17, // ar-DZ - 0x03a0006a: 18, // ar-EG - 0x03a0006b: 19, // ar-EH - 0x03a0006c: 20, // ar-ER - 0x03a00096: 21, // ar-IL - 0x03a0009a: 22, // ar-IQ - 0x03a000a0: 23, // ar-JO - 0x03a000a7: 24, // ar-KM - 0x03a000ab: 25, // ar-KW - 0x03a000af: 26, // ar-LB - 0x03a000b8: 27, // ar-LY - 0x03a000b9: 28, // ar-MA - 0x03a000c8: 29, // ar-MR - 0x03a000e0: 30, // ar-OM - 0x03a000ec: 31, // ar-PS - 0x03a000f2: 32, // ar-QA - 0x03a00107: 33, // ar-SA - 0x03a0010a: 34, // ar-SD - 0x03a00114: 35, // ar-SO - 0x03a00116: 36, // ar-SS - 0x03a0011b: 37, // ar-SY - 0x03a0011f: 38, // ar-TD - 0x03a00127: 39, // ar-TN - 0x03a0015d: 40, // ar-YE - 0x04000000: 41, // ars - 0x04300000: 42, // as - 0x04300098: 43, // as-IN - 0x04400000: 44, // asa - 0x0440012e: 45, // asa-TZ - 0x04800000: 46, // ast - 0x0480006d: 47, // ast-ES - 0x05800000: 48, // az - 0x0581e000: 49, // az-Cyrl - 0x0581e031: 50, // az-Cyrl-AZ - 0x05852000: 51, // az-Latn - 0x05852031: 52, // az-Latn-AZ - 0x05e00000: 53, // bas - 0x05e00051: 54, // bas-CM - 0x07100000: 55, // be - 0x07100046: 56, // be-BY - 0x07500000: 57, // bem - 0x07500161: 58, // bem-ZM - 0x07900000: 59, // bez - 0x0790012e: 60, // bez-TZ - 0x07e00000: 61, // bg - 0x07e00037: 62, // bg-BG - 0x08200000: 63, // bh - 0x0a000000: 64, // bm - 0x0a0000c2: 65, // bm-ML - 0x0a500000: 66, // bn - 0x0a500034: 67, // bn-BD - 0x0a500098: 68, // bn-IN - 0x0a900000: 69, // bo - 0x0a900052: 70, // bo-CN - 0x0a900098: 71, // bo-IN - 0x0b200000: 72, // br - 0x0b200077: 73, // br-FR - 0x0b500000: 74, // brx - 0x0b500098: 75, // brx-IN - 0x0b700000: 76, // bs - 0x0b71e000: 77, // bs-Cyrl - 0x0b71e032: 78, // bs-Cyrl-BA - 0x0b752000: 79, // bs-Latn - 0x0b752032: 80, // bs-Latn-BA - 0x0d700000: 81, // ca - 0x0d700021: 82, // ca-AD - 0x0d70006d: 83, // ca-ES - 0x0d700077: 84, // ca-FR - 0x0d70009d: 85, // ca-IT - 0x0dc00000: 86, // ce - 0x0dc00105: 87, // ce-RU - 0x0df00000: 88, // cgg - 0x0df00130: 89, // cgg-UG - 0x0e500000: 90, // chr - 0x0e500134: 91, // chr-US - 0x0e900000: 92, // ckb - 0x0e90009a: 93, // ckb-IQ - 0x0e90009b: 94, // ckb-IR - 0x0f900000: 95, // cs - 0x0f90005d: 96, // cs-CZ - 0x0fd00000: 97, // cu - 0x0fd00105: 98, // cu-RU - 0x0ff00000: 99, // cy - 0x0ff0007a: 100, // cy-GB - 0x10000000: 101, // da - 0x10000062: 102, // da-DK - 0x10000081: 103, // da-GL - 0x10700000: 104, // dav - 0x107000a3: 105, // dav-KE - 0x10c00000: 106, // de - 0x10c0002d: 107, // de-AT - 0x10c00035: 108, // de-BE - 0x10c0004d: 109, // de-CH - 0x10c0005f: 110, // de-DE - 0x10c0009d: 111, // de-IT - 0x10c000b1: 112, // de-LI - 0x10c000b6: 113, // de-LU - 0x11600000: 114, // dje - 0x116000d3: 115, // dje-NE - 0x11e00000: 116, // dsb - 0x11e0005f: 117, // dsb-DE - 0x12300000: 118, // dua - 0x12300051: 119, // dua-CM - 0x12700000: 120, // dv - 0x12a00000: 121, // dyo - 0x12a00113: 122, // dyo-SN - 0x12c00000: 123, // dz - 0x12c00042: 124, // dz-BT - 0x12e00000: 125, // ebu - 0x12e000a3: 126, // ebu-KE - 0x12f00000: 127, // ee - 0x12f0007f: 128, // ee-GH - 0x12f00121: 129, // ee-TG - 0x13500000: 130, // el - 0x1350005c: 131, // el-CY - 0x13500086: 132, // el-GR - 0x13800000: 133, // en - 0x13800001: 134, // en-001 - 0x1380001a: 135, // en-150 - 0x13800024: 136, // en-AG - 0x13800025: 137, // en-AI - 0x1380002c: 138, // en-AS - 0x1380002d: 139, // en-AT - 0x1380002e: 140, // en-AU - 0x13800033: 141, // en-BB - 0x13800035: 142, // en-BE - 0x13800039: 143, // en-BI - 0x1380003c: 144, // en-BM - 0x13800041: 145, // en-BS - 0x13800045: 146, // en-BW - 0x13800047: 147, // en-BZ - 0x13800048: 148, // en-CA - 0x13800049: 149, // en-CC - 0x1380004d: 150, // en-CH - 0x1380004f: 151, // en-CK - 0x13800051: 152, // en-CM - 0x1380005b: 153, // en-CX - 0x1380005c: 154, // en-CY - 0x1380005f: 155, // en-DE - 0x13800060: 156, // en-DG - 0x13800062: 157, // en-DK - 0x13800063: 158, // en-DM - 0x1380006c: 159, // en-ER - 0x13800071: 160, // en-FI - 0x13800072: 161, // en-FJ - 0x13800073: 162, // en-FK - 0x13800074: 163, // en-FM - 0x1380007a: 164, // en-GB - 0x1380007b: 165, // en-GD - 0x1380007e: 166, // en-GG - 0x1380007f: 167, // en-GH - 0x13800080: 168, // en-GI - 0x13800082: 169, // en-GM - 0x13800089: 170, // en-GU - 0x1380008b: 171, // en-GY - 0x1380008c: 172, // en-HK - 0x13800095: 173, // en-IE - 0x13800096: 174, // en-IL - 0x13800097: 175, // en-IM - 0x13800098: 176, // en-IN - 0x13800099: 177, // en-IO - 0x1380009e: 178, // en-JE - 0x1380009f: 179, // en-JM - 0x138000a3: 180, // en-KE - 0x138000a6: 181, // en-KI - 0x138000a8: 182, // en-KN - 0x138000ac: 183, // en-KY - 0x138000b0: 184, // en-LC - 0x138000b3: 185, // en-LR - 0x138000b4: 186, // en-LS - 0x138000be: 187, // en-MG - 0x138000bf: 188, // en-MH - 0x138000c5: 189, // en-MO - 0x138000c6: 190, // en-MP - 0x138000c9: 191, // en-MS - 0x138000ca: 192, // en-MT - 0x138000cb: 193, // en-MU - 0x138000cd: 194, // en-MW - 0x138000cf: 195, // en-MY - 0x138000d1: 196, // en-NA - 0x138000d4: 197, // en-NF - 0x138000d5: 198, // en-NG - 0x138000d8: 199, // en-NL - 0x138000dc: 200, // en-NR - 0x138000de: 201, // en-NU - 0x138000df: 202, // en-NZ - 0x138000e5: 203, // en-PG - 0x138000e6: 204, // en-PH - 0x138000e7: 205, // en-PK - 0x138000ea: 206, // en-PN - 0x138000eb: 207, // en-PR - 0x138000ef: 208, // en-PW - 0x13800106: 209, // en-RW - 0x13800108: 210, // en-SB - 0x13800109: 211, // en-SC - 0x1380010a: 212, // en-SD - 0x1380010b: 213, // en-SE - 0x1380010c: 214, // en-SG - 0x1380010d: 215, // en-SH - 0x1380010e: 216, // en-SI - 0x13800111: 217, // en-SL - 0x13800116: 218, // en-SS - 0x1380011a: 219, // en-SX - 0x1380011c: 220, // en-SZ - 0x1380011e: 221, // en-TC - 0x13800124: 222, // en-TK - 0x13800128: 223, // en-TO - 0x1380012b: 224, // en-TT - 0x1380012c: 225, // en-TV - 0x1380012e: 226, // en-TZ - 0x13800130: 227, // en-UG - 0x13800132: 228, // en-UM - 0x13800134: 229, // en-US - 0x13800138: 230, // en-VC - 0x1380013b: 231, // en-VG - 0x1380013c: 232, // en-VI - 0x1380013e: 233, // en-VU - 0x13800141: 234, // en-WS - 0x13800160: 235, // en-ZA - 0x13800161: 236, // en-ZM - 0x13800163: 237, // en-ZW - 0x13b00000: 238, // eo - 0x13b00001: 239, // eo-001 - 0x13d00000: 240, // es - 0x13d0001e: 241, // es-419 - 0x13d0002b: 242, // es-AR - 0x13d0003e: 243, // es-BO - 0x13d00040: 244, // es-BR - 0x13d00047: 245, // es-BZ - 0x13d00050: 246, // es-CL - 0x13d00053: 247, // es-CO - 0x13d00055: 248, // es-CR - 0x13d00058: 249, // es-CU - 0x13d00064: 250, // es-DO - 0x13d00067: 251, // es-EA - 0x13d00068: 252, // es-EC - 0x13d0006d: 253, // es-ES - 0x13d00085: 254, // es-GQ - 0x13d00088: 255, // es-GT - 0x13d0008e: 256, // es-HN - 0x13d00093: 257, // es-IC - 0x13d000ce: 258, // es-MX - 0x13d000d7: 259, // es-NI - 0x13d000e1: 260, // es-PA - 0x13d000e3: 261, // es-PE - 0x13d000e6: 262, // es-PH - 0x13d000eb: 263, // es-PR - 0x13d000f0: 264, // es-PY - 0x13d00119: 265, // es-SV - 0x13d00134: 266, // es-US - 0x13d00135: 267, // es-UY - 0x13d0013a: 268, // es-VE - 0x13f00000: 269, // et - 0x13f00069: 270, // et-EE - 0x14400000: 271, // eu - 0x1440006d: 272, // eu-ES - 0x14500000: 273, // ewo - 0x14500051: 274, // ewo-CM - 0x14700000: 275, // fa - 0x14700023: 276, // fa-AF - 0x1470009b: 277, // fa-IR - 0x14d00000: 278, // ff - 0x14d00051: 279, // ff-CM - 0x14d00083: 280, // ff-GN - 0x14d000c8: 281, // ff-MR - 0x14d00113: 282, // ff-SN - 0x15000000: 283, // fi - 0x15000071: 284, // fi-FI - 0x15200000: 285, // fil - 0x152000e6: 286, // fil-PH - 0x15700000: 287, // fo - 0x15700062: 288, // fo-DK - 0x15700075: 289, // fo-FO - 0x15d00000: 290, // fr - 0x15d00035: 291, // fr-BE - 0x15d00036: 292, // fr-BF - 0x15d00039: 293, // fr-BI - 0x15d0003a: 294, // fr-BJ - 0x15d0003b: 295, // fr-BL - 0x15d00048: 296, // fr-CA - 0x15d0004a: 297, // fr-CD - 0x15d0004b: 298, // fr-CF - 0x15d0004c: 299, // fr-CG - 0x15d0004d: 300, // fr-CH - 0x15d0004e: 301, // fr-CI - 0x15d00051: 302, // fr-CM - 0x15d00061: 303, // fr-DJ - 0x15d00066: 304, // fr-DZ - 0x15d00077: 305, // fr-FR - 0x15d00079: 306, // fr-GA - 0x15d0007d: 307, // fr-GF - 0x15d00083: 308, // fr-GN - 0x15d00084: 309, // fr-GP - 0x15d00085: 310, // fr-GQ - 0x15d00090: 311, // fr-HT - 0x15d000a7: 312, // fr-KM - 0x15d000b6: 313, // fr-LU - 0x15d000b9: 314, // fr-MA - 0x15d000ba: 315, // fr-MC - 0x15d000bd: 316, // fr-MF - 0x15d000be: 317, // fr-MG - 0x15d000c2: 318, // fr-ML - 0x15d000c7: 319, // fr-MQ - 0x15d000c8: 320, // fr-MR - 0x15d000cb: 321, // fr-MU - 0x15d000d2: 322, // fr-NC - 0x15d000d3: 323, // fr-NE - 0x15d000e4: 324, // fr-PF - 0x15d000e9: 325, // fr-PM - 0x15d00101: 326, // fr-RE - 0x15d00106: 327, // fr-RW - 0x15d00109: 328, // fr-SC - 0x15d00113: 329, // fr-SN - 0x15d0011b: 330, // fr-SY - 0x15d0011f: 331, // fr-TD - 0x15d00121: 332, // fr-TG - 0x15d00127: 333, // fr-TN - 0x15d0013e: 334, // fr-VU - 0x15d0013f: 335, // fr-WF - 0x15d0015e: 336, // fr-YT - 0x16800000: 337, // fur - 0x1680009d: 338, // fur-IT - 0x16c00000: 339, // fy - 0x16c000d8: 340, // fy-NL - 0x16d00000: 341, // ga - 0x16d00095: 342, // ga-IE - 0x17c00000: 343, // gd - 0x17c0007a: 344, // gd-GB - 0x18e00000: 345, // gl - 0x18e0006d: 346, // gl-ES - 0x1a100000: 347, // gsw - 0x1a10004d: 348, // gsw-CH - 0x1a100077: 349, // gsw-FR - 0x1a1000b1: 350, // gsw-LI - 0x1a200000: 351, // gu - 0x1a200098: 352, // gu-IN - 0x1a700000: 353, // guw - 0x1a900000: 354, // guz - 0x1a9000a3: 355, // guz-KE - 0x1aa00000: 356, // gv - 0x1aa00097: 357, // gv-IM - 0x1b200000: 358, // ha - 0x1b20007f: 359, // ha-GH - 0x1b2000d3: 360, // ha-NE - 0x1b2000d5: 361, // ha-NG - 0x1b600000: 362, // haw - 0x1b600134: 363, // haw-US - 0x1ba00000: 364, // he - 0x1ba00096: 365, // he-IL - 0x1bc00000: 366, // hi - 0x1bc00098: 367, // hi-IN - 0x1cf00000: 368, // hr - 0x1cf00032: 369, // hr-BA - 0x1cf0008f: 370, // hr-HR - 0x1d000000: 371, // hsb - 0x1d00005f: 372, // hsb-DE - 0x1d300000: 373, // hu - 0x1d300091: 374, // hu-HU - 0x1d500000: 375, // hy - 0x1d500027: 376, // hy-AM - 0x1df00000: 377, // id - 0x1df00094: 378, // id-ID - 0x1e500000: 379, // ig - 0x1e5000d5: 380, // ig-NG - 0x1e800000: 381, // ii - 0x1e800052: 382, // ii-CN - 0x1f600000: 383, // is - 0x1f60009c: 384, // is-IS - 0x1f700000: 385, // it - 0x1f70004d: 386, // it-CH - 0x1f70009d: 387, // it-IT - 0x1f700112: 388, // it-SM - 0x1f700137: 389, // it-VA - 0x1f800000: 390, // iu - 0x1fe00000: 391, // ja - 0x1fe000a1: 392, // ja-JP - 0x20100000: 393, // jbo - 0x20500000: 394, // jgo - 0x20500051: 395, // jgo-CM - 0x20800000: 396, // jmc - 0x2080012e: 397, // jmc-TZ - 0x20c00000: 398, // jv - 0x20e00000: 399, // ka - 0x20e0007c: 400, // ka-GE - 0x21000000: 401, // kab - 0x21000066: 402, // kab-DZ - 0x21400000: 403, // kaj - 0x21500000: 404, // kam - 0x215000a3: 405, // kam-KE - 0x21d00000: 406, // kcg - 0x22100000: 407, // kde - 0x2210012e: 408, // kde-TZ - 0x22500000: 409, // kea - 0x22500059: 410, // kea-CV - 0x23200000: 411, // khq - 0x232000c2: 412, // khq-ML - 0x23700000: 413, // ki - 0x237000a3: 414, // ki-KE - 0x24000000: 415, // kk - 0x240000ad: 416, // kk-KZ - 0x24200000: 417, // kkj - 0x24200051: 418, // kkj-CM - 0x24300000: 419, // kl - 0x24300081: 420, // kl-GL - 0x24400000: 421, // kln - 0x244000a3: 422, // kln-KE - 0x24800000: 423, // km - 0x248000a5: 424, // km-KH - 0x24f00000: 425, // kn - 0x24f00098: 426, // kn-IN - 0x25200000: 427, // ko - 0x252000a9: 428, // ko-KP - 0x252000aa: 429, // ko-KR - 0x25400000: 430, // kok - 0x25400098: 431, // kok-IN - 0x26800000: 432, // ks - 0x26800098: 433, // ks-IN - 0x26900000: 434, // ksb - 0x2690012e: 435, // ksb-TZ - 0x26b00000: 436, // ksf - 0x26b00051: 437, // ksf-CM - 0x26c00000: 438, // ksh - 0x26c0005f: 439, // ksh-DE - 0x27200000: 440, // ku - 0x27f00000: 441, // kw - 0x27f0007a: 442, // kw-GB - 0x28800000: 443, // ky - 0x288000a4: 444, // ky-KG - 0x28f00000: 445, // lag - 0x28f0012e: 446, // lag-TZ - 0x29300000: 447, // lb - 0x293000b6: 448, // lb-LU - 0x2a100000: 449, // lg - 0x2a100130: 450, // lg-UG - 0x2ad00000: 451, // lkt - 0x2ad00134: 452, // lkt-US - 0x2b300000: 453, // ln - 0x2b300029: 454, // ln-AO - 0x2b30004a: 455, // ln-CD - 0x2b30004b: 456, // ln-CF - 0x2b30004c: 457, // ln-CG - 0x2b600000: 458, // lo - 0x2b6000ae: 459, // lo-LA - 0x2bd00000: 460, // lrc - 0x2bd0009a: 461, // lrc-IQ - 0x2bd0009b: 462, // lrc-IR - 0x2be00000: 463, // lt - 0x2be000b5: 464, // lt-LT - 0x2c000000: 465, // lu - 0x2c00004a: 466, // lu-CD - 0x2c200000: 467, // luo - 0x2c2000a3: 468, // luo-KE - 0x2c300000: 469, // luy - 0x2c3000a3: 470, // luy-KE - 0x2c500000: 471, // lv - 0x2c5000b7: 472, // lv-LV - 0x2cf00000: 473, // mas - 0x2cf000a3: 474, // mas-KE - 0x2cf0012e: 475, // mas-TZ - 0x2e700000: 476, // mer - 0x2e7000a3: 477, // mer-KE - 0x2eb00000: 478, // mfe - 0x2eb000cb: 479, // mfe-MU - 0x2ef00000: 480, // mg - 0x2ef000be: 481, // mg-MG - 0x2f000000: 482, // mgh - 0x2f0000d0: 483, // mgh-MZ - 0x2f200000: 484, // mgo - 0x2f200051: 485, // mgo-CM - 0x2fd00000: 486, // mk - 0x2fd000c1: 487, // mk-MK - 0x30200000: 488, // ml - 0x30200098: 489, // ml-IN - 0x30900000: 490, // mn - 0x309000c4: 491, // mn-MN - 0x31900000: 492, // mr - 0x31900098: 493, // mr-IN - 0x31d00000: 494, // ms - 0x31d0003d: 495, // ms-BN - 0x31d000cf: 496, // ms-MY - 0x31d0010c: 497, // ms-SG - 0x31e00000: 498, // mt - 0x31e000ca: 499, // mt-MT - 0x32300000: 500, // mua - 0x32300051: 501, // mua-CM - 0x32f00000: 502, // my - 0x32f000c3: 503, // my-MM - 0x33800000: 504, // mzn - 0x3380009b: 505, // mzn-IR - 0x33f00000: 506, // nah - 0x34300000: 507, // naq - 0x343000d1: 508, // naq-NA - 0x34500000: 509, // nb - 0x345000d9: 510, // nb-NO - 0x3450010f: 511, // nb-SJ - 0x34c00000: 512, // nd - 0x34c00163: 513, // nd-ZW - 0x34e00000: 514, // nds - 0x34e0005f: 515, // nds-DE - 0x34e000d8: 516, // nds-NL - 0x34f00000: 517, // ne - 0x34f00098: 518, // ne-IN - 0x34f000da: 519, // ne-NP - 0x36500000: 520, // nl - 0x3650002f: 521, // nl-AW - 0x36500035: 522, // nl-BE - 0x3650003f: 523, // nl-BQ - 0x3650005a: 524, // nl-CW - 0x365000d8: 525, // nl-NL - 0x36500115: 526, // nl-SR - 0x3650011a: 527, // nl-SX - 0x36600000: 528, // nmg - 0x36600051: 529, // nmg-CM - 0x36800000: 530, // nn - 0x368000d9: 531, // nn-NO - 0x36a00000: 532, // nnh - 0x36a00051: 533, // nnh-CM - 0x36d00000: 534, // no - 0x37300000: 535, // nqo - 0x37400000: 536, // nr - 0x37800000: 537, // nso - 0x37e00000: 538, // nus - 0x37e00116: 539, // nus-SS - 0x38500000: 540, // ny - 0x38700000: 541, // nyn - 0x38700130: 542, // nyn-UG - 0x38e00000: 543, // om - 0x38e0006e: 544, // om-ET - 0x38e000a3: 545, // om-KE - 0x39300000: 546, // or - 0x39300098: 547, // or-IN - 0x39600000: 548, // os - 0x3960007c: 549, // os-GE - 0x39600105: 550, // os-RU - 0x39b00000: 551, // pa - 0x39b05000: 552, // pa-Arab - 0x39b050e7: 553, // pa-Arab-PK - 0x39b2f000: 554, // pa-Guru - 0x39b2f098: 555, // pa-Guru-IN - 0x39f00000: 556, // pap - 0x3b100000: 557, // pl - 0x3b1000e8: 558, // pl-PL - 0x3bb00000: 559, // prg - 0x3bb00001: 560, // prg-001 - 0x3bc00000: 561, // ps - 0x3bc00023: 562, // ps-AF - 0x3be00000: 563, // pt - 0x3be00029: 564, // pt-AO - 0x3be00040: 565, // pt-BR - 0x3be0004d: 566, // pt-CH - 0x3be00059: 567, // pt-CV - 0x3be00085: 568, // pt-GQ - 0x3be0008a: 569, // pt-GW - 0x3be000b6: 570, // pt-LU - 0x3be000c5: 571, // pt-MO - 0x3be000d0: 572, // pt-MZ - 0x3be000ed: 573, // pt-PT - 0x3be00117: 574, // pt-ST - 0x3be00125: 575, // pt-TL - 0x3c200000: 576, // qu - 0x3c20003e: 577, // qu-BO - 0x3c200068: 578, // qu-EC - 0x3c2000e3: 579, // qu-PE - 0x3d200000: 580, // rm - 0x3d20004d: 581, // rm-CH - 0x3d700000: 582, // rn - 0x3d700039: 583, // rn-BI - 0x3da00000: 584, // ro - 0x3da000bb: 585, // ro-MD - 0x3da00103: 586, // ro-RO - 0x3dc00000: 587, // rof - 0x3dc0012e: 588, // rof-TZ - 0x3e000000: 589, // ru - 0x3e000046: 590, // ru-BY - 0x3e0000a4: 591, // ru-KG - 0x3e0000ad: 592, // ru-KZ - 0x3e0000bb: 593, // ru-MD - 0x3e000105: 594, // ru-RU - 0x3e00012f: 595, // ru-UA - 0x3e300000: 596, // rw - 0x3e300106: 597, // rw-RW - 0x3e400000: 598, // rwk - 0x3e40012e: 599, // rwk-TZ - 0x3e900000: 600, // sah - 0x3e900105: 601, // sah-RU - 0x3ea00000: 602, // saq - 0x3ea000a3: 603, // saq-KE - 0x3f100000: 604, // sbp - 0x3f10012e: 605, // sbp-TZ - 0x3fa00000: 606, // sdh - 0x3fb00000: 607, // se - 0x3fb00071: 608, // se-FI - 0x3fb000d9: 609, // se-NO - 0x3fb0010b: 610, // se-SE - 0x3fd00000: 611, // seh - 0x3fd000d0: 612, // seh-MZ - 0x3ff00000: 613, // ses - 0x3ff000c2: 614, // ses-ML - 0x40000000: 615, // sg - 0x4000004b: 616, // sg-CF - 0x40600000: 617, // shi - 0x40652000: 618, // shi-Latn - 0x406520b9: 619, // shi-Latn-MA - 0x406d2000: 620, // shi-Tfng - 0x406d20b9: 621, // shi-Tfng-MA - 0x40a00000: 622, // si - 0x40a000b2: 623, // si-LK - 0x41000000: 624, // sk - 0x41000110: 625, // sk-SK - 0x41400000: 626, // sl - 0x4140010e: 627, // sl-SI - 0x41a00000: 628, // sma - 0x41b00000: 629, // smi - 0x41c00000: 630, // smj - 0x41d00000: 631, // smn - 0x41d00071: 632, // smn-FI - 0x42000000: 633, // sms - 0x42100000: 634, // sn - 0x42100163: 635, // sn-ZW - 0x42700000: 636, // so - 0x42700061: 637, // so-DJ - 0x4270006e: 638, // so-ET - 0x427000a3: 639, // so-KE - 0x42700114: 640, // so-SO - 0x42f00000: 641, // sq - 0x42f00026: 642, // sq-AL - 0x42f000c1: 643, // sq-MK - 0x42f0014c: 644, // sq-XK - 0x43000000: 645, // sr - 0x4301e000: 646, // sr-Cyrl - 0x4301e032: 647, // sr-Cyrl-BA - 0x4301e0bc: 648, // sr-Cyrl-ME - 0x4301e104: 649, // sr-Cyrl-RS - 0x4301e14c: 650, // sr-Cyrl-XK - 0x43052000: 651, // sr-Latn - 0x43052032: 652, // sr-Latn-BA - 0x430520bc: 653, // sr-Latn-ME - 0x43052104: 654, // sr-Latn-RS - 0x4305214c: 655, // sr-Latn-XK - 0x43500000: 656, // ss - 0x43800000: 657, // ssy - 0x43900000: 658, // st - 0x44200000: 659, // sv - 0x44200030: 660, // sv-AX - 0x44200071: 661, // sv-FI - 0x4420010b: 662, // sv-SE - 0x44300000: 663, // sw - 0x4430004a: 664, // sw-CD - 0x443000a3: 665, // sw-KE - 0x4430012e: 666, // sw-TZ - 0x44300130: 667, // sw-UG - 0x44c00000: 668, // syr - 0x44e00000: 669, // ta - 0x44e00098: 670, // ta-IN - 0x44e000b2: 671, // ta-LK - 0x44e000cf: 672, // ta-MY - 0x44e0010c: 673, // ta-SG - 0x45f00000: 674, // te - 0x45f00098: 675, // te-IN - 0x46200000: 676, // teo - 0x462000a3: 677, // teo-KE - 0x46200130: 678, // teo-UG - 0x46900000: 679, // th - 0x46900122: 680, // th-TH - 0x46d00000: 681, // ti - 0x46d0006c: 682, // ti-ER - 0x46d0006e: 683, // ti-ET - 0x46f00000: 684, // tig - 0x47400000: 685, // tk - 0x47400126: 686, // tk-TM - 0x47e00000: 687, // tn - 0x48000000: 688, // to - 0x48000128: 689, // to-TO - 0x48800000: 690, // tr - 0x4880005c: 691, // tr-CY - 0x4880012a: 692, // tr-TR - 0x48c00000: 693, // ts - 0x4a200000: 694, // twq - 0x4a2000d3: 695, // twq-NE - 0x4a700000: 696, // tzm - 0x4a7000b9: 697, // tzm-MA - 0x4aa00000: 698, // ug - 0x4aa00052: 699, // ug-CN - 0x4ac00000: 700, // uk - 0x4ac0012f: 701, // uk-UA - 0x4b200000: 702, // ur - 0x4b200098: 703, // ur-IN - 0x4b2000e7: 704, // ur-PK - 0x4ba00000: 705, // uz - 0x4ba05000: 706, // uz-Arab - 0x4ba05023: 707, // uz-Arab-AF - 0x4ba1e000: 708, // uz-Cyrl - 0x4ba1e136: 709, // uz-Cyrl-UZ - 0x4ba52000: 710, // uz-Latn - 0x4ba52136: 711, // uz-Latn-UZ - 0x4bc00000: 712, // vai - 0x4bc52000: 713, // vai-Latn - 0x4bc520b3: 714, // vai-Latn-LR - 0x4bcd9000: 715, // vai-Vaii - 0x4bcd90b3: 716, // vai-Vaii-LR - 0x4be00000: 717, // ve - 0x4c100000: 718, // vi - 0x4c10013d: 719, // vi-VN - 0x4c700000: 720, // vo - 0x4c700001: 721, // vo-001 - 0x4ca00000: 722, // vun - 0x4ca0012e: 723, // vun-TZ - 0x4cc00000: 724, // wa - 0x4cd00000: 725, // wae - 0x4cd0004d: 726, // wae-CH - 0x4e300000: 727, // wo - 0x4f000000: 728, // xh - 0x4f900000: 729, // xog - 0x4f900130: 730, // xog-UG - 0x50700000: 731, // yav - 0x50700051: 732, // yav-CM - 0x51000000: 733, // yi - 0x51000001: 734, // yi-001 - 0x51600000: 735, // yo - 0x5160003a: 736, // yo-BJ - 0x516000d5: 737, // yo-NG - 0x51d00000: 738, // yue - 0x51d0008c: 739, // yue-HK - 0x52600000: 740, // zgh - 0x526000b9: 741, // zgh-MA - 0x52700000: 742, // zh - 0x52734000: 743, // zh-Hans - 0x52734052: 744, // zh-Hans-CN - 0x5273408c: 745, // zh-Hans-HK - 0x527340c5: 746, // zh-Hans-MO - 0x5273410c: 747, // zh-Hans-SG - 0x52735000: 748, // zh-Hant - 0x5273508c: 749, // zh-Hant-HK - 0x527350c5: 750, // zh-Hant-MO - 0x5273512d: 751, // zh-Hant-TW - 0x52c00000: 752, // zu - 0x52c00160: 753, // zu-ZA -} - -// Total table size 4592 bytes (4KiB); checksum: C25F8AFF diff --git a/vendor/golang.org/x/text/language/language.go b/vendor/golang.org/x/text/language/language.go deleted file mode 100644 index e2da1ab1..00000000 --- a/vendor/golang.org/x/text/language/language.go +++ /dev/null @@ -1,982 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate go run gen.go gen_common.go -output tables.go -//go:generate go run gen_index.go - -// Package language implements BCP 47 language tags and related functionality. -// -// The Tag type, which is used to represent languages, is agnostic to the -// meaning of its subtags. Tags are not fully canonicalized to preserve -// information that may be valuable in certain contexts. As a consequence, two -// different tags may represent identical languages. -// -// Initializing language- or locale-specific components usually consists of -// two steps. The first step is to select a display language based on the -// preferred languages of the user and the languages supported by an application. -// The second step is to create the language-specific services based on -// this selection. Each is discussed in more details below. -// -// Matching preferred against supported languages -// -// An application may support various languages. This list is typically limited -// by the languages for which there exists translations of the user interface. -// Similarly, a user may provide a list of preferred languages which is limited -// by the languages understood by this user. -// An application should use a Matcher to find the best supported language based -// on the user's preferred list. -// Matchers are aware of the intricacies of equivalence between languages. -// The default Matcher implementation takes into account things such as -// deprecated subtags, legacy tags, and mutual intelligibility between scripts -// and languages. -// -// A Matcher for English, Australian English, Danish, and standard Mandarin can -// be defined as follows: -// -// var matcher = language.NewMatcher([]language.Tag{ -// language.English, // The first language is used as fallback. -// language.MustParse("en-AU"), -// language.Danish, -// language.Chinese, -// }) -// -// The following code selects the best match for someone speaking Spanish and -// Norwegian: -// -// preferred := []language.Tag{ language.Spanish, language.Norwegian } -// tag, _, _ := matcher.Match(preferred...) -// -// In this case, the best match is Danish, as Danish is sufficiently a match to -// Norwegian to not have to fall back to the default. -// See ParseAcceptLanguage on how to handle the Accept-Language HTTP header. -// -// Selecting language-specific services -// -// One should always use the Tag returned by the Matcher to create an instance -// of any of the language-specific services provided by the text repository. -// This prevents the mixing of languages, such as having a different language for -// messages and display names, as well as improper casing or sorting order for -// the selected language. -// Using the returned Tag also allows user-defined settings, such as collation -// order or numbering system to be transparently passed as options. -// -// If you have language-specific data in your application, however, it will in -// most cases suffice to use the index returned by the matcher to identify -// the user language. -// The following loop provides an alternative in case this is not sufficient: -// -// supported := map[language.Tag]data{ -// language.English: enData, -// language.MustParse("en-AU"): enAUData, -// language.Danish: daData, -// language.Chinese: zhData, -// } -// tag, _, _ := matcher.Match(preferred...) -// for ; tag != language.Und; tag = tag.Parent() { -// if v, ok := supported[tag]; ok { -// return v -// } -// } -// return enData // should not reach here -// -// Repeatedly taking the Parent of the tag returned by Match will eventually -// match one of the tags used to initialize the Matcher. -// -// Canonicalization -// -// By default, only legacy and deprecated tags are converted into their -// canonical equivalent. All other information is preserved. This approach makes -// the confidence scores more accurate and allows matchers to distinguish -// between variants that are otherwise lost. -// -// As a consequence, two tags that should be treated as identical according to -// BCP 47 or CLDR, like "en-Latn" and "en", will be represented differently. The -// Matchers will handle such distinctions, though, and are aware of the -// equivalence relations. The CanonType type can be used to alter the -// canonicalization form. -// -// References -// -// BCP 47 - Tags for Identifying Languages -// http://tools.ietf.org/html/bcp47 -package language - -// TODO: Remove above NOTE after: -// - verifying that tables are dropped correctly (most notably matcher tables). - -import ( - "errors" - "fmt" - "strings" -) - -const ( - // maxCoreSize is the maximum size of a BCP 47 tag without variants and - // extensions. Equals max lang (3) + script (4) + max reg (3) + 2 dashes. - maxCoreSize = 12 - - // max99thPercentileSize is a somewhat arbitrary buffer size that presumably - // is large enough to hold at least 99% of the BCP 47 tags. - max99thPercentileSize = 32 - - // maxSimpleUExtensionSize is the maximum size of a -u extension with one - // key-type pair. Equals len("-u-") + key (2) + dash + max value (8). - maxSimpleUExtensionSize = 14 -) - -// Tag represents a BCP 47 language tag. It is used to specify an instance of a -// specific language or locale. All language tag values are guaranteed to be -// well-formed. -type Tag struct { - lang langID - region regionID - // TODO: we will soon run out of positions for script. Idea: instead of - // storing lang, region, and script codes, store only the compact index and - // have a lookup table from this code to its expansion. This greatly speeds - // up table lookup, speed up common variant cases. - // This will also immediately free up 3 extra bytes. Also, the pVariant - // field can now be moved to the lookup table, as the compact index uniquely - // determines the offset of a possible variant. - script scriptID - pVariant byte // offset in str, includes preceding '-' - pExt uint16 // offset of first extension, includes preceding '-' - - // str is the string representation of the Tag. It will only be used if the - // tag has variants or extensions. - str string -} - -// Make is a convenience wrapper for Parse that omits the error. -// In case of an error, a sensible default is returned. -func Make(s string) Tag { - return Default.Make(s) -} - -// Make is a convenience wrapper for c.Parse that omits the error. -// In case of an error, a sensible default is returned. -func (c CanonType) Make(s string) Tag { - t, _ := c.Parse(s) - return t -} - -// Raw returns the raw base language, script and region, without making an -// attempt to infer their values. -func (t Tag) Raw() (b Base, s Script, r Region) { - return Base{t.lang}, Script{t.script}, Region{t.region} -} - -// equalTags compares language, script and region subtags only. -func (t Tag) equalTags(a Tag) bool { - return t.lang == a.lang && t.script == a.script && t.region == a.region -} - -// IsRoot returns true if t is equal to language "und". -func (t Tag) IsRoot() bool { - if int(t.pVariant) < len(t.str) { - return false - } - return t.equalTags(und) -} - -// private reports whether the Tag consists solely of a private use tag. -func (t Tag) private() bool { - return t.str != "" && t.pVariant == 0 -} - -// CanonType can be used to enable or disable various types of canonicalization. -type CanonType int - -const ( - // Replace deprecated base languages with their preferred replacements. - DeprecatedBase CanonType = 1 << iota - // Replace deprecated scripts with their preferred replacements. - DeprecatedScript - // Replace deprecated regions with their preferred replacements. - DeprecatedRegion - // Remove redundant scripts. - SuppressScript - // Normalize legacy encodings. This includes legacy languages defined in - // CLDR as well as bibliographic codes defined in ISO-639. - Legacy - // Map the dominant language of a macro language group to the macro language - // subtag. For example cmn -> zh. - Macro - // The CLDR flag should be used if full compatibility with CLDR is required. - // There are a few cases where language.Tag may differ from CLDR. To follow all - // of CLDR's suggestions, use All|CLDR. - CLDR - - // Raw can be used to Compose or Parse without Canonicalization. - Raw CanonType = 0 - - // Replace all deprecated tags with their preferred replacements. - Deprecated = DeprecatedBase | DeprecatedScript | DeprecatedRegion - - // All canonicalizations recommended by BCP 47. - BCP47 = Deprecated | SuppressScript - - // All canonicalizations. - All = BCP47 | Legacy | Macro - - // Default is the canonicalization used by Parse, Make and Compose. To - // preserve as much information as possible, canonicalizations that remove - // potentially valuable information are not included. The Matcher is - // designed to recognize similar tags that would be the same if - // they were canonicalized using All. - Default = Deprecated | Legacy - - canonLang = DeprecatedBase | Legacy | Macro - - // TODO: LikelyScript, LikelyRegion: suppress similar to ICU. -) - -// canonicalize returns the canonicalized equivalent of the tag and -// whether there was any change. -func (t Tag) canonicalize(c CanonType) (Tag, bool) { - if c == Raw { - return t, false - } - changed := false - if c&SuppressScript != 0 { - if t.lang < langNoIndexOffset && uint8(t.script) == suppressScript[t.lang] { - t.script = 0 - changed = true - } - } - if c&canonLang != 0 { - for { - if l, aliasType := normLang(t.lang); l != t.lang { - switch aliasType { - case langLegacy: - if c&Legacy != 0 { - if t.lang == _sh && t.script == 0 { - t.script = _Latn - } - t.lang = l - changed = true - } - case langMacro: - if c&Macro != 0 { - // We deviate here from CLDR. The mapping "nb" -> "no" - // qualifies as a typical Macro language mapping. However, - // for legacy reasons, CLDR maps "no", the macro language - // code for Norwegian, to the dominant variant "nb". This - // change is currently under consideration for CLDR as well. - // See http://unicode.org/cldr/trac/ticket/2698 and also - // http://unicode.org/cldr/trac/ticket/1790 for some of the - // practical implications. TODO: this check could be removed - // if CLDR adopts this change. - if c&CLDR == 0 || t.lang != _nb { - changed = true - t.lang = l - } - } - case langDeprecated: - if c&DeprecatedBase != 0 { - if t.lang == _mo && t.region == 0 { - t.region = _MD - } - t.lang = l - changed = true - // Other canonicalization types may still apply. - continue - } - } - } else if c&Legacy != 0 && t.lang == _no && c&CLDR != 0 { - t.lang = _nb - changed = true - } - break - } - } - if c&DeprecatedScript != 0 { - if t.script == _Qaai { - changed = true - t.script = _Zinh - } - } - if c&DeprecatedRegion != 0 { - if r := normRegion(t.region); r != 0 { - changed = true - t.region = r - } - } - return t, changed -} - -// Canonicalize returns the canonicalized equivalent of the tag. -func (c CanonType) Canonicalize(t Tag) (Tag, error) { - t, changed := t.canonicalize(c) - if changed { - t.remakeString() - } - return t, nil -} - -// Confidence indicates the level of certainty for a given return value. -// For example, Serbian may be written in Cyrillic or Latin script. -// The confidence level indicates whether a value was explicitly specified, -// whether it is typically the only possible value, or whether there is -// an ambiguity. -type Confidence int - -const ( - No Confidence = iota // full confidence that there was no match - Low // most likely value picked out of a set of alternatives - High // value is generally assumed to be the correct match - Exact // exact match or explicitly specified value -) - -var confName = []string{"No", "Low", "High", "Exact"} - -func (c Confidence) String() string { - return confName[c] -} - -// remakeString is used to update t.str in case lang, script or region changed. -// It is assumed that pExt and pVariant still point to the start of the -// respective parts. -func (t *Tag) remakeString() { - if t.str == "" { - return - } - extra := t.str[t.pVariant:] - if t.pVariant > 0 { - extra = extra[1:] - } - if t.equalTags(und) && strings.HasPrefix(extra, "x-") { - t.str = extra - t.pVariant = 0 - t.pExt = 0 - return - } - var buf [max99thPercentileSize]byte // avoid extra memory allocation in most cases. - b := buf[:t.genCoreBytes(buf[:])] - if extra != "" { - diff := len(b) - int(t.pVariant) - b = append(b, '-') - b = append(b, extra...) - t.pVariant = uint8(int(t.pVariant) + diff) - t.pExt = uint16(int(t.pExt) + diff) - } else { - t.pVariant = uint8(len(b)) - t.pExt = uint16(len(b)) - } - t.str = string(b) -} - -// genCoreBytes writes a string for the base languages, script and region tags -// to the given buffer and returns the number of bytes written. It will never -// write more than maxCoreSize bytes. -func (t *Tag) genCoreBytes(buf []byte) int { - n := t.lang.stringToBuf(buf[:]) - if t.script != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.script.String()) - } - if t.region != 0 { - n += copy(buf[n:], "-") - n += copy(buf[n:], t.region.String()) - } - return n -} - -// String returns the canonical string representation of the language tag. -func (t Tag) String() string { - if t.str != "" { - return t.str - } - if t.script == 0 && t.region == 0 { - return t.lang.String() - } - buf := [maxCoreSize]byte{} - return string(buf[:t.genCoreBytes(buf[:])]) -} - -// Base returns the base language of the language tag. If the base language is -// unspecified, an attempt will be made to infer it from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Base() (Base, Confidence) { - if t.lang != 0 { - return Base{t.lang}, Exact - } - c := High - if t.script == 0 && !(Region{t.region}).IsCountry() { - c = Low - } - if tag, err := addTags(t); err == nil && tag.lang != 0 { - return Base{tag.lang}, c - } - return Base{0}, No -} - -// Script infers the script for the language tag. If it was not explicitly given, it will infer -// a most likely candidate. -// If more than one script is commonly used for a language, the most likely one -// is returned with a low confidence indication. For example, it returns (Cyrl, Low) -// for Serbian. -// If a script cannot be inferred (Zzzz, No) is returned. We do not use Zyyy (undetermined) -// as one would suspect from the IANA registry for BCP 47. In a Unicode context Zyyy marks -// common characters (like 1, 2, 3, '.', etc.) and is therefore more like multiple scripts. -// See http://www.unicode.org/reports/tr24/#Values for more details. Zzzz is also used for -// unknown value in CLDR. (Zzzz, Exact) is returned if Zzzz was explicitly specified. -// Note that an inferred script is never guaranteed to be the correct one. Latin is -// almost exclusively used for Afrikaans, but Arabic has been used for some texts -// in the past. Also, the script that is commonly used may change over time. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Script() (Script, Confidence) { - if t.script != 0 { - return Script{t.script}, Exact - } - sc, c := scriptID(_Zzzz), No - if t.lang < langNoIndexOffset { - if scr := scriptID(suppressScript[t.lang]); scr != 0 { - // Note: it is not always the case that a language with a suppress - // script value is only written in one script (e.g. kk, ms, pa). - if t.region == 0 { - return Script{scriptID(scr)}, High - } - sc, c = scr, High - } - } - if tag, err := addTags(t); err == nil { - if tag.script != sc { - sc, c = tag.script, Low - } - } else { - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil && tag.script != sc { - sc, c = tag.script, Low - } - } - return Script{sc}, c -} - -// Region returns the region for the language tag. If it was not explicitly given, it will -// infer a most likely candidate from the context. -// It uses a variant of CLDR's Add Likely Subtags algorithm. This is subject to change. -func (t Tag) Region() (Region, Confidence) { - if t.region != 0 { - return Region{t.region}, Exact - } - if t, err := addTags(t); err == nil { - return Region{t.region}, Low // TODO: differentiate between high and low. - } - t, _ = (Deprecated | Macro).Canonicalize(t) - if tag, err := addTags(t); err == nil { - return Region{tag.region}, Low - } - return Region{_ZZ}, No // TODO: return world instead of undetermined? -} - -// Variant returns the variants specified explicitly for this language tag. -// or nil if no variant was specified. -func (t Tag) Variants() []Variant { - v := []Variant{} - if int(t.pVariant) < int(t.pExt) { - for x, str := "", t.str[t.pVariant:t.pExt]; str != ""; { - x, str = nextToken(str) - v = append(v, Variant{x}) - } - } - return v -} - -// Parent returns the CLDR parent of t. In CLDR, missing fields in data for a -// specific language are substituted with fields from the parent language. -// The parent for a language may change for newer versions of CLDR. -func (t Tag) Parent() Tag { - if t.str != "" { - // Strip the variants and extensions. - t, _ = Raw.Compose(t.Raw()) - if t.region == 0 && t.script != 0 && t.lang != 0 { - base, _ := addTags(Tag{lang: t.lang}) - if base.script == t.script { - return Tag{lang: t.lang} - } - } - return t - } - if t.lang != 0 { - if t.region != 0 { - maxScript := t.script - if maxScript == 0 { - max, _ := addTags(t) - maxScript = max.script - } - - for i := range parents { - if langID(parents[i].lang) == t.lang && scriptID(parents[i].maxScript) == maxScript { - for _, r := range parents[i].fromRegion { - if regionID(r) == t.region { - return Tag{ - lang: t.lang, - script: scriptID(parents[i].script), - region: regionID(parents[i].toRegion), - } - } - } - } - } - - // Strip the script if it is the default one. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != maxScript { - return Tag{lang: t.lang, script: maxScript} - } - return Tag{lang: t.lang} - } else if t.script != 0 { - // The parent for an base-script pair with a non-default script is - // "und" instead of the base language. - base, _ := addTags(Tag{lang: t.lang}) - if base.script != t.script { - return und - } - return Tag{lang: t.lang} - } - } - return und -} - -// returns token t and the rest of the string. -func nextToken(s string) (t, tail string) { - p := strings.Index(s[1:], "-") - if p == -1 { - return s[1:], "" - } - p++ - return s[1:p], s[p:] -} - -// Extension is a single BCP 47 extension. -type Extension struct { - s string -} - -// String returns the string representation of the extension, including the -// type tag. -func (e Extension) String() string { - return e.s -} - -// ParseExtension parses s as an extension and returns it on success. -func ParseExtension(s string) (e Extension, err error) { - scan := makeScannerString(s) - var end int - if n := len(scan.token); n != 1 { - return Extension{}, errSyntax - } - scan.toLower(0, len(scan.b)) - end = parseExtension(&scan) - if end != len(s) { - return Extension{}, errSyntax - } - return Extension{string(scan.b)}, nil -} - -// Type returns the one-byte extension type of e. It returns 0 for the zero -// exception. -func (e Extension) Type() byte { - if e.s == "" { - return 0 - } - return e.s[0] -} - -// Tokens returns the list of tokens of e. -func (e Extension) Tokens() []string { - return strings.Split(e.s, "-") -} - -// Extension returns the extension of type x for tag t. It will return -// false for ok if t does not have the requested extension. The returned -// extension will be invalid in this case. -func (t Tag) Extension(x byte) (ext Extension, ok bool) { - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - if ext[0] == x { - return Extension{ext}, true - } - } - return Extension{}, false -} - -// Extensions returns all extensions of t. -func (t Tag) Extensions() []Extension { - e := []Extension{} - for i := int(t.pExt); i < len(t.str)-1; { - var ext string - i, ext = getExtension(t.str, i) - e = append(e, Extension{ext}) - } - return e -} - -// TypeForKey returns the type associated with the given key, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// TypeForKey will traverse the inheritance chain to get the correct value. -func (t Tag) TypeForKey(key string) string { - if start, end, _ := t.findTypeForKey(key); end != start { - return t.str[start:end] - } - return "" -} - -var ( - errPrivateUse = errors.New("cannot set a key on a private use tag") - errInvalidArguments = errors.New("invalid key or type") -) - -// SetTypeForKey returns a new Tag with the key set to type, where key and type -// are of the allowed values defined for the Unicode locale extension ('u') in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// An empty value removes an existing pair with the same key. -func (t Tag) SetTypeForKey(key, value string) (Tag, error) { - if t.private() { - return t, errPrivateUse - } - if len(key) != 2 { - return t, errInvalidArguments - } - - // Remove the setting if value is "". - if value == "" { - start, end, _ := t.findTypeForKey(key) - if start != end { - // Remove key tag and leading '-'. - start -= 4 - - // Remove a possible empty extension. - if (end == len(t.str) || t.str[end+2] == '-') && t.str[start-2] == '-' { - start -= 2 - } - if start == int(t.pVariant) && end == len(t.str) { - t.str = "" - t.pVariant, t.pExt = 0, 0 - } else { - t.str = fmt.Sprintf("%s%s", t.str[:start], t.str[end:]) - } - } - return t, nil - } - - if len(value) < 3 || len(value) > 8 { - return t, errInvalidArguments - } - - var ( - buf [maxCoreSize + maxSimpleUExtensionSize]byte - uStart int // start of the -u extension. - ) - - // Generate the tag string if needed. - if t.str == "" { - uStart = t.genCoreBytes(buf[:]) - buf[uStart] = '-' - uStart++ - } - - // Create new key-type pair and parse it to verify. - b := buf[uStart:] - copy(b, "u-") - copy(b[2:], key) - b[4] = '-' - b = b[:5+copy(b[5:], value)] - scan := makeScanner(b) - if parseExtensions(&scan); scan.err != nil { - return t, scan.err - } - - // Assemble the replacement string. - if t.str == "" { - t.pVariant, t.pExt = byte(uStart-1), uint16(uStart-1) - t.str = string(buf[:uStart+len(b)]) - } else { - s := t.str - start, end, hasExt := t.findTypeForKey(key) - if start == end { - if hasExt { - b = b[2:] - } - t.str = fmt.Sprintf("%s-%s%s", s[:start], b, s[end:]) - } else { - t.str = fmt.Sprintf("%s%s%s", s[:start], value, s[end:]) - } - } - return t, nil -} - -// findKeyAndType returns the start and end position for the type corresponding -// to key or the point at which to insert the key-value pair if the type -// wasn't found. The hasExt return value reports whether an -u extension was present. -// Note: the extensions are typically very small and are likely to contain -// only one key-type pair. -func (t Tag) findTypeForKey(key string) (start, end int, hasExt bool) { - p := int(t.pExt) - if len(key) != 2 || p == len(t.str) || p == 0 { - return p, p, false - } - s := t.str - - // Find the correct extension. - for p++; s[p] != 'u'; p++ { - if s[p] > 'u' { - p-- - return p, p, false - } - if p = nextExtension(s, p); p == len(s) { - return len(s), len(s), false - } - } - // Proceed to the hyphen following the extension name. - p++ - - // curKey is the key currently being processed. - curKey := "" - - // Iterate over keys until we get the end of a section. - for { - // p points to the hyphen preceding the current token. - if p3 := p + 3; s[p3] == '-' { - // Found a key. - // Check whether we just processed the key that was requested. - if curKey == key { - return start, p, true - } - // Set to the next key and continue scanning type tokens. - curKey = s[p+1 : p3] - if curKey > key { - return p, p, true - } - // Start of the type token sequence. - start = p + 4 - // A type is at least 3 characters long. - p += 7 // 4 + 3 - } else { - // Attribute or type, which is at least 3 characters long. - p += 4 - } - // p points past the third character of a type or attribute. - max := p + 5 // maximum length of token plus hyphen. - if len(s) < max { - max = len(s) - } - for ; p < max && s[p] != '-'; p++ { - } - // Bail if we have exhausted all tokens or if the next token starts - // a new extension. - if p == len(s) || s[p+2] == '-' { - if curKey == key { - return start, p, true - } - return p, p, true - } - } -} - -// CompactIndex returns an index, where 0 <= index < NumCompactTags, for tags -// for which data exists in the text repository. The index will change over time -// and should not be stored in persistent storage. Extensions, except for the -// 'va' type of the 'u' extension, are ignored. It will return 0, false if no -// compact tag exists, where 0 is the index for the root language (Und). -func CompactIndex(t Tag) (index int, ok bool) { - // TODO: perhaps give more frequent tags a lower index. - // TODO: we could make the indexes stable. This will excluded some - // possibilities for optimization, so don't do this quite yet. - b, s, r := t.Raw() - if len(t.str) > 0 { - if strings.HasPrefix(t.str, "x-") { - // We have no entries for user-defined tags. - return 0, false - } - if uint16(t.pVariant) != t.pExt { - // There are no tags with variants and an u-va type. - if t.TypeForKey("va") != "" { - return 0, false - } - t, _ = Raw.Compose(b, s, r, t.Variants()) - } else if _, ok := t.Extension('u'); ok { - // Strip all but the 'va' entry. - variant := t.TypeForKey("va") - t, _ = Raw.Compose(b, s, r) - t, _ = t.SetTypeForKey("va", variant) - } - if len(t.str) > 0 { - // We have some variants. - for i, s := range specialTags { - if s == t { - return i + 1, true - } - } - return 0, false - } - } - // No variants specified: just compare core components. - // The key has the form lllssrrr, where l, s, and r are nibbles for - // respectively the langID, scriptID, and regionID. - key := uint32(b.langID) << (8 + 12) - key |= uint32(s.scriptID) << 12 - key |= uint32(r.regionID) - x, ok := coreTags[key] - return int(x), ok -} - -// Base is an ISO 639 language code, used for encoding the base language -// of a language tag. -type Base struct { - langID -} - -// ParseBase parses a 2- or 3-letter ISO 639 code. -// It returns a ValueError if s is a well-formed but unknown language identifier -// or another error if another error occurred. -func ParseBase(s string) (Base, error) { - if n := len(s); n < 2 || 3 < n { - return Base{}, errSyntax - } - var buf [3]byte - l, err := getLangID(buf[:copy(buf[:], s)]) - return Base{l}, err -} - -// Script is a 4-letter ISO 15924 code for representing scripts. -// It is idiomatically represented in title case. -type Script struct { - scriptID -} - -// ParseScript parses a 4-letter ISO 15924 code. -// It returns a ValueError if s is a well-formed but unknown script identifier -// or another error if another error occurred. -func ParseScript(s string) (Script, error) { - if len(s) != 4 { - return Script{}, errSyntax - } - var buf [4]byte - sc, err := getScriptID(script, buf[:copy(buf[:], s)]) - return Script{sc}, err -} - -// Region is an ISO 3166-1 or UN M.49 code for representing countries and regions. -type Region struct { - regionID -} - -// EncodeM49 returns the Region for the given UN M.49 code. -// It returns an error if r is not a valid code. -func EncodeM49(r int) (Region, error) { - rid, err := getRegionM49(r) - return Region{rid}, err -} - -// ParseRegion parses a 2- or 3-letter ISO 3166-1 or a UN M.49 code. -// It returns a ValueError if s is a well-formed but unknown region identifier -// or another error if another error occurred. -func ParseRegion(s string) (Region, error) { - if n := len(s); n < 2 || 3 < n { - return Region{}, errSyntax - } - var buf [3]byte - r, err := getRegionID(buf[:copy(buf[:], s)]) - return Region{r}, err -} - -// IsCountry returns whether this region is a country or autonomous area. This -// includes non-standard definitions from CLDR. -func (r Region) IsCountry() bool { - if r.regionID == 0 || r.IsGroup() || r.IsPrivateUse() && r.regionID != _XK { - return false - } - return true -} - -// IsGroup returns whether this region defines a collection of regions. This -// includes non-standard definitions from CLDR. -func (r Region) IsGroup() bool { - if r.regionID == 0 { - return false - } - return int(regionInclusion[r.regionID]) < len(regionContainment) -} - -// Contains returns whether Region c is contained by Region r. It returns true -// if c == r. -func (r Region) Contains(c Region) bool { - return r.regionID.contains(c.regionID) -} - -func (r regionID) contains(c regionID) bool { - if r == c { - return true - } - g := regionInclusion[r] - if g >= nRegionGroups { - return false - } - m := regionContainment[g] - - d := regionInclusion[c] - b := regionInclusionBits[d] - - // A contained country may belong to multiple disjoint groups. Matching any - // of these indicates containment. If the contained region is a group, it - // must strictly be a subset. - if d >= nRegionGroups { - return b&m != 0 - } - return b&^m == 0 -} - -var errNoTLD = errors.New("language: region is not a valid ccTLD") - -// TLD returns the country code top-level domain (ccTLD). UK is returned for GB. -// In all other cases it returns either the region itself or an error. -// -// This method may return an error for a region for which there exists a -// canonical form with a ccTLD. To get that ccTLD canonicalize r first. The -// region will already be canonicalized it was obtained from a Tag that was -// obtained using any of the default methods. -func (r Region) TLD() (Region, error) { - // See http://en.wikipedia.org/wiki/Country_code_top-level_domain for the - // difference between ISO 3166-1 and IANA ccTLD. - if r.regionID == _GB { - r = Region{_UK} - } - if (r.typ() & ccTLD) == 0 { - return Region{}, errNoTLD - } - return r, nil -} - -// Canonicalize returns the region or a possible replacement if the region is -// deprecated. It will not return a replacement for deprecated regions that -// are split into multiple regions. -func (r Region) Canonicalize() Region { - if cr := normRegion(r.regionID); cr != 0 { - return Region{cr} - } - return r -} - -// Variant represents a registered variant of a language as defined by BCP 47. -type Variant struct { - variant string -} - -// ParseVariant parses and returns a Variant. An error is returned if s is not -// a valid variant. -func ParseVariant(s string) (Variant, error) { - s = strings.ToLower(s) - if _, ok := variantIndex[s]; ok { - return Variant{s}, nil - } - return Variant{}, mkErrInvalid([]byte(s)) -} - -// String returns the string representation of the variant. -func (v Variant) String() string { - return v.variant -} diff --git a/vendor/golang.org/x/text/language/lookup.go b/vendor/golang.org/x/text/language/lookup.go deleted file mode 100644 index 1d80ac37..00000000 --- a/vendor/golang.org/x/text/language/lookup.go +++ /dev/null @@ -1,396 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "fmt" - "sort" - "strconv" - - "golang.org/x/text/internal/tag" -) - -// findIndex tries to find the given tag in idx and returns a standardized error -// if it could not be found. -func findIndex(idx tag.Index, key []byte, form string) (index int, err error) { - if !tag.FixCase(form, key) { - return 0, errSyntax - } - i := idx.Index(key) - if i == -1 { - return 0, mkErrInvalid(key) - } - return i, nil -} - -func searchUint(imap []uint16, key uint16) int { - return sort.Search(len(imap), func(i int) bool { - return imap[i] >= key - }) -} - -type langID uint16 - -// getLangID returns the langID of s if s is a canonical subtag -// or langUnknown if s is not a canonical subtag. -func getLangID(s []byte) (langID, error) { - if len(s) == 2 { - return getLangISO2(s) - } - return getLangISO3(s) -} - -// mapLang returns the mapped langID of id according to mapping m. -func normLang(id langID) (langID, langAliasType) { - k := sort.Search(len(langAliasMap), func(i int) bool { - return langAliasMap[i].from >= uint16(id) - }) - if k < len(langAliasMap) && langAliasMap[k].from == uint16(id) { - return langID(langAliasMap[k].to), langAliasTypes[k] - } - return id, langAliasTypeUnknown -} - -// getLangISO2 returns the langID for the given 2-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO2(s []byte) (langID, error) { - if !tag.FixCase("zz", s) { - return 0, errSyntax - } - if i := lang.Index(s); i != -1 && lang.Elem(i)[3] != 0 { - return langID(i), nil - } - return 0, mkErrInvalid(s) -} - -const base = 'z' - 'a' + 1 - -func strToInt(s []byte) uint { - v := uint(0) - for i := 0; i < len(s); i++ { - v *= base - v += uint(s[i] - 'a') - } - return v -} - -// converts the given integer to the original ASCII string passed to strToInt. -// len(s) must match the number of characters obtained. -func intToStr(v uint, s []byte) { - for i := len(s) - 1; i >= 0; i-- { - s[i] = byte(v%base) + 'a' - v /= base - } -} - -// getLangISO3 returns the langID for the given 3-letter ISO language code -// or unknownLang if this does not exist. -func getLangISO3(s []byte) (langID, error) { - if tag.FixCase("und", s) { - // first try to match canonical 3-letter entries - for i := lang.Index(s[:2]); i != -1; i = lang.Next(s[:2], i) { - if e := lang.Elem(i); e[3] == 0 && e[2] == s[2] { - // We treat "und" as special and always translate it to "unspecified". - // Note that ZZ and Zzzz are private use and are not treated as - // unspecified by default. - id := langID(i) - if id == nonCanonicalUnd { - return 0, nil - } - return id, nil - } - } - if i := altLangISO3.Index(s); i != -1 { - return langID(altLangIndex[altLangISO3.Elem(i)[3]]), nil - } - n := strToInt(s) - if langNoIndex[n/8]&(1<<(n%8)) != 0 { - return langID(n) + langNoIndexOffset, nil - } - // Check for non-canonical uses of ISO3. - for i := lang.Index(s[:1]); i != -1; i = lang.Next(s[:1], i) { - if e := lang.Elem(i); e[2] == s[1] && e[3] == s[2] { - return langID(i), nil - } - } - return 0, mkErrInvalid(s) - } - return 0, errSyntax -} - -// stringToBuf writes the string to b and returns the number of bytes -// written. cap(b) must be >= 3. -func (id langID) stringToBuf(b []byte) int { - if id >= langNoIndexOffset { - intToStr(uint(id)-langNoIndexOffset, b[:3]) - return 3 - } else if id == 0 { - return copy(b, "und") - } - l := lang[id<<2:] - if l[3] == 0 { - return copy(b, l[:3]) - } - return copy(b, l[:2]) -} - -// String returns the BCP 47 representation of the langID. -// Use b as variable name, instead of id, to ensure the variable -// used is consistent with that of Base in which this type is embedded. -func (b langID) String() string { - if b == 0 { - return "und" - } else if b >= langNoIndexOffset { - b -= langNoIndexOffset - buf := [3]byte{} - intToStr(uint(b), buf[:]) - return string(buf[:]) - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } - return l[:2] -} - -// ISO3 returns the ISO 639-3 language code. -func (b langID) ISO3() string { - if b == 0 || b >= langNoIndexOffset { - return b.String() - } - l := lang.Elem(int(b)) - if l[3] == 0 { - return l[:3] - } else if l[2] == 0 { - return altLangISO3.Elem(int(l[3]))[:3] - } - // This allocation will only happen for 3-letter ISO codes - // that are non-canonical BCP 47 language identifiers. - return l[0:1] + l[2:4] -} - -// IsPrivateUse reports whether this language code is reserved for private use. -func (b langID) IsPrivateUse() bool { - return langPrivateStart <= b && b <= langPrivateEnd -} - -type regionID uint16 - -// getRegionID returns the region id for s if s is a valid 2-letter region code -// or unknownRegion. -func getRegionID(s []byte) (regionID, error) { - if len(s) == 3 { - if isAlpha(s[0]) { - return getRegionISO3(s) - } - if i, err := strconv.ParseUint(string(s), 10, 10); err == nil { - return getRegionM49(int(i)) - } - } - return getRegionISO2(s) -} - -// getRegionISO2 returns the regionID for the given 2-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO2(s []byte) (regionID, error) { - i, err := findIndex(regionISO, s, "ZZ") - if err != nil { - return 0, err - } - return regionID(i) + isoRegionOffset, nil -} - -// getRegionISO3 returns the regionID for the given 3-letter ISO country code -// or unknownRegion if this does not exist. -func getRegionISO3(s []byte) (regionID, error) { - if tag.FixCase("ZZZ", s) { - for i := regionISO.Index(s[:1]); i != -1; i = regionISO.Next(s[:1], i) { - if e := regionISO.Elem(i); e[2] == s[1] && e[3] == s[2] { - return regionID(i) + isoRegionOffset, nil - } - } - for i := 0; i < len(altRegionISO3); i += 3 { - if tag.Compare(altRegionISO3[i:i+3], s) == 0 { - return regionID(altRegionIDs[i/3]), nil - } - } - return 0, mkErrInvalid(s) - } - return 0, errSyntax -} - -func getRegionM49(n int) (regionID, error) { - if 0 < n && n <= 999 { - const ( - searchBits = 7 - regionBits = 9 - regionMask = 1<<regionBits - 1 - ) - idx := n >> searchBits - buf := fromM49[m49Index[idx]:m49Index[idx+1]] - val := uint16(n) << regionBits // we rely on bits shifting out - i := sort.Search(len(buf), func(i int) bool { - return buf[i] >= val - }) - if r := fromM49[int(m49Index[idx])+i]; r&^regionMask == val { - return regionID(r & regionMask), nil - } - } - var e ValueError - fmt.Fprint(bytes.NewBuffer([]byte(e.v[:])), n) - return 0, e -} - -// normRegion returns a region if r is deprecated or 0 otherwise. -// TODO: consider supporting BYS (-> BLR), CSK (-> 200 or CZ), PHI (-> PHL) and AFI (-> DJ). -// TODO: consider mapping split up regions to new most populous one (like CLDR). -func normRegion(r regionID) regionID { - m := regionOldMap - k := sort.Search(len(m), func(i int) bool { - return m[i].from >= uint16(r) - }) - if k < len(m) && m[k].from == uint16(r) { - return regionID(m[k].to) - } - return 0 -} - -const ( - iso3166UserAssigned = 1 << iota - ccTLD - bcp47Region -) - -func (r regionID) typ() byte { - return regionTypes[r] -} - -// String returns the BCP 47 representation for the region. -// It returns "ZZ" for an unspecified region. -func (r regionID) String() string { - if r < isoRegionOffset { - if r == 0 { - return "ZZ" - } - return fmt.Sprintf("%03d", r.M49()) - } - r -= isoRegionOffset - return regionISO.Elem(int(r))[:2] -} - -// ISO3 returns the 3-letter ISO code of r. -// Note that not all regions have a 3-letter ISO code. -// In such cases this method returns "ZZZ". -func (r regionID) ISO3() string { - if r < isoRegionOffset { - return "ZZZ" - } - r -= isoRegionOffset - reg := regionISO.Elem(int(r)) - switch reg[2] { - case 0: - return altRegionISO3[reg[3]:][:3] - case ' ': - return "ZZZ" - } - return reg[0:1] + reg[2:4] -} - -// M49 returns the UN M.49 encoding of r, or 0 if this encoding -// is not defined for r. -func (r regionID) M49() int { - return int(m49[r]) -} - -// IsPrivateUse reports whether r has the ISO 3166 User-assigned status. This -// may include private-use tags that are assigned by CLDR and used in this -// implementation. So IsPrivateUse and IsCountry can be simultaneously true. -func (r regionID) IsPrivateUse() bool { - return r.typ()&iso3166UserAssigned != 0 -} - -type scriptID uint8 - -// getScriptID returns the script id for string s. It assumes that s -// is of the format [A-Z][a-z]{3}. -func getScriptID(idx tag.Index, s []byte) (scriptID, error) { - i, err := findIndex(idx, s, "Zzzz") - return scriptID(i), err -} - -// String returns the script code in title case. -// It returns "Zzzz" for an unspecified script. -func (s scriptID) String() string { - if s == 0 { - return "Zzzz" - } - return script.Elem(int(s)) -} - -// IsPrivateUse reports whether this script code is reserved for private use. -func (s scriptID) IsPrivateUse() bool { - return _Qaaa <= s && s <= _Qabx -} - -const ( - maxAltTaglen = len("en-US-POSIX") - maxLen = maxAltTaglen -) - -var ( - // grandfatheredMap holds a mapping from legacy and grandfathered tags to - // their base language or index to more elaborate tag. - grandfatheredMap = map[[maxLen]byte]int16{ - [maxLen]byte{'a', 'r', 't', '-', 'l', 'o', 'j', 'b', 'a', 'n'}: _jbo, // art-lojban - [maxLen]byte{'i', '-', 'a', 'm', 'i'}: _ami, // i-ami - [maxLen]byte{'i', '-', 'b', 'n', 'n'}: _bnn, // i-bnn - [maxLen]byte{'i', '-', 'h', 'a', 'k'}: _hak, // i-hak - [maxLen]byte{'i', '-', 'k', 'l', 'i', 'n', 'g', 'o', 'n'}: _tlh, // i-klingon - [maxLen]byte{'i', '-', 'l', 'u', 'x'}: _lb, // i-lux - [maxLen]byte{'i', '-', 'n', 'a', 'v', 'a', 'j', 'o'}: _nv, // i-navajo - [maxLen]byte{'i', '-', 'p', 'w', 'n'}: _pwn, // i-pwn - [maxLen]byte{'i', '-', 't', 'a', 'o'}: _tao, // i-tao - [maxLen]byte{'i', '-', 't', 'a', 'y'}: _tay, // i-tay - [maxLen]byte{'i', '-', 't', 's', 'u'}: _tsu, // i-tsu - [maxLen]byte{'n', 'o', '-', 'b', 'o', 'k'}: _nb, // no-bok - [maxLen]byte{'n', 'o', '-', 'n', 'y', 'n'}: _nn, // no-nyn - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'f', 'r'}: _sfb, // sgn-BE-FR - [maxLen]byte{'s', 'g', 'n', '-', 'b', 'e', '-', 'n', 'l'}: _vgt, // sgn-BE-NL - [maxLen]byte{'s', 'g', 'n', '-', 'c', 'h', '-', 'd', 'e'}: _sgg, // sgn-CH-DE - [maxLen]byte{'z', 'h', '-', 'g', 'u', 'o', 'y', 'u'}: _cmn, // zh-guoyu - [maxLen]byte{'z', 'h', '-', 'h', 'a', 'k', 'k', 'a'}: _hak, // zh-hakka - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n', '-', 'n', 'a', 'n'}: _nan, // zh-min-nan - [maxLen]byte{'z', 'h', '-', 'x', 'i', 'a', 'n', 'g'}: _hsn, // zh-xiang - - // Grandfathered tags with no modern replacement will be converted as - // follows: - [maxLen]byte{'c', 'e', 'l', '-', 'g', 'a', 'u', 'l', 'i', 's', 'h'}: -1, // cel-gaulish - [maxLen]byte{'e', 'n', '-', 'g', 'b', '-', 'o', 'e', 'd'}: -2, // en-GB-oed - [maxLen]byte{'i', '-', 'd', 'e', 'f', 'a', 'u', 'l', 't'}: -3, // i-default - [maxLen]byte{'i', '-', 'e', 'n', 'o', 'c', 'h', 'i', 'a', 'n'}: -4, // i-enochian - [maxLen]byte{'i', '-', 'm', 'i', 'n', 'g', 'o'}: -5, // i-mingo - [maxLen]byte{'z', 'h', '-', 'm', 'i', 'n'}: -6, // zh-min - - // CLDR-specific tag. - [maxLen]byte{'r', 'o', 'o', 't'}: 0, // root - [maxLen]byte{'e', 'n', '-', 'u', 's', '-', 'p', 'o', 's', 'i', 'x'}: -7, // en_US_POSIX" - } - - altTagIndex = [...]uint8{0, 17, 31, 45, 61, 74, 86, 102} - - altTags = "xtg-x-cel-gaulishen-GB-oxendicten-x-i-defaultund-x-i-enochiansee-x-i-mingonan-x-zh-minen-US-u-va-posix" -) - -func grandfathered(s [maxAltTaglen]byte) (t Tag, ok bool) { - if v, ok := grandfatheredMap[s]; ok { - if v < 0 { - return Make(altTags[altTagIndex[-v-1]:altTagIndex[-v]]), true - } - t.lang = langID(v) - return t, true - } - return t, false -} diff --git a/vendor/golang.org/x/text/language/match.go b/vendor/golang.org/x/text/language/match.go deleted file mode 100644 index 63bc744a..00000000 --- a/vendor/golang.org/x/text/language/match.go +++ /dev/null @@ -1,933 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import "errors" - -// A MatchOption configures a Matcher. -type MatchOption func(*matcher) - -// PreferSameScript will, in the absence of a match, result in the first -// preferred tag with the same script as a supported tag to match this supported -// tag. The default is currently true, but this may change in the future. -func PreferSameScript(preferSame bool) MatchOption { - return func(m *matcher) { m.preferSameScript = preferSame } -} - -// Matcher is the interface that wraps the Match method. -// -// Match returns the best match for any of the given tags, along with -// a unique index associated with the returned tag and a confidence -// score. -type Matcher interface { - Match(t ...Tag) (tag Tag, index int, c Confidence) -} - -// Comprehends reports the confidence score for a speaker of a given language -// to being able to comprehend the written form of an alternative language. -func Comprehends(speaker, alternative Tag) Confidence { - _, _, c := NewMatcher([]Tag{alternative}).Match(speaker) - return c -} - -// NewMatcher returns a Matcher that matches an ordered list of preferred tags -// against a list of supported tags based on written intelligibility, closeness -// of dialect, equivalence of subtags and various other rules. It is initialized -// with the list of supported tags. The first element is used as the default -// value in case no match is found. -// -// Its Match method matches the first of the given Tags to reach a certain -// confidence threshold. The tags passed to Match should therefore be specified -// in order of preference. Extensions are ignored for matching. -// -// The index returned by the Match method corresponds to the index of the -// matched tag in t, but is augmented with the Unicode extension ('u')of the -// corresponding preferred tag. This allows user locale options to be passed -// transparently. -func NewMatcher(t []Tag, options ...MatchOption) Matcher { - return newMatcher(t, options) -} - -func (m *matcher) Match(want ...Tag) (t Tag, index int, c Confidence) { - match, w, c := m.getBest(want...) - if match != nil { - t, index = match.tag, match.index - } else { - // TODO: this should be an option - t = m.default_.tag - if m.preferSameScript { - outer: - for _, w := range want { - script, _ := w.Script() - if script.scriptID == 0 { - // Don't do anything if there is no script, such as with - // private subtags. - continue - } - for i, h := range m.supported { - if script.scriptID == h.maxScript { - t, index = h.tag, i - break outer - } - } - } - } - // TODO: select first language tag based on script. - } - if w.region != 0 && t.region != 0 && t.region.contains(w.region) { - t, _ = Raw.Compose(t, Region{w.region}) - } - // Copy options from the user-provided tag into the result tag. This is hard - // to do after the fact, so we do it here. - // TODO: add in alternative variants to -u-va-. - // TODO: add preferred region to -u-rg-. - // TODO: add other extensions. Merge with existing extensions. - if u, ok := w.Extension('u'); ok { - t, _ = Raw.Compose(t, u) - } - return t, index, c -} - -type scriptRegionFlags uint8 - -const ( - isList = 1 << iota - scriptInFrom - regionInFrom -) - -func (t *Tag) setUndefinedLang(id langID) { - if t.lang == 0 { - t.lang = id - } -} - -func (t *Tag) setUndefinedScript(id scriptID) { - if t.script == 0 { - t.script = id - } -} - -func (t *Tag) setUndefinedRegion(id regionID) { - if t.region == 0 || t.region.contains(id) { - t.region = id - } -} - -// ErrMissingLikelyTagsData indicates no information was available -// to compute likely values of missing tags. -var ErrMissingLikelyTagsData = errors.New("missing likely tags data") - -// addLikelySubtags sets subtags to their most likely value, given the locale. -// In most cases this means setting fields for unknown values, but in some -// cases it may alter a value. It returns a ErrMissingLikelyTagsData error -// if the given locale cannot be expanded. -func (t Tag) addLikelySubtags() (Tag, error) { - id, err := addTags(t) - if err != nil { - return t, err - } else if id.equalTags(t) { - return t, nil - } - id.remakeString() - return id, nil -} - -// specializeRegion attempts to specialize a group region. -func specializeRegion(t *Tag) bool { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if langID(x.lang) == t.lang && scriptID(x.script) == t.script { - t.region = regionID(x.region) - } - return true - } - return false -} - -func addTags(t Tag) (Tag, error) { - // We leave private use identifiers alone. - if t.private() { - return t, nil - } - if t.script != 0 && t.region != 0 { - if t.lang != 0 { - // already fully specified - specializeRegion(&t) - return t, nil - } - // Search matches for und-script-region. Note that for these cases - // region will never be a group so there is no need to check for this. - list := likelyRegion[t.region : t.region+1] - if x := list[0]; x.flags&isList != 0 { - list = likelyRegionList[x.lang : x.lang+uint16(x.script)] - } - for _, x := range list { - // Deviating from the spec. See match_test.go for details. - if scriptID(x.script) == t.script { - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - } - if t.lang != 0 { - // Search matches for lang-script and lang-region, where lang != und. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - list := likelyLangList[x.region : x.region+uint16(x.script)] - if t.script != 0 { - for _, x := range list { - if scriptID(x.script) == t.script && x.flags&scriptInFrom != 0 { - t.setUndefinedRegion(regionID(x.region)) - return t, nil - } - } - } else if t.region != 0 { - count := 0 - goodScript := true - tt := t - for _, x := range list { - // We visit all entries for which the script was not - // defined, including the ones where the region was not - // defined. This allows for proper disambiguation within - // regions. - if x.flags&scriptInFrom == 0 && t.region.contains(regionID(x.region)) { - tt.region = regionID(x.region) - tt.setUndefinedScript(scriptID(x.script)) - goodScript = goodScript && tt.script == scriptID(x.script) - count++ - } - } - if count == 1 { - return tt, nil - } - // Even if we fail to find a unique Region, we might have - // an unambiguous script. - if goodScript { - t.script = tt.script - } - } - } - } - } else { - // Search matches for und-script. - if t.script != 0 { - x := likelyScript[t.script] - if x.region != 0 { - t.setUndefinedRegion(regionID(x.region)) - t.setUndefinedLang(langID(x.lang)) - return t, nil - } - } - // Search matches for und-region. If und-script-region exists, it would - // have been found earlier. - if t.region != 0 { - if i := regionInclusion[t.region]; i < nRegionGroups { - x := likelyRegionGroup[i] - if x.region != 0 { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - t.region = regionID(x.region) - } - } else { - x := likelyRegion[t.region] - if x.flags&isList != 0 { - x = likelyRegionList[x.lang] - } - if x.script != 0 && x.flags != scriptInFrom { - t.setUndefinedLang(langID(x.lang)) - t.setUndefinedScript(scriptID(x.script)) - return t, nil - } - } - } - } - - // Search matches for lang. - if t.lang < langNoIndexOffset { - x := likelyLang[t.lang] - if x.flags&isList != 0 { - x = likelyLangList[x.region] - } - if x.region != 0 { - t.setUndefinedScript(scriptID(x.script)) - t.setUndefinedRegion(regionID(x.region)) - } - specializeRegion(&t) - if t.lang == 0 { - t.lang = _en // default language - } - return t, nil - } - return t, ErrMissingLikelyTagsData -} - -func (t *Tag) setTagsFrom(id Tag) { - t.lang = id.lang - t.script = id.script - t.region = id.region -} - -// minimize removes the region or script subtags from t such that -// t.addLikelySubtags() == t.minimize().addLikelySubtags(). -func (t Tag) minimize() (Tag, error) { - t, err := minimizeTags(t) - if err != nil { - return t, err - } - t.remakeString() - return t, nil -} - -// minimizeTags mimics the behavior of the ICU 51 C implementation. -func minimizeTags(t Tag) (Tag, error) { - if t.equalTags(und) { - return t, nil - } - max, err := addTags(t) - if err != nil { - return t, err - } - for _, id := range [...]Tag{ - {lang: t.lang}, - {lang: t.lang, region: t.region}, - {lang: t.lang, script: t.script}, - } { - if x, err := addTags(id); err == nil && max.equalTags(x) { - t.setTagsFrom(id) - break - } - } - return t, nil -} - -// Tag Matching -// CLDR defines an algorithm for finding the best match between two sets of language -// tags. The basic algorithm defines how to score a possible match and then find -// the match with the best score -// (see http://www.unicode.org/reports/tr35/#LanguageMatching). -// Using scoring has several disadvantages. The scoring obfuscates the importance of -// the various factors considered, making the algorithm harder to understand. Using -// scoring also requires the full score to be computed for each pair of tags. -// -// We will use a different algorithm which aims to have the following properties: -// - clarity on the precedence of the various selection factors, and -// - improved performance by allowing early termination of a comparison. -// -// Matching algorithm (overview) -// Input: -// - supported: a set of supported tags -// - default: the default tag to return in case there is no match -// - desired: list of desired tags, ordered by preference, starting with -// the most-preferred. -// -// Algorithm: -// 1) Set the best match to the lowest confidence level -// 2) For each tag in "desired": -// a) For each tag in "supported": -// 1) compute the match between the two tags. -// 2) if the match is better than the previous best match, replace it -// with the new match. (see next section) -// b) if the current best match is above a certain threshold, return this -// match without proceeding to the next tag in "desired". [See Note 1] -// 3) If the best match so far is below a certain threshold, return "default". -// -// Ranking: -// We use two phases to determine whether one pair of tags are a better match -// than another pair of tags. First, we determine a rough confidence level. If the -// levels are different, the one with the highest confidence wins. -// Second, if the rough confidence levels are identical, we use a set of tie-breaker -// rules. -// -// The confidence level of matching a pair of tags is determined by finding the -// lowest confidence level of any matches of the corresponding subtags (the -// result is deemed as good as its weakest link). -// We define the following levels: -// Exact - An exact match of a subtag, before adding likely subtags. -// MaxExact - An exact match of a subtag, after adding likely subtags. -// [See Note 2]. -// High - High level of mutual intelligibility between different subtag -// variants. -// Low - Low level of mutual intelligibility between different subtag -// variants. -// No - No mutual intelligibility. -// -// The following levels can occur for each type of subtag: -// Base: Exact, MaxExact, High, Low, No -// Script: Exact, MaxExact [see Note 3], Low, No -// Region: Exact, MaxExact, High -// Variant: Exact, High -// Private: Exact, No -// -// Any result with a confidence level of Low or higher is deemed a possible match. -// Once a desired tag matches any of the supported tags with a level of MaxExact -// or higher, the next desired tag is not considered (see Step 2.b). -// Note that CLDR provides languageMatching data that defines close equivalence -// classes for base languages, scripts and regions. -// -// Tie-breaking -// If we get the same confidence level for two matches, we apply a sequence of -// tie-breaking rules. The first that succeeds defines the result. The rules are -// applied in the following order. -// 1) Original language was defined and was identical. -// 2) Original region was defined and was identical. -// 3) Distance between two maximized regions was the smallest. -// 4) Original script was defined and was identical. -// 5) Distance from want tag to have tag using the parent relation [see Note 5.] -// If there is still no winner after these rules are applied, the first match -// found wins. -// -// Notes: -// [1] Note that even if we may not have a perfect match, if a match is above a -// certain threshold, it is considered a better match than any other match -// to a tag later in the list of preferred language tags. -// [2] In practice, as matching of Exact is done in a separate phase from -// matching the other levels, we reuse the Exact level to mean MaxExact in -// the second phase. As a consequence, we only need the levels defined by -// the Confidence type. The MaxExact confidence level is mapped to High in -// the public API. -// [3] We do not differentiate between maximized script values that were derived -// from suppressScript versus most likely tag data. We determined that in -// ranking the two, one ranks just after the other. Moreover, the two cannot -// occur concurrently. As a consequence, they are identical for practical -// purposes. -// [4] In case of deprecated, macro-equivalents and legacy mappings, we assign -// the MaxExact level to allow iw vs he to still be a closer match than -// en-AU vs en-US, for example. -// [5] In CLDR a locale inherits fields that are unspecified for this locale -// from its parent. Therefore, if a locale is a parent of another locale, -// it is a strong measure for closeness, especially when no other tie -// breaker rule applies. One could also argue it is inconsistent, for -// example, when pt-AO matches pt (which CLDR equates with pt-BR), even -// though its parent is pt-PT according to the inheritance rules. -// -// Implementation Details: -// There are several performance considerations worth pointing out. Most notably, -// we preprocess as much as possible (within reason) at the time of creation of a -// matcher. This includes: -// - creating a per-language map, which includes data for the raw base language -// and its canonicalized variant (if applicable), -// - expanding entries for the equivalence classes defined in CLDR's -// languageMatch data. -// The per-language map ensures that typically only a very small number of tags -// need to be considered. The pre-expansion of canonicalized subtags and -// equivalence classes reduces the amount of map lookups that need to be done at -// runtime. - -// matcher keeps a set of supported language tags, indexed by language. -type matcher struct { - default_ *haveTag - supported []*haveTag - index map[langID]*matchHeader - passSettings bool - preferSameScript bool -} - -// matchHeader has the lists of tags for exact matches and matches based on -// maximized and canonicalized tags for a given language. -type matchHeader struct { - exact []*haveTag - max []*haveTag -} - -// haveTag holds a supported Tag and its maximized script and region. The maximized -// or canonicalized language is not stored as it is not needed during matching. -type haveTag struct { - tag Tag - - // index of this tag in the original list of supported tags. - index int - - // conf is the maximum confidence that can result from matching this haveTag. - // When conf < Exact this means it was inserted after applying a CLDR equivalence rule. - conf Confidence - - // Maximized region and script. - maxRegion regionID - maxScript scriptID - - // altScript may be checked as an alternative match to maxScript. If altScript - // matches, the confidence level for this match is Low. Theoretically there - // could be multiple alternative scripts. This does not occur in practice. - altScript scriptID - - // nextMax is the index of the next haveTag with the same maximized tags. - nextMax uint16 -} - -func makeHaveTag(tag Tag, index int) (haveTag, langID) { - max := tag - if tag.lang != 0 { - max, _ = max.canonicalize(All) - max, _ = addTags(max) - max.remakeString() - } - return haveTag{tag, index, Exact, max.region, max.script, altScript(max.lang, max.script), 0}, max.lang -} - -// altScript returns an alternative script that may match the given script with -// a low confidence. At the moment, the langMatch data allows for at most one -// script to map to another and we rely on this to keep the code simple. -func altScript(l langID, s scriptID) scriptID { - for _, alt := range matchScript { - // TODO: also match cases where language is not the same. - if (langID(alt.wantLang) == l || langID(alt.haveLang) == l) && - scriptID(alt.haveScript) == s { - return scriptID(alt.wantScript) - } - } - return 0 -} - -// addIfNew adds a haveTag to the list of tags only if it is a unique tag. -// Tags that have the same maximized values are linked by index. -func (h *matchHeader) addIfNew(n haveTag, exact bool) { - // Don't add new exact matches. - for _, v := range h.exact { - if v.tag.equalsRest(n.tag) { - return - } - } - if exact { - h.exact = append(h.exact, &n) - } - // Allow duplicate maximized tags, but create a linked list to allow quickly - // comparing the equivalents and bail out. - for i, v := range h.max { - if v.maxScript == n.maxScript && - v.maxRegion == n.maxRegion && - v.tag.variantOrPrivateTagStr() == n.tag.variantOrPrivateTagStr() { - for h.max[i].nextMax != 0 { - i = int(h.max[i].nextMax) - } - h.max[i].nextMax = uint16(len(h.max)) - break - } - } - h.max = append(h.max, &n) -} - -// header returns the matchHeader for the given language. It creates one if -// it doesn't already exist. -func (m *matcher) header(l langID) *matchHeader { - if h := m.index[l]; h != nil { - return h - } - h := &matchHeader{} - m.index[l] = h - return h -} - -func toConf(d uint8) Confidence { - if d <= 10 { - return High - } - if d < 30 { - return Low - } - return No -} - -// newMatcher builds an index for the given supported tags and returns it as -// a matcher. It also expands the index by considering various equivalence classes -// for a given tag. -func newMatcher(supported []Tag, options []MatchOption) *matcher { - m := &matcher{ - index: make(map[langID]*matchHeader), - preferSameScript: true, - } - for _, o := range options { - o(m) - } - if len(supported) == 0 { - m.default_ = &haveTag{} - return m - } - // Add supported languages to the index. Add exact matches first to give - // them precedence. - for i, tag := range supported { - pair, _ := makeHaveTag(tag, i) - m.header(tag.lang).addIfNew(pair, true) - m.supported = append(m.supported, &pair) - } - m.default_ = m.header(supported[0].lang).exact[0] - for i, tag := range supported { - pair, max := makeHaveTag(tag, i) - if max != tag.lang { - m.header(max).addIfNew(pair, false) - } - } - - // TODO: include alt script. - // - don't replace regions, but allow regions to be made more specific. - - // update is used to add indexes in the map for equivalent languages. - // If force is true, the update will also apply to derived entries. To - // avoid applying a "transitive closure", use false. - update := func(want, have uint16, conf Confidence, force bool) { - if hh := m.index[langID(have)]; hh != nil { - if !force && len(hh.exact) == 0 { - return - } - hw := m.header(langID(want)) - for _, ht := range hh.max { - v := *ht - if conf < v.conf { - v.conf = conf - } - v.nextMax = 0 // this value needs to be recomputed - if v.altScript != 0 { - v.altScript = altScript(langID(want), v.maxScript) - } - hw.addIfNew(v, conf == Exact && len(hh.exact) > 0) - } - } - } - - // Add entries for languages with mutual intelligibility as defined by CLDR's - // languageMatch data. - for _, ml := range matchLang { - update(ml.want, ml.have, toConf(ml.distance), false) - if !ml.oneway { - update(ml.have, ml.want, toConf(ml.distance), false) - } - } - - // Add entries for possible canonicalizations. This is an optimization to - // ensure that only one map lookup needs to be done at runtime per desired tag. - // First we match deprecated equivalents. If they are perfect equivalents - // (their canonicalization simply substitutes a different language code, but - // nothing else), the match confidence is Exact, otherwise it is High. - for i, lm := range langAliasMap { - if lm.from == _sh { - continue - } - - // If deprecated codes match and there is no fiddling with the script or - // or region, we consider it an exact match. - conf := Exact - if langAliasTypes[i] != langMacro { - if !isExactEquivalent(langID(lm.from)) { - conf = High - } - update(lm.to, lm.from, conf, true) - } - update(lm.from, lm.to, conf, true) - } - return m -} - -// getBest gets the best matching tag in m for any of the given tags, taking into -// account the order of preference of the given tags. -func (m *matcher) getBest(want ...Tag) (got *haveTag, orig Tag, c Confidence) { - best := bestMatch{} - for _, w := range want { - var max Tag - // Check for exact match first. - h := m.index[w.lang] - if w.lang != 0 { - // Base language is defined. - if h == nil { - continue - } - for i := range h.exact { - have := h.exact[i] - if have.tag.equalsRest(w) { - return have, w, Exact - } - } - max, _ = w.canonicalize(Legacy | Deprecated) - max, _ = addTags(max) - } else { - // Base language is not defined. - if h != nil { - for i := range h.exact { - have := h.exact[i] - if have.tag.equalsRest(w) { - return have, w, Exact - } - } - } - if w.script == 0 && w.region == 0 { - // We skip all tags matching und for approximate matching, including - // private tags. - continue - } - max, _ = addTags(w) - if h = m.index[max.lang]; h == nil { - continue - } - } - // Check for match based on maximized tag. - for i := range h.max { - have := h.max[i] - best.update(have, w, max.script, max.region) - if best.conf == Exact { - for have.nextMax != 0 { - have = h.max[have.nextMax] - best.update(have, w, max.script, max.region) - } - return best.have, best.want, High - } - } - } - if best.conf <= No { - if len(want) != 0 { - return nil, want[0], No - } - return nil, Tag{}, No - } - return best.have, best.want, best.conf -} - -// bestMatch accumulates the best match so far. -type bestMatch struct { - have *haveTag - want Tag - conf Confidence - // Cached results from applying tie-breaking rules. - origLang bool - origReg bool - regGroupDist uint8 - regDist uint8 - origScript bool - parentDist uint8 // 255 if have is not an ancestor of want tag. -} - -// update updates the existing best match if the new pair is considered to be a -// better match. -// To determine if the given pair is a better match, it first computes the rough -// confidence level. If this surpasses the current match, it will replace it and -// update the tie-breaker rule cache. If there is a tie, it proceeds with applying -// a series of tie-breaker rules. If there is no conclusive winner after applying -// the tie-breaker rules, it leaves the current match as the preferred match. -func (m *bestMatch) update(have *haveTag, tag Tag, maxScript scriptID, maxRegion regionID) { - // Bail if the maximum attainable confidence is below that of the current best match. - c := have.conf - if c < m.conf { - return - } - if have.maxScript != maxScript { - // There is usually very little comprehension between different scripts. - // In a few cases there may still be Low comprehension. This possibility is - // pre-computed and stored in have.altScript. - if Low < m.conf || have.altScript != maxScript { - return - } - c = Low - } else if have.maxRegion != maxRegion { - // There is usually a small difference between languages across regions. - // We use the region distance (below) to disambiguate between equal matches. - if High < c { - c = High - } - } - - // We store the results of the computations of the tie-breaker rules along - // with the best match. There is no need to do the checks once we determine - // we have a winner, but we do still need to do the tie-breaker computations. - // We use "beaten" to keep track if we still need to do the checks. - beaten := false // true if the new pair defeats the current one. - if c != m.conf { - if c < m.conf { - return - } - beaten = true - } - - // Tie-breaker rules: - // We prefer if the pre-maximized language was specified and identical. - origLang := have.tag.lang == tag.lang && tag.lang != 0 - if !beaten && m.origLang != origLang { - if m.origLang { - return - } - beaten = true - } - - regGroupDist := regionGroupDist(have.maxRegion, maxRegion, maxScript, tag.lang) - if !beaten && m.regGroupDist != regGroupDist { - if regGroupDist > m.regGroupDist { - return - } - beaten = true - } - - // We prefer if the pre-maximized region was specified and identical. - origReg := have.tag.region == tag.region && tag.region != 0 - if !beaten && m.origReg != origReg { - if m.origReg { - return - } - beaten = true - } - - // TODO: remove the region distance rule. Region distance has been replaced - // by the region grouping rule. For now we leave it as it still seems to - // have a net positive effect when applied after the grouping rule. - // Possible solutions: - // - apply the primary locale rule first to effectively disable region - // region distance if groups are defined. - // - express the following errors in terms of grouping (if possible) - // - find another method of handling the following cases. - // maximization of legacy: find mo in - // "sr-Cyrl, sr-Latn, ro, ro-MD": have ro; want ro-MD (High) - // region distance French: find fr-US in - // "en, fr, fr-CA, fr-CH": have fr; want fr-CA (High) - - // Next we prefer smaller distances between regions, as defined by - // regionDist. - regDist := uint8(regionDistance(have.maxRegion, maxRegion)) - if !beaten && m.regDist != regDist { - if regDist > m.regDist { - return - } - beaten = true - } - - // Next we prefer if the pre-maximized script was specified and identical. - origScript := have.tag.script == tag.script && tag.script != 0 - if !beaten && m.origScript != origScript { - if m.origScript { - return - } - beaten = true - } - - // Finally we prefer tags which have a closer parent relationship. - // TODO: the parent relationship no longer seems necessary. It doesn't hurt - // to leave it in as the final tie-breaker, though, especially until the - // grouping data has further matured. - parentDist := parentDistance(have.tag.region, tag) - if !beaten && m.parentDist != parentDist { - if parentDist > m.parentDist { - return - } - beaten = true - } - - // Update m to the newly found best match. - if beaten { - m.have = have - m.want = tag - m.conf = c - m.origLang = origLang - m.origReg = origReg - m.origScript = origScript - m.regGroupDist = regGroupDist - m.regDist = regDist - m.parentDist = parentDist - } -} - -// parentDistance returns the number of times Parent must be called before the -// regions match. It is assumed that it has already been checked that lang and -// script are identical. If haveRegion does not occur in the ancestor chain of -// tag, it returns 255. -func parentDistance(haveRegion regionID, tag Tag) uint8 { - p := tag.Parent() - d := uint8(1) - for haveRegion != p.region { - if p.region == 0 { - return 255 - } - p = p.Parent() - d++ - } - return d -} - -// regionGroupDist computes the distance between two regions based on their -// CLDR grouping. -func regionGroupDist(a, b regionID, script scriptID, lang langID) uint8 { - aGroup := uint(regionToGroups[a]) << 1 - bGroup := uint(regionToGroups[b]) << 1 - for _, ri := range matchRegion { - if langID(ri.lang) == lang && (ri.script == 0 || scriptID(ri.script) == script) { - group := uint(1 << (ri.group &^ 0x80)) - if 0x80&ri.group == 0 { - if aGroup&bGroup&group != 0 { // Both regions are in the group. - return ri.distance - } - } else { - if (aGroup|bGroup)&group == 0 { // Both regions are not in the group. - return ri.distance - } - } - } - } - const defaultDistance = 4 - return defaultDistance -} - -// regionDistance computes the distance between two regions based on the -// distance in the graph of region containments as defined in CLDR. It iterates -// over increasingly inclusive sets of groups, represented as bit vectors, until -// the source bit vector has bits in common with the destination vector. -func regionDistance(a, b regionID) int { - if a == b { - return 0 - } - p, q := regionInclusion[a], regionInclusion[b] - if p < nRegionGroups { - p, q = q, p - } - set := regionInclusionBits - if q < nRegionGroups && set[p]&(1<<q) != 0 { - return 1 - } - d := 2 - for goal := set[q]; set[p]&goal == 0; p = regionInclusionNext[p] { - d++ - } - return d -} - -func (t Tag) variants() string { - if t.pVariant == 0 { - return "" - } - return t.str[t.pVariant:t.pExt] -} - -// variantOrPrivateTagStr returns variants or private use tags. -func (t Tag) variantOrPrivateTagStr() string { - if t.pExt > 0 { - return t.str[t.pVariant:t.pExt] - } - return t.str[t.pVariant:] -} - -// equalsRest compares everything except the language. -func (a Tag) equalsRest(b Tag) bool { - // TODO: don't include extensions in this comparison. To do this efficiently, - // though, we should handle private tags separately. - return a.script == b.script && a.region == b.region && a.variantOrPrivateTagStr() == b.variantOrPrivateTagStr() -} - -// isExactEquivalent returns true if canonicalizing the language will not alter -// the script or region of a tag. -func isExactEquivalent(l langID) bool { - for _, o := range notEquivalent { - if o == l { - return false - } - } - return true -} - -var notEquivalent []langID - -func init() { - // Create a list of all languages for which canonicalization may alter the - // script or region. - for _, lm := range langAliasMap { - tag := Tag{lang: langID(lm.from)} - if tag, _ = tag.canonicalize(All); tag.script != 0 || tag.region != 0 { - notEquivalent = append(notEquivalent, langID(lm.from)) - } - } -} diff --git a/vendor/golang.org/x/text/language/parse.go b/vendor/golang.org/x/text/language/parse.go deleted file mode 100644 index cfa28f56..00000000 --- a/vendor/golang.org/x/text/language/parse.go +++ /dev/null @@ -1,859 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -import ( - "bytes" - "errors" - "fmt" - "sort" - "strconv" - "strings" - - "golang.org/x/text/internal/tag" -) - -// isAlpha returns true if the byte is not a digit. -// b must be an ASCII letter or digit. -func isAlpha(b byte) bool { - return b > '9' -} - -// isAlphaNum returns true if the string contains only ASCII letters or digits. -func isAlphaNum(s []byte) bool { - for _, c := range s { - if !('a' <= c && c <= 'z' || 'A' <= c && c <= 'Z' || '0' <= c && c <= '9') { - return false - } - } - return true -} - -// errSyntax is returned by any of the parsing functions when the -// input is not well-formed, according to BCP 47. -// TODO: return the position at which the syntax error occurred? -var errSyntax = errors.New("language: tag is not well-formed") - -// ValueError is returned by any of the parsing functions when the -// input is well-formed but the respective subtag is not recognized -// as a valid value. -type ValueError struct { - v [8]byte -} - -func mkErrInvalid(s []byte) error { - var e ValueError - copy(e.v[:], s) - return e -} - -func (e ValueError) tag() []byte { - n := bytes.IndexByte(e.v[:], 0) - if n == -1 { - n = 8 - } - return e.v[:n] -} - -// Error implements the error interface. -func (e ValueError) Error() string { - return fmt.Sprintf("language: subtag %q is well-formed but unknown", e.tag()) -} - -// Subtag returns the subtag for which the error occurred. -func (e ValueError) Subtag() string { - return string(e.tag()) -} - -// scanner is used to scan BCP 47 tokens, which are separated by _ or -. -type scanner struct { - b []byte - bytes [max99thPercentileSize]byte - token []byte - start int // start position of the current token - end int // end position of the current token - next int // next point for scan - err error - done bool -} - -func makeScannerString(s string) scanner { - scan := scanner{} - if len(s) <= len(scan.bytes) { - scan.b = scan.bytes[:copy(scan.bytes[:], s)] - } else { - scan.b = []byte(s) - } - scan.init() - return scan -} - -// makeScanner returns a scanner using b as the input buffer. -// b is not copied and may be modified by the scanner routines. -func makeScanner(b []byte) scanner { - scan := scanner{b: b} - scan.init() - return scan -} - -func (s *scanner) init() { - for i, c := range s.b { - if c == '_' { - s.b[i] = '-' - } - } - s.scan() -} - -// restToLower converts the string between start and end to lower case. -func (s *scanner) toLower(start, end int) { - for i := start; i < end; i++ { - c := s.b[i] - if 'A' <= c && c <= 'Z' { - s.b[i] += 'a' - 'A' - } - } -} - -func (s *scanner) setError(e error) { - if s.err == nil || (e == errSyntax && s.err != errSyntax) { - s.err = e - } -} - -// resizeRange shrinks or grows the array at position oldStart such that -// a new string of size newSize can fit between oldStart and oldEnd. -// Sets the scan point to after the resized range. -func (s *scanner) resizeRange(oldStart, oldEnd, newSize int) { - s.start = oldStart - if end := oldStart + newSize; end != oldEnd { - diff := end - oldEnd - if end < cap(s.b) { - b := make([]byte, len(s.b)+diff) - copy(b, s.b[:oldStart]) - copy(b[end:], s.b[oldEnd:]) - s.b = b - } else { - s.b = append(s.b[end:], s.b[oldEnd:]...) - } - s.next = end + (s.next - s.end) - s.end = end - } -} - -// replace replaces the current token with repl. -func (s *scanner) replace(repl string) { - s.resizeRange(s.start, s.end, len(repl)) - copy(s.b[s.start:], repl) -} - -// gobble removes the current token from the input. -// Caller must call scan after calling gobble. -func (s *scanner) gobble(e error) { - s.setError(e) - if s.start == 0 { - s.b = s.b[:+copy(s.b, s.b[s.next:])] - s.end = 0 - } else { - s.b = s.b[:s.start-1+copy(s.b[s.start-1:], s.b[s.end:])] - s.end = s.start - 1 - } - s.next = s.start -} - -// deleteRange removes the given range from s.b before the current token. -func (s *scanner) deleteRange(start, end int) { - s.setError(errSyntax) - s.b = s.b[:start+copy(s.b[start:], s.b[end:])] - diff := end - start - s.next -= diff - s.start -= diff - s.end -= diff -} - -// scan parses the next token of a BCP 47 string. Tokens that are larger -// than 8 characters or include non-alphanumeric characters result in an error -// and are gobbled and removed from the output. -// It returns the end position of the last token consumed. -func (s *scanner) scan() (end int) { - end = s.end - s.token = nil - for s.start = s.next; s.next < len(s.b); { - i := bytes.IndexByte(s.b[s.next:], '-') - if i == -1 { - s.end = len(s.b) - s.next = len(s.b) - i = s.end - s.start - } else { - s.end = s.next + i - s.next = s.end + 1 - } - token := s.b[s.start:s.end] - if i < 1 || i > 8 || !isAlphaNum(token) { - s.gobble(errSyntax) - continue - } - s.token = token - return end - } - if n := len(s.b); n > 0 && s.b[n-1] == '-' { - s.setError(errSyntax) - s.b = s.b[:len(s.b)-1] - } - s.done = true - return end -} - -// acceptMinSize parses multiple tokens of the given size or greater. -// It returns the end position of the last token consumed. -func (s *scanner) acceptMinSize(min int) (end int) { - end = s.end - s.scan() - for ; len(s.token) >= min; s.scan() { - end = s.end - } - return end -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the default canonicalization type. -func Parse(s string) (t Tag, err error) { - return Default.Parse(s) -} - -// Parse parses the given BCP 47 string and returns a valid Tag. If parsing -// failed it returns an error and any part of the tag that could be parsed. -// If parsing succeeded but an unknown value was found, it returns -// ValueError. The Tag returned in this case is just stripped of the unknown -// value. All other values are preserved. It accepts tags in the BCP 47 format -// and extensions to this standard defined in -// http://www.unicode.org/reports/tr35/#Unicode_Language_and_Locale_Identifiers. -// The resulting tag is canonicalized using the the canonicalization type c. -func (c CanonType) Parse(s string) (t Tag, err error) { - // TODO: consider supporting old-style locale key-value pairs. - if s == "" { - return und, errSyntax - } - if len(s) <= maxAltTaglen { - b := [maxAltTaglen]byte{} - for i, c := range s { - // Generating invalid UTF-8 is okay as it won't match. - if 'A' <= c && c <= 'Z' { - c += 'a' - 'A' - } else if c == '_' { - c = '-' - } - b[i] = byte(c) - } - if t, ok := grandfathered(b); ok { - return t, nil - } - } - scan := makeScannerString(s) - t, err = parse(&scan, s) - t, changed := t.canonicalize(c) - if changed { - t.remakeString() - } - return t, err -} - -func parse(scan *scanner, s string) (t Tag, err error) { - t = und - var end int - if n := len(scan.token); n <= 1 { - scan.toLower(0, len(scan.b)) - if n == 0 || scan.token[0] != 'x' { - return t, errSyntax - } - end = parseExtensions(scan) - } else if n >= 4 { - return und, errSyntax - } else { // the usual case - t, end = parseTag(scan) - if n := len(scan.token); n == 1 { - t.pExt = uint16(end) - end = parseExtensions(scan) - } else if end < len(scan.b) { - scan.setError(errSyntax) - scan.b = scan.b[:end] - } - } - if int(t.pVariant) < len(scan.b) { - if end < len(s) { - s = s[:end] - } - if len(s) > 0 && tag.Compare(s, scan.b) == 0 { - t.str = s - } else { - t.str = string(scan.b) - } - } else { - t.pVariant, t.pExt = 0, 0 - } - return t, scan.err -} - -// parseTag parses language, script, region and variants. -// It returns a Tag and the end position in the input that was parsed. -func parseTag(scan *scanner) (t Tag, end int) { - var e error - // TODO: set an error if an unknown lang, script or region is encountered. - t.lang, e = getLangID(scan.token) - scan.setError(e) - scan.replace(t.lang.String()) - langStart := scan.start - end = scan.scan() - for len(scan.token) == 3 && isAlpha(scan.token[0]) { - // From http://tools.ietf.org/html/bcp47, <lang>-<extlang> tags are equivalent - // to a tag of the form <extlang>. - lang, e := getLangID(scan.token) - if lang != 0 { - t.lang = lang - copy(scan.b[langStart:], lang.String()) - scan.b[langStart+3] = '-' - scan.start = langStart + 4 - } - scan.gobble(e) - end = scan.scan() - } - if len(scan.token) == 4 && isAlpha(scan.token[0]) { - t.script, e = getScriptID(script, scan.token) - if t.script == 0 { - scan.gobble(e) - } - end = scan.scan() - } - if n := len(scan.token); n >= 2 && n <= 3 { - t.region, e = getRegionID(scan.token) - if t.region == 0 { - scan.gobble(e) - } else { - scan.replace(t.region.String()) - } - end = scan.scan() - } - scan.toLower(scan.start, len(scan.b)) - t.pVariant = byte(end) - end = parseVariants(scan, end, t) - t.pExt = uint16(end) - return t, end -} - -var separator = []byte{'-'} - -// parseVariants scans tokens as long as each token is a valid variant string. -// Duplicate variants are removed. -func parseVariants(scan *scanner, end int, t Tag) int { - start := scan.start - varIDBuf := [4]uint8{} - variantBuf := [4][]byte{} - varID := varIDBuf[:0] - variant := variantBuf[:0] - last := -1 - needSort := false - for ; len(scan.token) >= 4; scan.scan() { - // TODO: measure the impact of needing this conversion and redesign - // the data structure if there is an issue. - v, ok := variantIndex[string(scan.token)] - if !ok { - // unknown variant - // TODO: allow user-defined variants? - scan.gobble(mkErrInvalid(scan.token)) - continue - } - varID = append(varID, v) - variant = append(variant, scan.token) - if !needSort { - if last < int(v) { - last = int(v) - } else { - needSort = true - // There is no legal combinations of more than 7 variants - // (and this is by no means a useful sequence). - const maxVariants = 8 - if len(varID) > maxVariants { - break - } - } - } - end = scan.end - } - if needSort { - sort.Sort(variantsSort{varID, variant}) - k, l := 0, -1 - for i, v := range varID { - w := int(v) - if l == w { - // Remove duplicates. - continue - } - varID[k] = varID[i] - variant[k] = variant[i] - k++ - l = w - } - if str := bytes.Join(variant[:k], separator); len(str) == 0 { - end = start - 1 - } else { - scan.resizeRange(start, end, len(str)) - copy(scan.b[scan.start:], str) - end = scan.end - } - } - return end -} - -type variantsSort struct { - i []uint8 - v [][]byte -} - -func (s variantsSort) Len() int { - return len(s.i) -} - -func (s variantsSort) Swap(i, j int) { - s.i[i], s.i[j] = s.i[j], s.i[i] - s.v[i], s.v[j] = s.v[j], s.v[i] -} - -func (s variantsSort) Less(i, j int) bool { - return s.i[i] < s.i[j] -} - -type bytesSort [][]byte - -func (b bytesSort) Len() int { - return len(b) -} - -func (b bytesSort) Swap(i, j int) { - b[i], b[j] = b[j], b[i] -} - -func (b bytesSort) Less(i, j int) bool { - return bytes.Compare(b[i], b[j]) == -1 -} - -// parseExtensions parses and normalizes the extensions in the buffer. -// It returns the last position of scan.b that is part of any extension. -// It also trims scan.b to remove excess parts accordingly. -func parseExtensions(scan *scanner) int { - start := scan.start - exts := [][]byte{} - private := []byte{} - end := scan.end - for len(scan.token) == 1 { - extStart := scan.start - ext := scan.token[0] - end = parseExtension(scan) - extension := scan.b[extStart:end] - if len(extension) < 3 || (ext != 'x' && len(extension) < 4) { - scan.setError(errSyntax) - end = extStart - continue - } else if start == extStart && (ext == 'x' || scan.start == len(scan.b)) { - scan.b = scan.b[:end] - return end - } else if ext == 'x' { - private = extension - break - } - exts = append(exts, extension) - } - sort.Sort(bytesSort(exts)) - if len(private) > 0 { - exts = append(exts, private) - } - scan.b = scan.b[:start] - if len(exts) > 0 { - scan.b = append(scan.b, bytes.Join(exts, separator)...) - } else if start > 0 { - // Strip trailing '-'. - scan.b = scan.b[:start-1] - } - return end -} - -// parseExtension parses a single extension and returns the position of -// the extension end. -func parseExtension(scan *scanner) int { - start, end := scan.start, scan.end - switch scan.token[0] { - case 'u': - attrStart := end - scan.scan() - for last := []byte{}; len(scan.token) > 2; scan.scan() { - if bytes.Compare(scan.token, last) != -1 { - // Attributes are unsorted. Start over from scratch. - p := attrStart + 1 - scan.next = p - attrs := [][]byte{} - for scan.scan(); len(scan.token) > 2; scan.scan() { - attrs = append(attrs, scan.token) - end = scan.end - } - sort.Sort(bytesSort(attrs)) - copy(scan.b[p:], bytes.Join(attrs, separator)) - break - } - last = scan.token - end = scan.end - } - var last, key []byte - for attrEnd := end; len(scan.token) == 2; last = key { - key = scan.token - keyEnd := scan.end - end = scan.acceptMinSize(3) - // TODO: check key value validity - if keyEnd == end || bytes.Compare(key, last) != 1 { - // We have an invalid key or the keys are not sorted. - // Start scanning keys from scratch and reorder. - p := attrEnd + 1 - scan.next = p - keys := [][]byte{} - for scan.scan(); len(scan.token) == 2; { - keyStart, keyEnd := scan.start, scan.end - end = scan.acceptMinSize(3) - if keyEnd != end { - keys = append(keys, scan.b[keyStart:end]) - } else { - scan.setError(errSyntax) - end = keyStart - } - } - sort.Sort(bytesSort(keys)) - reordered := bytes.Join(keys, separator) - if e := p + len(reordered); e < end { - scan.deleteRange(e, end) - end = e - } - copy(scan.b[p:], bytes.Join(keys, separator)) - break - } - } - case 't': - scan.scan() - if n := len(scan.token); n >= 2 && n <= 3 && isAlpha(scan.token[1]) { - _, end = parseTag(scan) - scan.toLower(start, end) - } - for len(scan.token) == 2 && !isAlpha(scan.token[1]) { - end = scan.acceptMinSize(3) - } - case 'x': - end = scan.acceptMinSize(1) - default: - end = scan.acceptMinSize(2) - } - return end -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using the Default CanonType. If one or more errors are -// encountered, one of the errors is returned. -func Compose(part ...interface{}) (t Tag, err error) { - return Default.Compose(part...) -} - -// Compose creates a Tag from individual parts, which may be of type Tag, Base, -// Script, Region, Variant, []Variant, Extension, []Extension or error. If a -// Base, Script or Region or slice of type Variant or Extension is passed more -// than once, the latter will overwrite the former. Variants and Extensions are -// accumulated, but if two extensions of the same type are passed, the latter -// will replace the former. A Tag overwrites all former values and typically -// only makes sense as the first argument. The resulting tag is returned after -// canonicalizing using CanonType c. If one or more errors are encountered, -// one of the errors is returned. -func (c CanonType) Compose(part ...interface{}) (t Tag, err error) { - var b builder - if err = b.update(part...); err != nil { - return und, err - } - t, _ = b.tag.canonicalize(c) - - if len(b.ext) > 0 || len(b.variant) > 0 { - sort.Sort(sortVariant(b.variant)) - sort.Strings(b.ext) - if b.private != "" { - b.ext = append(b.ext, b.private) - } - n := maxCoreSize + tokenLen(b.variant...) + tokenLen(b.ext...) - buf := make([]byte, n) - p := t.genCoreBytes(buf) - t.pVariant = byte(p) - p += appendTokens(buf[p:], b.variant...) - t.pExt = uint16(p) - p += appendTokens(buf[p:], b.ext...) - t.str = string(buf[:p]) - } else if b.private != "" { - t.str = b.private - t.remakeString() - } - return -} - -type builder struct { - tag Tag - - private string // the x extension - ext []string - variant []string - - err error -} - -func (b *builder) addExt(e string) { - if e == "" { - } else if e[0] == 'x' { - b.private = e - } else { - b.ext = append(b.ext, e) - } -} - -var errInvalidArgument = errors.New("invalid Extension or Variant") - -func (b *builder) update(part ...interface{}) (err error) { - replace := func(l *[]string, s string, eq func(a, b string) bool) bool { - if s == "" { - b.err = errInvalidArgument - return true - } - for i, v := range *l { - if eq(v, s) { - (*l)[i] = s - return true - } - } - return false - } - for _, x := range part { - switch v := x.(type) { - case Tag: - b.tag.lang = v.lang - b.tag.region = v.region - b.tag.script = v.script - if v.str != "" { - b.variant = nil - for x, s := "", v.str[v.pVariant:v.pExt]; s != ""; { - x, s = nextToken(s) - b.variant = append(b.variant, x) - } - b.ext, b.private = nil, "" - for i, e := int(v.pExt), ""; i < len(v.str); { - i, e = getExtension(v.str, i) - b.addExt(e) - } - } - case Base: - b.tag.lang = v.langID - case Script: - b.tag.script = v.scriptID - case Region: - b.tag.region = v.regionID - case Variant: - if !replace(&b.variant, v.variant, func(a, b string) bool { return a == b }) { - b.variant = append(b.variant, v.variant) - } - case Extension: - if !replace(&b.ext, v.s, func(a, b string) bool { return a[0] == b[0] }) { - b.addExt(v.s) - } - case []Variant: - b.variant = nil - for _, x := range v { - b.update(x) - } - case []Extension: - b.ext, b.private = nil, "" - for _, e := range v { - b.update(e) - } - // TODO: support parsing of raw strings based on morphology or just extensions? - case error: - err = v - } - } - return -} - -func tokenLen(token ...string) (n int) { - for _, t := range token { - n += len(t) + 1 - } - return -} - -func appendTokens(b []byte, token ...string) int { - p := 0 - for _, t := range token { - b[p] = '-' - copy(b[p+1:], t) - p += 1 + len(t) - } - return p -} - -type sortVariant []string - -func (s sortVariant) Len() int { - return len(s) -} - -func (s sortVariant) Swap(i, j int) { - s[j], s[i] = s[i], s[j] -} - -func (s sortVariant) Less(i, j int) bool { - return variantIndex[s[i]] < variantIndex[s[j]] -} - -func findExt(list []string, x byte) int { - for i, e := range list { - if e[0] == x { - return i - } - } - return -1 -} - -// getExtension returns the name, body and end position of the extension. -func getExtension(s string, p int) (end int, ext string) { - if s[p] == '-' { - p++ - } - if s[p] == 'x' { - return len(s), s[p:] - } - end = nextExtension(s, p) - return end, s[p:end] -} - -// nextExtension finds the next extension within the string, searching -// for the -<char>- pattern from position p. -// In the fast majority of cases, language tags will have at most -// one extension and extensions tend to be small. -func nextExtension(s string, p int) int { - for n := len(s) - 3; p < n; { - if s[p] == '-' { - if s[p+2] == '-' { - return p - } - p += 3 - } else { - p++ - } - } - return len(s) -} - -var errInvalidWeight = errors.New("ParseAcceptLanguage: invalid weight") - -// ParseAcceptLanguage parses the contents of a Accept-Language header as -// defined in http://www.ietf.org/rfc/rfc2616.txt and returns a list of Tags and -// a list of corresponding quality weights. It is more permissive than RFC 2616 -// and may return non-nil slices even if the input is not valid. -// The Tags will be sorted by highest weight first and then by first occurrence. -// Tags with a weight of zero will be dropped. An error will be returned if the -// input could not be parsed. -func ParseAcceptLanguage(s string) (tag []Tag, q []float32, err error) { - var entry string - for s != "" { - if entry, s = split(s, ','); entry == "" { - continue - } - - entry, weight := split(entry, ';') - - // Scan the language. - t, err := Parse(entry) - if err != nil { - id, ok := acceptFallback[entry] - if !ok { - return nil, nil, err - } - t = Tag{lang: id} - } - - // Scan the optional weight. - w := 1.0 - if weight != "" { - weight = consume(weight, 'q') - weight = consume(weight, '=') - // consume returns the empty string when a token could not be - // consumed, resulting in an error for ParseFloat. - if w, err = strconv.ParseFloat(weight, 32); err != nil { - return nil, nil, errInvalidWeight - } - // Drop tags with a quality weight of 0. - if w <= 0 { - continue - } - } - - tag = append(tag, t) - q = append(q, float32(w)) - } - sortStable(&tagSort{tag, q}) - return tag, q, nil -} - -// consume removes a leading token c from s and returns the result or the empty -// string if there is no such token. -func consume(s string, c byte) string { - if s == "" || s[0] != c { - return "" - } - return strings.TrimSpace(s[1:]) -} - -func split(s string, c byte) (head, tail string) { - if i := strings.IndexByte(s, c); i >= 0 { - return strings.TrimSpace(s[:i]), strings.TrimSpace(s[i+1:]) - } - return strings.TrimSpace(s), "" -} - -// Add hack mapping to deal with a small number of cases that that occur -// in Accept-Language (with reasonable frequency). -var acceptFallback = map[string]langID{ - "english": _en, - "deutsch": _de, - "italian": _it, - "french": _fr, - "*": _mul, // defined in the spec to match all languages. -} - -type tagSort struct { - tag []Tag - q []float32 -} - -func (s *tagSort) Len() int { - return len(s.q) -} - -func (s *tagSort) Less(i, j int) bool { - return s.q[i] > s.q[j] -} - -func (s *tagSort) Swap(i, j int) { - s.tag[i], s.tag[j] = s.tag[j], s.tag[i] - s.q[i], s.q[j] = s.q[j], s.q[i] -} diff --git a/vendor/golang.org/x/text/language/tables.go b/vendor/golang.org/x/text/language/tables.go deleted file mode 100644 index a108554a..00000000 --- a/vendor/golang.org/x/text/language/tables.go +++ /dev/null @@ -1,3654 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package language - -import "golang.org/x/text/internal/tag" - -// CLDRVersion is the CLDR version from which the tables in this package are derived. -const CLDRVersion = "31" - -const numLanguages = 8654 - -const numScripts = 230 - -const numRegions = 356 - -type fromTo struct { - from uint16 - to uint16 -} - -const nonCanonicalUnd = 1199 -const ( - _af = 22 - _am = 39 - _ar = 58 - _az = 88 - _bg = 126 - _bn = 165 - _ca = 215 - _cs = 249 - _da = 256 - _de = 268 - _el = 309 - _en = 312 - _es = 317 - _et = 319 - _fa = 327 - _fi = 336 - _fil = 338 - _fr = 349 - _gu = 418 - _he = 442 - _hi = 444 - _hr = 463 - _hu = 467 - _hy = 469 - _id = 479 - _is = 502 - _it = 503 - _ja = 510 - _ka = 526 - _kk = 576 - _km = 584 - _kn = 591 - _ko = 594 - _ky = 648 - _lo = 694 - _lt = 702 - _lv = 709 - _mk = 765 - _ml = 770 - _mn = 777 - _mo = 782 - _mr = 793 - _ms = 797 - _mul = 804 - _my = 815 - _nb = 837 - _ne = 847 - _nl = 869 - _no = 877 - _pa = 923 - _pl = 945 - _pt = 958 - _ro = 986 - _ru = 992 - _sh = 1029 - _si = 1034 - _sk = 1040 - _sl = 1044 - _sq = 1071 - _sr = 1072 - _sv = 1090 - _sw = 1091 - _ta = 1102 - _te = 1119 - _th = 1129 - _tl = 1144 - _tn = 1150 - _tr = 1160 - _uk = 1196 - _ur = 1202 - _uz = 1210 - _vi = 1217 - _zh = 1319 - _zu = 1324 - _jbo = 513 - _ami = 1647 - _bnn = 2354 - _hak = 436 - _tlh = 14464 - _lb = 659 - _nv = 897 - _pwn = 12052 - _tao = 14185 - _tay = 14195 - _tsu = 14659 - _nn = 872 - _sfb = 13626 - _vgt = 15698 - _sgg = 13657 - _cmn = 3004 - _nan = 833 - _hsn = 465 -) - -const langPrivateStart = 0x2f6f - -const langPrivateEnd = 0x3176 - -// lang holds an alphabetically sorted list of ISO-639 language identifiers. -// All entries are 4 bytes. The index of the identifier (divided by 4) is the language tag. -// For 2-byte language identifiers, the two successive bytes have the following meaning: -// - if the first letter of the 2- and 3-letter ISO codes are the same: -// the second and third letter of the 3-letter ISO code. -// - otherwise: a 0 and a by 2 bits right-shifted index into altLangISO3. -// For 3-byte language identifiers the 4th byte is 0. -const lang tag.Index = "" + // Size: 5312 bytes - "---\x00aaaraai\x00aak\x00aau\x00abbkabi\x00abq\x00abr\x00abt\x00aby\x00a" + - "cd\x00ace\x00ach\x00ada\x00ade\x00adj\x00ady\x00adz\x00aeveaeb\x00aey" + - "\x00affragc\x00agd\x00agg\x00agm\x00ago\x00agq\x00aha\x00ahl\x00aho\x00a" + - "jg\x00akkaakk\x00ala\x00ali\x00aln\x00alt\x00ammhamm\x00amn\x00amo\x00am" + - "p\x00anrganc\x00ank\x00ann\x00any\x00aoj\x00aom\x00aoz\x00apc\x00apd\x00" + - "ape\x00apr\x00aps\x00apz\x00arraarc\x00arh\x00arn\x00aro\x00arq\x00ars" + - "\x00ary\x00arz\x00assmasa\x00ase\x00asg\x00aso\x00ast\x00ata\x00atg\x00a" + - "tj\x00auy\x00avvaavl\x00avn\x00avt\x00avu\x00awa\x00awb\x00awo\x00awx" + - "\x00ayymayb\x00azzebaakbal\x00ban\x00bap\x00bar\x00bas\x00bav\x00bax\x00" + - "bba\x00bbb\x00bbc\x00bbd\x00bbj\x00bbp\x00bbr\x00bcf\x00bch\x00bci\x00bc" + - "m\x00bcn\x00bco\x00bcq\x00bcu\x00bdd\x00beelbef\x00beh\x00bej\x00bem\x00" + - "bet\x00bew\x00bex\x00bez\x00bfd\x00bfq\x00bft\x00bfy\x00bgulbgc\x00bgn" + - "\x00bgx\x00bhihbhb\x00bhg\x00bhi\x00bhk\x00bhl\x00bho\x00bhy\x00biisbib" + - "\x00big\x00bik\x00bim\x00bin\x00bio\x00biq\x00bjh\x00bji\x00bjj\x00bjn" + - "\x00bjo\x00bjr\x00bjt\x00bjz\x00bkc\x00bkm\x00bkq\x00bku\x00bkv\x00blt" + - "\x00bmambmh\x00bmk\x00bmq\x00bmu\x00bnenbng\x00bnm\x00bnp\x00boodboj\x00" + - "bom\x00bon\x00bpy\x00bqc\x00bqi\x00bqp\x00bqv\x00brrebra\x00brh\x00brx" + - "\x00brz\x00bsosbsj\x00bsq\x00bss\x00bst\x00bto\x00btt\x00btv\x00bua\x00b" + - "uc\x00bud\x00bug\x00buk\x00bum\x00buo\x00bus\x00buu\x00bvb\x00bwd\x00bwr" + - "\x00bxh\x00bye\x00byn\x00byr\x00bys\x00byv\x00byx\x00bza\x00bze\x00bzf" + - "\x00bzh\x00bzw\x00caatcan\x00cbj\x00cch\x00ccp\x00ceheceb\x00cfa\x00cgg" + - "\x00chhachk\x00chm\x00cho\x00chp\x00chr\x00cja\x00cjm\x00cjv\x00ckb\x00c" + - "kl\x00cko\x00cky\x00cla\x00cme\x00cooscop\x00cps\x00crrecrh\x00crj\x00cr" + - "k\x00crl\x00crm\x00crs\x00csescsb\x00csw\x00ctd\x00cuhucvhvcyymdaandad" + - "\x00daf\x00dag\x00dah\x00dak\x00dar\x00dav\x00dbd\x00dbq\x00dcc\x00ddn" + - "\x00deeuded\x00den\x00dga\x00dgh\x00dgi\x00dgl\x00dgr\x00dgz\x00dia\x00d" + - "je\x00dnj\x00dob\x00doi\x00dop\x00dow\x00dri\x00drs\x00dsb\x00dtm\x00dtp" + - "\x00dts\x00dty\x00dua\x00duc\x00dud\x00dug\x00dvivdva\x00dww\x00dyo\x00d" + - "yu\x00dzzodzg\x00ebu\x00eeweefi\x00egl\x00egy\x00eka\x00eky\x00elllema" + - "\x00emi\x00enngenn\x00enq\x00eopoeri\x00es\x00\x05esu\x00etstetr\x00ett" + - "\x00etu\x00etx\x00euusewo\x00ext\x00faasfaa\x00fab\x00fag\x00fai\x00fan" + - "\x00ffulffi\x00ffm\x00fiinfia\x00fil\x00fit\x00fjijflr\x00fmp\x00foaofod" + - "\x00fon\x00for\x00fpe\x00fqs\x00frrafrc\x00frp\x00frr\x00frs\x00fub\x00f" + - "ud\x00fue\x00fuf\x00fuh\x00fuq\x00fur\x00fuv\x00fuy\x00fvr\x00fyrygalega" + - "a\x00gaf\x00gag\x00gah\x00gaj\x00gam\x00gan\x00gaw\x00gay\x00gbf\x00gbm" + - "\x00gby\x00gbz\x00gcr\x00gdlagde\x00gdn\x00gdr\x00geb\x00gej\x00gel\x00g" + - "ez\x00gfk\x00ggn\x00ghs\x00gil\x00gim\x00gjk\x00gjn\x00gju\x00gkn\x00gkp" + - "\x00gllgglk\x00gmm\x00gmv\x00gnrngnd\x00gng\x00god\x00gof\x00goi\x00gom" + - "\x00gon\x00gor\x00gos\x00got\x00grb\x00grc\x00grt\x00grw\x00gsw\x00guujg" + - "ub\x00guc\x00gud\x00gur\x00guw\x00gux\x00guz\x00gvlvgvf\x00gvr\x00gvs" + - "\x00gwc\x00gwi\x00gwt\x00gyi\x00haauhag\x00hak\x00ham\x00haw\x00haz\x00h" + - "bb\x00hdy\x00heebhhy\x00hiinhia\x00hif\x00hig\x00hih\x00hil\x00hla\x00hl" + - "u\x00hmd\x00hmt\x00hnd\x00hne\x00hnj\x00hnn\x00hno\x00homohoc\x00hoj\x00" + - "hot\x00hrrvhsb\x00hsn\x00htathuunhui\x00hyyehzerianaian\x00iar\x00iba" + - "\x00ibb\x00iby\x00ica\x00ich\x00idndidd\x00idi\x00idu\x00ieleife\x00igbo" + - "igb\x00ige\x00iiiiijj\x00ikpkikk\x00ikt\x00ikw\x00ikx\x00ilo\x00imo\x00i" + - "nndinh\x00iodoiou\x00iri\x00isslittaiukuiw\x00\x03iwm\x00iws\x00izh\x00i" + - "zi\x00japnjab\x00jam\x00jbo\x00jbu\x00jen\x00jgk\x00jgo\x00ji\x00\x06jib" + - "\x00jmc\x00jml\x00jra\x00jut\x00jvavjwavkaatkaa\x00kab\x00kac\x00kad\x00" + - "kai\x00kaj\x00kam\x00kao\x00kbd\x00kbm\x00kbp\x00kbq\x00kbx\x00kby\x00kc" + - "g\x00kck\x00kcl\x00kct\x00kde\x00kdh\x00kdl\x00kdt\x00kea\x00ken\x00kez" + - "\x00kfo\x00kfr\x00kfy\x00kgonkge\x00kgf\x00kgp\x00kha\x00khb\x00khn\x00k" + - "hq\x00khs\x00kht\x00khw\x00khz\x00kiikkij\x00kiu\x00kiw\x00kjuakjd\x00kj" + - "g\x00kjs\x00kjy\x00kkazkkc\x00kkj\x00klalkln\x00klq\x00klt\x00klx\x00kmh" + - "mkmb\x00kmh\x00kmo\x00kms\x00kmu\x00kmw\x00knanknf\x00knp\x00koorkoi\x00" + - "kok\x00kol\x00kos\x00koz\x00kpe\x00kpf\x00kpo\x00kpr\x00kpx\x00kqb\x00kq" + - "f\x00kqs\x00kqy\x00kraukrc\x00kri\x00krj\x00krl\x00krs\x00kru\x00ksasksb" + - "\x00ksd\x00ksf\x00ksh\x00ksj\x00ksr\x00ktb\x00ktm\x00kto\x00kuurkub\x00k" + - "ud\x00kue\x00kuj\x00kum\x00kun\x00kup\x00kus\x00kvomkvg\x00kvr\x00kvx" + - "\x00kw\x00\x01kwj\x00kwo\x00kxa\x00kxc\x00kxm\x00kxp\x00kxw\x00kxz\x00ky" + - "irkye\x00kyx\x00kzr\x00laatlab\x00lad\x00lag\x00lah\x00laj\x00las\x00lbt" + - "zlbe\x00lbu\x00lbw\x00lcm\x00lcp\x00ldb\x00led\x00lee\x00lem\x00lep\x00l" + - "eq\x00leu\x00lez\x00lguglgg\x00liimlia\x00lid\x00lif\x00lig\x00lih\x00li" + - "j\x00lis\x00ljp\x00lki\x00lkt\x00lle\x00lln\x00lmn\x00lmo\x00lmp\x00lnin" + - "lns\x00lnu\x00loaoloj\x00lok\x00lol\x00lor\x00los\x00loz\x00lrc\x00ltitl" + - "tg\x00luublua\x00luo\x00luy\x00luz\x00lvavlwl\x00lzh\x00lzz\x00mad\x00ma" + - "f\x00mag\x00mai\x00mak\x00man\x00mas\x00maw\x00maz\x00mbh\x00mbo\x00mbq" + - "\x00mbu\x00mbw\x00mci\x00mcp\x00mcq\x00mcr\x00mcu\x00mda\x00mde\x00mdf" + - "\x00mdh\x00mdj\x00mdr\x00mdx\x00med\x00mee\x00mek\x00men\x00mer\x00met" + - "\x00meu\x00mfa\x00mfe\x00mfn\x00mfo\x00mfq\x00mglgmgh\x00mgl\x00mgo\x00m" + - "gp\x00mgy\x00mhahmhi\x00mhl\x00mirimif\x00min\x00mis\x00miw\x00mkkdmki" + - "\x00mkl\x00mkp\x00mkw\x00mlalmle\x00mlp\x00mls\x00mmo\x00mmu\x00mmx\x00m" + - "nonmna\x00mnf\x00mni\x00mnw\x00moolmoa\x00moe\x00moh\x00mos\x00mox\x00mp" + - "p\x00mps\x00mpt\x00mpx\x00mql\x00mrarmrd\x00mrj\x00mro\x00mssamtltmtc" + - "\x00mtf\x00mti\x00mtr\x00mua\x00mul\x00mur\x00mus\x00mva\x00mvn\x00mvy" + - "\x00mwk\x00mwr\x00mwv\x00mxc\x00mxm\x00myyamyk\x00mym\x00myv\x00myw\x00m" + - "yx\x00myz\x00mzk\x00mzm\x00mzn\x00mzp\x00mzw\x00mzz\x00naaunac\x00naf" + - "\x00nah\x00nak\x00nan\x00nap\x00naq\x00nas\x00nbobnca\x00nce\x00ncf\x00n" + - "ch\x00nco\x00ncu\x00nddendc\x00nds\x00neepneb\x00new\x00nex\x00nfr\x00ng" + - "donga\x00ngb\x00ngl\x00nhb\x00nhe\x00nhw\x00nif\x00nii\x00nij\x00nin\x00" + - "niu\x00niy\x00niz\x00njo\x00nkg\x00nko\x00nlldnmg\x00nmz\x00nnnonnf\x00n" + - "nh\x00nnk\x00nnm\x00noornod\x00noe\x00non\x00nop\x00nou\x00nqo\x00nrblnr" + - "b\x00nsk\x00nsn\x00nso\x00nss\x00ntm\x00ntr\x00nui\x00nup\x00nus\x00nuv" + - "\x00nux\x00nvavnwb\x00nxq\x00nxr\x00nyyanym\x00nyn\x00nzi\x00occiogc\x00" + - "ojjiokr\x00okv\x00omrmong\x00onn\x00ons\x00opm\x00orrioro\x00oru\x00osss" + - "osa\x00ota\x00otk\x00ozm\x00paanpag\x00pal\x00pam\x00pap\x00pau\x00pbi" + - "\x00pcd\x00pcm\x00pdc\x00pdt\x00ped\x00peo\x00pex\x00pfl\x00phl\x00phn" + - "\x00pilipil\x00pip\x00pka\x00pko\x00plolpla\x00pms\x00png\x00pnn\x00pnt" + - "\x00pon\x00ppo\x00pra\x00prd\x00prg\x00psuspss\x00ptorptp\x00puu\x00pwa" + - "\x00quuequc\x00qug\x00rai\x00raj\x00rao\x00rcf\x00rej\x00rel\x00res\x00r" + - "gn\x00rhg\x00ria\x00rif\x00rjs\x00rkt\x00rmohrmf\x00rmo\x00rmt\x00rmu" + - "\x00rnunrna\x00rng\x00roonrob\x00rof\x00roo\x00rro\x00rtm\x00ruusrue\x00" + - "rug\x00rw\x00\x04rwk\x00rwo\x00ryu\x00saansaf\x00sah\x00saq\x00sas\x00sa" + - "t\x00sav\x00saz\x00sba\x00sbe\x00sbp\x00scrdsck\x00scl\x00scn\x00sco\x00" + - "scs\x00sdndsdc\x00sdh\x00semesef\x00seh\x00sei\x00ses\x00sgagsga\x00sgs" + - "\x00sgw\x00sgz\x00sh\x00\x02shi\x00shk\x00shn\x00shu\x00siinsid\x00sig" + - "\x00sil\x00sim\x00sjr\x00sklkskc\x00skr\x00sks\x00sllvsld\x00sli\x00sll" + - "\x00sly\x00smmosma\x00smi\x00smj\x00smn\x00smp\x00smq\x00sms\x00snnasnc" + - "\x00snk\x00snp\x00snx\x00sny\x00soomsok\x00soq\x00sou\x00soy\x00spd\x00s" + - "pl\x00sps\x00sqqisrrpsrb\x00srn\x00srr\x00srx\x00ssswssd\x00ssg\x00ssy" + - "\x00stotstk\x00stq\x00suunsua\x00sue\x00suk\x00sur\x00sus\x00svweswwaswb" + - "\x00swc\x00swg\x00swp\x00swv\x00sxn\x00sxw\x00syl\x00syr\x00szl\x00taamt" + - "aj\x00tal\x00tan\x00taq\x00tbc\x00tbd\x00tbf\x00tbg\x00tbo\x00tbw\x00tbz" + - "\x00tci\x00tcy\x00tdd\x00tdg\x00tdh\x00teelted\x00tem\x00teo\x00tet\x00t" + - "fi\x00tggktgc\x00tgo\x00tgu\x00thhathl\x00thq\x00thr\x00tiirtif\x00tig" + - "\x00tik\x00tim\x00tio\x00tiv\x00tkuktkl\x00tkr\x00tkt\x00tlgltlf\x00tlx" + - "\x00tly\x00tmh\x00tmy\x00tnsntnh\x00toontof\x00tog\x00toq\x00tpi\x00tpm" + - "\x00tpz\x00tqo\x00trurtru\x00trv\x00trw\x00tssotsd\x00tsf\x00tsg\x00tsj" + - "\x00tsw\x00ttatttd\x00tte\x00ttj\x00ttr\x00tts\x00ttt\x00tuh\x00tul\x00t" + - "um\x00tuq\x00tvd\x00tvl\x00tvu\x00twwitwh\x00twq\x00txg\x00tyahtya\x00ty" + - "v\x00tzm\x00ubu\x00udm\x00ugiguga\x00ukkruli\x00umb\x00und\x00unr\x00unx" + - "\x00urrduri\x00urt\x00urw\x00usa\x00utr\x00uvh\x00uvl\x00uzzbvag\x00vai" + - "\x00van\x00veenvec\x00vep\x00viievic\x00viv\x00vls\x00vmf\x00vmw\x00vool" + - "vot\x00vro\x00vun\x00vut\x00walnwae\x00waj\x00wal\x00wan\x00war\x00wbp" + - "\x00wbq\x00wbr\x00wci\x00wer\x00wgi\x00whg\x00wib\x00wiu\x00wiv\x00wja" + - "\x00wji\x00wls\x00wmo\x00wnc\x00wni\x00wnu\x00woolwob\x00wos\x00wrs\x00w" + - "sk\x00wtm\x00wuu\x00wuv\x00wwa\x00xav\x00xbi\x00xcr\x00xes\x00xhhoxla" + - "\x00xlc\x00xld\x00xmf\x00xmn\x00xmr\x00xna\x00xnr\x00xog\x00xon\x00xpr" + - "\x00xrb\x00xsa\x00xsi\x00xsm\x00xsr\x00xwe\x00yam\x00yao\x00yap\x00yas" + - "\x00yat\x00yav\x00yay\x00yaz\x00yba\x00ybb\x00yby\x00yer\x00ygr\x00ygw" + - "\x00yiidyko\x00yle\x00ylg\x00yll\x00yml\x00yooryon\x00yrb\x00yre\x00yrl" + - "\x00yss\x00yua\x00yue\x00yuj\x00yut\x00yuw\x00zahazag\x00zbl\x00zdj\x00z" + - "ea\x00zgh\x00zhhozia\x00zlm\x00zmi\x00zne\x00zuulzxx\x00zza\x00\xff\xff" + - "\xff\xff" - -const langNoIndexOffset = 1327 - -// langNoIndex is a bit vector of all 3-letter language codes that are not used as an index -// in lookup tables. The language ids for these language codes are derived directly -// from the letters and are not consecutive. -// Size: 2197 bytes, 2197 elements -var langNoIndex = [2197]uint8{ - // Entry 0 - 3F - 0xff, 0xf8, 0xed, 0xfe, 0xeb, 0xd3, 0x3b, 0xd2, - 0xfb, 0xbf, 0x7a, 0xfa, 0x37, 0x1d, 0x3c, 0x57, - 0x6e, 0x97, 0x73, 0x38, 0xfb, 0xea, 0xbf, 0x70, - 0xad, 0x03, 0xff, 0xff, 0xcf, 0x05, 0x84, 0x62, - 0xe9, 0xbf, 0xfd, 0xbf, 0xbf, 0xf7, 0xfd, 0x77, - 0x0f, 0xff, 0xef, 0x6f, 0xff, 0xfb, 0xdf, 0xe2, - 0xc9, 0xf8, 0x7f, 0x7e, 0x4d, 0xb8, 0x0a, 0x6a, - 0x7c, 0xea, 0xe3, 0xfa, 0x7a, 0xbf, 0x67, 0xff, - // Entry 40 - 7F - 0xff, 0xff, 0xff, 0xdf, 0x2a, 0x54, 0x91, 0xc0, - 0x5d, 0xe3, 0x97, 0x14, 0x07, 0x20, 0xdd, 0xed, - 0x9f, 0x3f, 0xc9, 0x21, 0xf8, 0x3f, 0x94, 0x35, - 0x7c, 0x5f, 0xff, 0x5f, 0x8e, 0x6e, 0xdf, 0xff, - 0xff, 0xff, 0x55, 0x7c, 0xd3, 0xfd, 0xbf, 0xb5, - 0x7b, 0xdf, 0x7f, 0xf7, 0xca, 0xfe, 0xdb, 0xa3, - 0xa8, 0xff, 0x1f, 0x67, 0x7d, 0xeb, 0xef, 0xce, - 0xff, 0xff, 0x9f, 0xff, 0xb7, 0xef, 0xfe, 0xcf, - // Entry 80 - BF - 0xdb, 0xff, 0xf3, 0xcd, 0xfb, 0x2f, 0xff, 0xff, - 0xbb, 0xee, 0xf7, 0xbd, 0xdb, 0xff, 0x5f, 0xf7, - 0xfd, 0xf2, 0xfd, 0xff, 0x5e, 0x2f, 0x3b, 0xba, - 0x7e, 0xff, 0xff, 0xfe, 0xf7, 0xff, 0xdd, 0xff, - 0xfd, 0xdf, 0xfb, 0xfe, 0x9d, 0xb4, 0xd3, 0xff, - 0xef, 0xff, 0xdf, 0xf7, 0x7f, 0xb7, 0xfd, 0xd5, - 0xa5, 0x77, 0x40, 0xff, 0x9c, 0xc1, 0x41, 0x2c, - 0x08, 0x20, 0x41, 0x00, 0x50, 0x40, 0x00, 0x80, - // Entry C0 - FF - 0xfb, 0x4a, 0xf2, 0x9f, 0xb4, 0x42, 0x41, 0x96, - 0x1b, 0x14, 0x08, 0xf2, 0x2b, 0xe7, 0x17, 0x56, - 0x45, 0x7d, 0x0e, 0x1c, 0x37, 0x71, 0xf3, 0xef, - 0x97, 0xff, 0x5d, 0x38, 0x64, 0x08, 0x00, 0x10, - 0xbc, 0x85, 0xaf, 0xdf, 0xff, 0xf7, 0x73, 0x35, - 0x3e, 0x87, 0xc7, 0xdf, 0xff, 0x00, 0x81, 0x00, - 0xb0, 0x05, 0x80, 0x00, 0x00, 0x00, 0x00, 0x03, - 0x40, 0x00, 0x40, 0x92, 0x21, 0x50, 0xb1, 0x5d, - // Entry 100 - 13F - 0xfd, 0xdc, 0xbe, 0x5e, 0x00, 0x00, 0x02, 0x64, - 0x0d, 0x19, 0x41, 0xdf, 0x79, 0x22, 0x00, 0x00, - 0x00, 0x5e, 0x64, 0xdc, 0x24, 0xe5, 0xd9, 0xe3, - 0xfe, 0xff, 0xfd, 0xcb, 0x9f, 0x14, 0x01, 0x0c, - 0x86, 0x00, 0xd1, 0x00, 0xf0, 0xc5, 0x67, 0x5f, - 0x56, 0x89, 0x5e, 0xb5, 0x6c, 0xaf, 0x03, 0x00, - 0x02, 0x00, 0x00, 0x00, 0xc0, 0x37, 0xda, 0x56, - 0x90, 0x69, 0x01, 0x2c, 0x96, 0x69, 0x20, 0xfb, - // Entry 140 - 17F - 0xff, 0x3f, 0x00, 0x00, 0x00, 0x01, 0x08, 0x16, - 0x01, 0x00, 0x00, 0xb0, 0x14, 0x03, 0x50, 0x06, - 0x0a, 0x00, 0x01, 0x00, 0x00, 0x00, 0x11, 0x09, - 0x00, 0x00, 0x60, 0x10, 0x00, 0x00, 0x00, 0x10, - 0x00, 0x00, 0x44, 0x00, 0x00, 0x10, 0x00, 0x04, - 0x08, 0x00, 0x00, 0x04, 0x00, 0x80, 0x28, 0x04, - 0x00, 0x00, 0x40, 0xd5, 0x2d, 0x00, 0x64, 0x35, - 0x24, 0x52, 0xf4, 0xd4, 0xbd, 0x62, 0xc9, 0x03, - // Entry 180 - 1BF - 0x00, 0x80, 0x00, 0x40, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x13, 0x39, 0x01, 0xdd, 0x57, 0x98, - 0x21, 0x18, 0x81, 0x00, 0x00, 0x01, 0x40, 0x82, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x40, 0x00, 0x44, 0x00, 0x00, 0x80, 0xea, - 0xa9, 0x39, 0x00, 0x02, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x01, 0x28, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x20, 0x04, 0xa6, 0x00, 0x04, 0x00, 0x00, - 0x81, 0x50, 0x00, 0x00, 0x00, 0x11, 0x84, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x06, 0x55, - 0x02, 0x10, 0x08, 0x04, 0x00, 0x00, 0x00, 0x40, - 0x30, 0x83, 0x01, 0x00, 0x00, 0x00, 0x11, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x1e, 0xcd, 0xbf, 0x7e, 0xbf, - // Entry 200 - 23F - 0xdf, 0xc3, 0x83, 0x82, 0xc0, 0xfb, 0x57, 0x27, - 0xcd, 0x55, 0xe7, 0x01, 0x00, 0x20, 0xb2, 0xc5, - 0xa4, 0x45, 0x25, 0x9b, 0x02, 0xcf, 0xe0, 0xdf, - 0x03, 0x44, 0x08, 0x10, 0x01, 0x04, 0x01, 0xe3, - 0x92, 0x54, 0xdb, 0x28, 0xd1, 0x5f, 0xf6, 0x6d, - 0x79, 0xed, 0x1c, 0x7d, 0x04, 0x08, 0x00, 0x01, - 0x21, 0x12, 0x64, 0x5f, 0xdd, 0x0e, 0x85, 0x4f, - 0x40, 0x40, 0x00, 0x04, 0xf1, 0xfd, 0x3d, 0x54, - // Entry 240 - 27F - 0xe8, 0x03, 0xb4, 0x27, 0x23, 0x0d, 0x00, 0x00, - 0x20, 0x7b, 0x38, 0x02, 0x05, 0x84, 0x00, 0xf0, - 0xbb, 0x7e, 0x5a, 0x00, 0x18, 0x04, 0x81, 0x00, - 0x00, 0x00, 0x80, 0x10, 0x90, 0x1c, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x10, 0x40, 0x00, 0x04, - 0x08, 0xa0, 0x70, 0xa5, 0x0c, 0x40, 0x00, 0x00, - 0x11, 0x04, 0x04, 0x68, 0x00, 0x20, 0x70, 0xff, - 0x7b, 0x7f, 0x60, 0x00, 0x05, 0x9b, 0xdd, 0x66, - // Entry 280 - 2BF - 0x03, 0x00, 0x11, 0x00, 0x00, 0x00, 0x40, 0x05, - 0xb5, 0xb6, 0x80, 0x08, 0x04, 0x00, 0x04, 0x51, - 0xe2, 0xef, 0xfd, 0x3f, 0x05, 0x09, 0x08, 0x05, - 0x40, 0x00, 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, - 0x08, 0x00, 0x00, 0x00, 0x00, 0x81, 0x00, 0x60, - 0xe5, 0x48, 0x00, 0x81, 0x20, 0xc0, 0x05, 0x80, - 0x03, 0x00, 0x00, 0x00, 0x8c, 0x50, 0x40, 0x04, - 0x84, 0x47, 0x84, 0x40, 0x20, 0x10, 0x00, 0x20, - // Entry 2C0 - 2FF - 0x02, 0x50, 0x80, 0x11, 0x00, 0x91, 0x6c, 0xe2, - 0x50, 0x27, 0x1d, 0x11, 0x29, 0x06, 0x59, 0xe9, - 0x33, 0x08, 0x00, 0x20, 0x04, 0x40, 0x10, 0x00, - 0x00, 0x00, 0x50, 0x44, 0x92, 0x49, 0xd6, 0x5d, - 0xa7, 0x81, 0x47, 0x97, 0xfb, 0x00, 0x10, 0x00, - 0x08, 0x00, 0x80, 0x00, 0x40, 0x04, 0x00, 0x01, - 0x02, 0x00, 0x01, 0x40, 0x80, 0x00, 0x00, 0x08, - 0xd8, 0xeb, 0xf6, 0x39, 0xc4, 0x89, 0x12, 0x00, - // Entry 300 - 33F - 0x00, 0x0c, 0x04, 0x01, 0x20, 0x20, 0xdd, 0xa0, - 0x01, 0x00, 0x00, 0x00, 0x12, 0x00, 0x00, 0x00, - 0x04, 0x10, 0xd0, 0x9d, 0x95, 0x13, 0x04, 0x80, - 0x00, 0x01, 0xd0, 0x12, 0x40, 0x00, 0x10, 0xb0, - 0x10, 0x62, 0x4c, 0xd2, 0x02, 0x01, 0x4a, 0x00, - 0x46, 0x04, 0x00, 0x08, 0x02, 0x00, 0x20, 0x80, - 0x00, 0x80, 0x06, 0x00, 0x08, 0x00, 0x00, 0x00, - 0x00, 0xf0, 0xd8, 0x6f, 0x15, 0x02, 0x08, 0x00, - // Entry 340 - 37F - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x10, 0x01, - 0x00, 0x10, 0x00, 0x00, 0x00, 0xf0, 0x84, 0xe3, - 0xdd, 0xbf, 0xf9, 0xf9, 0x3b, 0x7f, 0x7f, 0xdb, - 0xfd, 0xfc, 0xfe, 0xdf, 0xff, 0xfd, 0xff, 0xf6, - 0xfb, 0xfc, 0xf7, 0x1f, 0xff, 0xb3, 0x6c, 0xff, - 0xd9, 0xad, 0xdf, 0xfe, 0xef, 0xba, 0xdf, 0xff, - 0xff, 0xff, 0xb7, 0xdd, 0x7d, 0xbf, 0xab, 0x7f, - 0xfd, 0xfd, 0xdf, 0x2f, 0x9c, 0xdf, 0xf3, 0x6f, - // Entry 380 - 3BF - 0xdf, 0xdd, 0xff, 0xfb, 0xee, 0xd2, 0xab, 0x5f, - 0xd5, 0xdf, 0x7f, 0xff, 0xeb, 0xff, 0xe4, 0x4d, - 0xf9, 0xff, 0xfe, 0xf7, 0xfd, 0xdf, 0xfb, 0xbf, - 0xee, 0xdb, 0x6f, 0xef, 0xff, 0x7f, 0xff, 0xff, - 0xf7, 0x5f, 0xd3, 0x3b, 0xfd, 0xd9, 0xdf, 0xeb, - 0xbc, 0x08, 0x05, 0x24, 0xff, 0x07, 0x70, 0xfe, - 0xe6, 0x5e, 0x00, 0x08, 0x00, 0x83, 0x3d, 0x1b, - 0x06, 0xe6, 0x72, 0x60, 0xd1, 0x3c, 0x7f, 0x44, - // Entry 3C0 - 3FF - 0x02, 0x30, 0x9f, 0x7a, 0x16, 0xbd, 0x7f, 0x57, - 0xf2, 0xff, 0x31, 0xff, 0xf2, 0x1e, 0x90, 0xf7, - 0xf1, 0xf9, 0x45, 0x80, 0x01, 0x02, 0x00, 0x00, - 0x40, 0x54, 0x9f, 0x8a, 0xd9, 0xd9, 0x0e, 0x11, - 0x84, 0x51, 0xc0, 0xf3, 0xfb, 0x47, 0x00, 0x01, - 0x05, 0xd1, 0x50, 0x58, 0x00, 0x00, 0x00, 0x10, - 0x04, 0x02, 0x00, 0x00, 0x0a, 0x00, 0x17, 0xd2, - 0xb9, 0xfd, 0xfc, 0xba, 0xfe, 0xef, 0xc7, 0xbe, - // Entry 400 - 43F - 0x53, 0x6f, 0xdf, 0xe7, 0xdb, 0x65, 0xbb, 0x7f, - 0xfa, 0xff, 0x77, 0xf3, 0xef, 0xbf, 0xfd, 0xf7, - 0xdf, 0xdf, 0x9b, 0x7f, 0xff, 0xff, 0x7f, 0x6f, - 0xf7, 0xfb, 0xeb, 0xdf, 0xbc, 0xff, 0xbf, 0x6b, - 0x7b, 0xfb, 0xff, 0xce, 0x76, 0xbd, 0xf7, 0xf7, - 0xdf, 0xdc, 0xf7, 0xf7, 0xff, 0xdf, 0xf3, 0xfe, - 0xef, 0xff, 0xff, 0xff, 0xb6, 0x7f, 0x7f, 0xde, - 0xf7, 0xb9, 0xeb, 0x77, 0xff, 0xfb, 0xbf, 0xdf, - // Entry 440 - 47F - 0xfd, 0xfe, 0xfb, 0xff, 0xfe, 0xeb, 0x1f, 0x7d, - 0x2f, 0xfd, 0xb6, 0xb5, 0xa5, 0xfc, 0xff, 0xfd, - 0x7f, 0x4e, 0xbf, 0x8e, 0xae, 0xff, 0xee, 0xdf, - 0x7f, 0xf7, 0x73, 0x02, 0x02, 0x04, 0xfc, 0xf7, - 0xff, 0xb7, 0xd7, 0xef, 0xfe, 0xcd, 0xf5, 0xce, - 0xe2, 0x8e, 0xe7, 0xbf, 0xb7, 0xff, 0x56, 0xbd, - 0xcd, 0xff, 0xfb, 0xff, 0xdf, 0xd7, 0xea, 0xff, - 0xe5, 0x5f, 0x6d, 0x0f, 0xa7, 0x51, 0x04, 0x44, - // Entry 480 - 4BF - 0x13, 0x50, 0x5d, 0xaf, 0xa6, 0xfd, 0x99, 0xfb, - 0x63, 0x1d, 0x53, 0xff, 0xef, 0xb7, 0x35, 0x20, - 0x14, 0x00, 0x55, 0x51, 0x82, 0x65, 0xf5, 0x41, - 0xe2, 0xff, 0xfc, 0xdf, 0x00, 0x05, 0xc5, 0x05, - 0x00, 0x22, 0x00, 0x74, 0x69, 0x10, 0x08, 0x04, - 0x41, 0x00, 0x01, 0x06, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x51, 0x20, 0x05, 0x04, 0x01, 0x00, 0x00, - 0x06, 0x01, 0x20, 0x00, 0x18, 0x01, 0x92, 0xb1, - // Entry 4C0 - 4FF - 0xfd, 0x47, 0x49, 0x06, 0x95, 0x06, 0x57, 0xed, - 0xfb, 0x4c, 0x1c, 0x6b, 0x83, 0x04, 0x62, 0x40, - 0x00, 0x11, 0x42, 0x00, 0x00, 0x00, 0x54, 0x83, - 0xb8, 0x4f, 0x10, 0x8c, 0x89, 0x46, 0xde, 0xf7, - 0x13, 0x31, 0x00, 0x20, 0x00, 0x00, 0x00, 0x90, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0a, 0x10, 0x00, - 0x01, 0x00, 0x00, 0xf0, 0x5b, 0xf4, 0xbe, 0x3d, - 0xba, 0xcf, 0xf7, 0xaf, 0x42, 0x04, 0x84, 0x41, - // Entry 500 - 53F - 0x30, 0xff, 0x79, 0x72, 0x04, 0x00, 0x00, 0x49, - 0x2d, 0x14, 0x27, 0x57, 0xed, 0xf1, 0x3f, 0xe7, - 0x3f, 0x00, 0x00, 0x02, 0xc6, 0xa0, 0x1e, 0xf8, - 0xbb, 0xff, 0xfd, 0xfb, 0xb7, 0xfd, 0xe5, 0xf7, - 0xfd, 0xfc, 0xd5, 0xed, 0x47, 0xf4, 0x7e, 0x10, - 0x01, 0x01, 0x84, 0x6d, 0xff, 0xf7, 0xdd, 0xf9, - 0x5b, 0x05, 0x86, 0xed, 0xf5, 0x77, 0xbd, 0x3c, - 0x00, 0x00, 0x00, 0x42, 0x71, 0x42, 0x00, 0x40, - // Entry 540 - 57F - 0x00, 0x00, 0x01, 0x43, 0x19, 0x00, 0x08, 0x00, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - // Entry 580 - 5BF - 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, 0xff, - 0xff, 0xab, 0xbd, 0xe7, 0x57, 0xee, 0x13, 0x5d, - 0x09, 0xc1, 0x40, 0x21, 0xfa, 0x17, 0x01, 0x80, - 0x00, 0x00, 0x00, 0x00, 0xf0, 0xce, 0xfb, 0xbf, - 0x00, 0x23, 0x00, 0x00, 0x00, 0x00, 0x08, 0x00, - 0x00, 0x30, 0x15, 0xa3, 0x10, 0x00, 0x00, 0x00, - 0x11, 0x04, 0x16, 0x00, 0x00, 0x02, 0x00, 0x81, - 0xa3, 0x01, 0x50, 0x00, 0x00, 0x83, 0x11, 0x40, - // Entry 5C0 - 5FF - 0x00, 0x00, 0x00, 0xf0, 0xdd, 0x7b, 0x3e, 0x02, - 0xaa, 0x10, 0x5d, 0x98, 0x52, 0x00, 0x80, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x02, 0x02, - 0x19, 0x00, 0x10, 0x02, 0x10, 0x61, 0x5a, 0x9d, - 0x31, 0x00, 0x00, 0x00, 0x01, 0x10, 0x02, 0x20, - 0x00, 0x00, 0x01, 0x00, 0x42, 0x00, 0x20, 0x00, - 0x00, 0x1f, 0xdf, 0xd2, 0xb9, 0xff, 0xfd, 0x3f, - 0x1f, 0x18, 0xcf, 0x9c, 0xbf, 0xaf, 0x5f, 0xfe, - // Entry 600 - 63F - 0x7b, 0x4b, 0x40, 0x10, 0xe1, 0xfd, 0xaf, 0xd9, - 0xb7, 0xf6, 0xfb, 0xb3, 0xc7, 0xff, 0x6f, 0xf1, - 0x73, 0xb1, 0x7f, 0x9f, 0x7f, 0xbd, 0xfc, 0xb7, - 0xee, 0x1c, 0xfa, 0xcb, 0xef, 0xdd, 0xf9, 0xbd, - 0x6e, 0xae, 0x55, 0xfd, 0x6e, 0x81, 0x76, 0x1f, - 0xd4, 0x77, 0xf5, 0x7d, 0xfb, 0xff, 0xeb, 0xfe, - 0xbe, 0x5f, 0x46, 0x1b, 0xe9, 0x5f, 0x50, 0x18, - 0x02, 0xfa, 0xf7, 0x9d, 0x15, 0x97, 0x05, 0x0f, - // Entry 640 - 67F - 0x75, 0xc4, 0x7d, 0x81, 0x82, 0xf1, 0x57, 0x6c, - 0xff, 0xe4, 0xef, 0x6f, 0xff, 0xfc, 0xdd, 0xde, - 0xfc, 0xfd, 0x76, 0x5f, 0x7a, 0x1f, 0x00, 0x98, - 0x02, 0xfb, 0xa3, 0xef, 0xf3, 0xd6, 0xf2, 0xff, - 0xb9, 0xda, 0x7d, 0x50, 0x1e, 0x15, 0x7b, 0xb4, - 0xf5, 0x3e, 0xff, 0xff, 0xf1, 0xf7, 0xff, 0xe7, - 0x5f, 0xff, 0xff, 0x9e, 0xdb, 0xf6, 0xd7, 0xb9, - 0xef, 0x27, 0x80, 0xbb, 0xc5, 0xff, 0xff, 0xe3, - // Entry 680 - 6BF - 0x97, 0x9d, 0xbf, 0x9f, 0xf7, 0xc7, 0xfd, 0x37, - 0xce, 0x7f, 0x04, 0x1d, 0x53, 0x7f, 0xf8, 0xda, - 0x5d, 0xce, 0x7d, 0x06, 0xb9, 0xea, 0x69, 0xa0, - 0x1a, 0x20, 0x00, 0x30, 0x02, 0x04, 0x24, 0x08, - 0x04, 0x00, 0x00, 0x40, 0xd4, 0x02, 0x04, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x20, 0x01, 0x06, - 0x50, 0x00, 0x08, 0x00, 0x00, 0x00, 0x24, 0x00, - 0x04, 0x00, 0x10, 0x8c, 0x58, 0xd5, 0x0d, 0x0f, - // Entry 6C0 - 6FF - 0x14, 0x4d, 0xf1, 0x16, 0x44, 0xd1, 0x42, 0x08, - 0x40, 0x00, 0x00, 0x40, 0x00, 0x08, 0x00, 0x00, - 0x00, 0xdc, 0xfb, 0xcb, 0x0e, 0x58, 0x08, 0x41, - 0x04, 0x20, 0x04, 0x00, 0x30, 0x12, 0x40, 0x00, - 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x80, 0x10, 0x10, 0xab, - 0x6d, 0x93, 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x80, 0x80, 0x25, 0x00, 0x00, - // Entry 700 - 73F - 0x00, 0x00, 0x00, 0x00, 0x0a, 0x00, 0x00, 0x00, - 0x80, 0x86, 0xc2, 0x00, 0x00, 0x00, 0x00, 0x01, - 0xdf, 0x18, 0x00, 0x00, 0x02, 0xf0, 0xfd, 0x79, - 0x3b, 0x00, 0x25, 0x00, 0x00, 0x00, 0x02, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x40, 0x00, 0x00, - 0x03, 0x00, 0x09, 0x20, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x01, 0x00, 0x00, 0x00, 0x00, 0x01, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 740 - 77F - 0x00, 0x00, 0x00, 0xef, 0xd5, 0xfd, 0xcf, 0x7e, - 0xa0, 0x11, 0x00, 0x00, 0x00, 0x92, 0x01, 0x44, - 0xcd, 0xf9, 0x5c, 0x00, 0x01, 0x00, 0x30, 0x04, - 0x04, 0x55, 0x00, 0x01, 0x04, 0xf4, 0x3f, 0x4a, - 0x01, 0x00, 0x00, 0xb0, 0x80, 0x00, 0x55, 0x55, - 0x97, 0x7c, 0x9f, 0x31, 0xcc, 0x68, 0xd1, 0x03, - 0xd5, 0x57, 0x27, 0x14, 0x01, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x2c, 0xf7, 0xcb, 0x1f, 0x14, 0x60, - // Entry 780 - 7BF - 0x03, 0x68, 0x01, 0x10, 0x8b, 0x38, 0x8a, 0x01, - 0x00, 0x00, 0x20, 0x00, 0x24, 0x44, 0x00, 0x00, - 0x10, 0x03, 0x11, 0x02, 0x01, 0x00, 0x00, 0xf0, - 0xf5, 0xff, 0xd5, 0x97, 0xbc, 0x70, 0xd6, 0x78, - 0x78, 0x15, 0x50, 0x00, 0xa4, 0x84, 0xa9, 0x41, - 0x00, 0x00, 0x00, 0x6b, 0x39, 0x52, 0x74, 0x00, - 0xe8, 0x30, 0x90, 0x6a, 0x92, 0x00, 0x00, 0x02, - 0xff, 0xef, 0xff, 0x4b, 0x85, 0x53, 0xf4, 0xed, - // Entry 7C0 - 7FF - 0xdd, 0xbf, 0x72, 0x19, 0xc7, 0x0c, 0xd5, 0x42, - 0x54, 0xdd, 0x77, 0x14, 0x00, 0x80, 0x40, 0x56, - 0xcc, 0x16, 0x9e, 0xea, 0x35, 0x7d, 0xef, 0xff, - 0xbd, 0xa4, 0xaf, 0x01, 0x44, 0x18, 0x01, 0x4d, - 0x4e, 0x4a, 0x08, 0x50, 0x28, 0x30, 0xe0, 0x80, - 0x10, 0x20, 0x24, 0x00, 0xff, 0x2f, 0xd3, 0x60, - 0xfe, 0x01, 0x02, 0x88, 0x0a, 0x40, 0x16, 0x01, - 0x01, 0x15, 0x2b, 0x3c, 0x01, 0x00, 0x00, 0x10, - // Entry 800 - 83F - 0x90, 0x49, 0x41, 0x02, 0x02, 0x01, 0xe1, 0xbf, - 0xbf, 0x03, 0x00, 0x00, 0x10, 0xd4, 0xa3, 0xd1, - 0x40, 0x9c, 0x44, 0xdf, 0xf5, 0x8f, 0x66, 0xb3, - 0x55, 0x20, 0xd4, 0xc1, 0xd8, 0x30, 0x3d, 0x80, - 0x00, 0x00, 0x00, 0x04, 0xd4, 0x11, 0xc5, 0x84, - 0x2e, 0x50, 0x00, 0x22, 0x50, 0x6e, 0xbd, 0x93, - 0x07, 0x00, 0x20, 0x10, 0x84, 0xb2, 0x45, 0x10, - 0x06, 0x44, 0x00, 0x00, 0x12, 0x02, 0x11, 0x00, - // Entry 840 - 87F - 0xf0, 0xfb, 0xfd, 0x3f, 0x05, 0x00, 0x12, 0x81, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x0c, 0x02, - 0x00, 0x00, 0x00, 0x00, 0x03, 0x30, 0x02, 0x28, - 0x84, 0x00, 0x23, 0xc0, 0x23, 0x24, 0x00, 0x00, - 0x00, 0xcb, 0xe4, 0x3a, 0x42, 0x88, 0x14, 0xf1, - 0xef, 0xff, 0x7f, 0x12, 0x01, 0x01, 0x84, 0x50, - 0x07, 0xfc, 0xff, 0xff, 0x0f, 0x01, 0x00, 0x40, - 0x10, 0x38, 0x01, 0x01, 0x1c, 0x12, 0x40, 0xe1, - // Entry 880 - 8BF - 0x76, 0x16, 0x08, 0x03, 0x10, 0x00, 0x00, 0x00, - 0x01, 0x00, 0x00, 0x00, 0x00, 0x00, 0x20, 0x24, - 0x0a, 0x00, 0x80, 0x00, 0x00, -} - -// altLangISO3 holds an alphabetically sorted list of 3-letter language code alternatives -// to 2-letter language codes that cannot be derived using the method described above. -// Each 3-letter code is followed by its 1-byte langID. -const altLangISO3 tag.Index = "---\x00cor\x00hbs\x01heb\x02kin\x03spa\x04yid\x05\xff\xff\xff\xff" - -// altLangIndex is used to convert indexes in altLangISO3 to langIDs. -// Size: 12 bytes, 6 elements -var altLangIndex = [6]uint16{ - 0x027f, 0x0405, 0x01f9, 0x03e3, 0x013d, 0x0206, -} - -// langAliasMap maps langIDs to their suggested replacements. -// Size: 644 bytes, 161 elements -var langAliasMap = [161]fromTo{ - 0: {from: 0x82, to: 0x88}, - 1: {from: 0x185, to: 0x1ac}, - 2: {from: 0x1f1, to: 0x1df}, - 3: {from: 0x1f9, to: 0x1ba}, - 4: {from: 0x206, to: 0x510}, - 5: {from: 0x20d, to: 0x20c}, - 6: {from: 0x30e, to: 0x3da}, - 7: {from: 0x345, to: 0x36d}, - 8: {from: 0x405, to: 0x430}, - 9: {from: 0x478, to: 0x152}, - 10: {from: 0x48e, to: 0x44f}, - 11: {from: 0x4a0, to: 0x21}, - 12: {from: 0x53b, to: 0x541}, - 13: {from: 0x58c, to: 0x12c}, - 14: {from: 0x62d, to: 0x1eae}, - 15: {from: 0x64e, to: 0x42f}, - 16: {from: 0x65f, to: 0x42f}, - 17: {from: 0x6ea, to: 0x3a}, - 18: {from: 0x6f5, to: 0x1d5}, - 19: {from: 0x73b, to: 0x219e}, - 20: {from: 0x7b0, to: 0x56}, - 21: {from: 0x7b6, to: 0x2998}, - 22: {from: 0x7c2, to: 0x58}, - 23: {from: 0x7e3, to: 0x144}, - 24: {from: 0x809, to: 0x5a}, - 25: {from: 0x812, to: 0x8d}, - 26: {from: 0x87b, to: 0x80d}, - 27: {from: 0x8c0, to: 0xee0}, - 28: {from: 0x9ec, to: 0x32f}, - 29: {from: 0xa33, to: 0x2c3}, - 30: {from: 0xa3a, to: 0xbf}, - 31: {from: 0xabb, to: 0x331f}, - 32: {from: 0xb35, to: 0x527}, - 33: {from: 0xb72, to: 0x2657}, - 34: {from: 0xb7b, to: 0xbc0}, - 35: {from: 0xb98, to: 0x44c}, - 36: {from: 0xbb9, to: 0x4226}, - 37: {from: 0xbbc, to: 0x527}, - 38: {from: 0xbfb, to: 0x2da4}, - 39: {from: 0xc2b, to: 0x317e}, - 40: {from: 0xcb6, to: 0xf2}, - 41: {from: 0xd05, to: 0xf9}, - 42: {from: 0xdc5, to: 0x119}, - 43: {from: 0xdd4, to: 0x32b}, - 44: {from: 0xdf5, to: 0xdf8}, - 45: {from: 0xdfb, to: 0x52e}, - 46: {from: 0xedc, to: 0x2057}, - 47: {from: 0xeeb, to: 0x2e97}, - 48: {from: 0xf36, to: 0x365}, - 49: {from: 0x10cd, to: 0x13f}, - 50: {from: 0x1101, to: 0x2ce}, - 51: {from: 0x119d, to: 0x1ea}, - 52: {from: 0x1276, to: 0x21}, - 53: {from: 0x1421, to: 0x15d}, - 54: {from: 0x146d, to: 0x14d}, - 55: {from: 0x151c, to: 0xd98}, - 56: {from: 0x1520, to: 0x38e}, - 57: {from: 0x152f, to: 0x19d}, - 58: {from: 0x157d, to: 0x20e}, - 59: {from: 0x1580, to: 0x10c}, - 60: {from: 0x15a0, to: 0x3cac}, - 61: {from: 0x1667, to: 0x199}, - 62: {from: 0x16c5, to: 0x135}, - 63: {from: 0x16fd, to: 0x29f5}, - 64: {from: 0x1715, to: 0x192}, - 65: {from: 0x1724, to: 0xf3c}, - 66: {from: 0x1777, to: 0x1521}, - 67: {from: 0x1806, to: 0x17b3}, - 68: {from: 0x1813, to: 0x18f0}, - 69: {from: 0x1887, to: 0x434}, - 70: {from: 0x1976, to: 0x1cfe}, - 71: {from: 0x1a71, to: 0x2bad}, - 72: {from: 0x1a87, to: 0x1f6}, - 73: {from: 0x1b57, to: 0x1f8}, - 74: {from: 0x1b83, to: 0x1512}, - 75: {from: 0x2035, to: 0x37ae}, - 76: {from: 0x203a, to: 0x20da}, - 77: {from: 0x2057, to: 0x309}, - 78: {from: 0x20e0, to: 0x272}, - 79: {from: 0x20eb, to: 0x261}, - 80: {from: 0x20ef, to: 0x22b}, - 81: {from: 0x20f6, to: 0x254}, - 82: {from: 0x210c, to: 0x21e8}, - 83: {from: 0x2132, to: 0x27b}, - 84: {from: 0x2196, to: 0x120}, - 85: {from: 0x21cb, to: 0x155e}, - 86: {from: 0x21e3, to: 0x502}, - 87: {from: 0x21f1, to: 0x49d}, - 88: {from: 0x222a, to: 0x120}, - 89: {from: 0x2234, to: 0x120}, - 90: {from: 0x225f, to: 0x927}, - 91: {from: 0x2313, to: 0x3223}, - 92: {from: 0x237f, to: 0x3362}, - 93: {from: 0x246f, to: 0x2c5}, - 94: {from: 0x24e1, to: 0x2fd}, - 95: {from: 0x24ed, to: 0x2f8}, - 96: {from: 0x24f7, to: 0x31d}, - 97: {from: 0x254d, to: 0xb58}, - 98: {from: 0x25a6, to: 0xe2}, - 99: {from: 0x263b, to: 0x2ce}, - 100: {from: 0x26c6, to: 0x26b1}, - 101: {from: 0x26f6, to: 0x3c6}, - 102: {from: 0x2724, to: 0x3cac}, - 103: {from: 0x2762, to: 0x26b1}, - 104: {from: 0x2786, to: 0x4355}, - 105: {from: 0x28ec, to: 0x2834}, - 106: {from: 0x2911, to: 0x34f}, - 107: {from: 0x2983, to: 0x2da4}, - 108: {from: 0x2b17, to: 0x38b}, - 109: {from: 0x2bf9, to: 0x393}, - 110: {from: 0x2c3c, to: 0x3cac}, - 111: {from: 0x2cf9, to: 0x3bc}, - 112: {from: 0x2d10, to: 0x594}, - 113: {from: 0x2d44, to: 0x147}, - 114: {from: 0x2d45, to: 0x147}, - 115: {from: 0x2dfc, to: 0x2ef}, - 116: {from: 0x2e05, to: 0x19c9}, - 117: {from: 0x2e17, to: 0x2d92}, - 118: {from: 0x2e1e, to: 0x290}, - 119: {from: 0x2e51, to: 0x7d}, - 120: {from: 0x2e62, to: 0x227f}, - 121: {from: 0x2e9d, to: 0x2e98}, - 122: {from: 0x2eec, to: 0x2ed4}, - 123: {from: 0x3190, to: 0x3c2}, - 124: {from: 0x3363, to: 0x338b}, - 125: {from: 0x3427, to: 0x3da}, - 126: {from: 0x34eb, to: 0x18cd}, - 127: {from: 0x35e3, to: 0x410}, - 128: {from: 0x3655, to: 0x244}, - 129: {from: 0x3673, to: 0x3f2}, - 130: {from: 0x36fa, to: 0x443}, - 131: {from: 0x37bd, to: 0x120}, - 132: {from: 0x3813, to: 0x38ef}, - 133: {from: 0x3828, to: 0x2c98}, - 134: {from: 0x382c, to: 0xa9}, - 135: {from: 0x382f, to: 0x3225}, - 136: {from: 0x3869, to: 0x39a3}, - 137: {from: 0x388f, to: 0x3fbd}, - 138: {from: 0x38a2, to: 0x39d4}, - 139: {from: 0x38b1, to: 0x1fa1}, - 140: {from: 0x38b2, to: 0x2e97}, - 141: {from: 0x3959, to: 0x47c}, - 142: {from: 0x3b4b, to: 0xd8e}, - 143: {from: 0x3b75, to: 0x136}, - 144: {from: 0x3c96, to: 0x4ba}, - 145: {from: 0x3fba, to: 0xff}, - 146: {from: 0x4205, to: 0xa8e}, - 147: {from: 0x42bb, to: 0x570}, - 148: {from: 0x42f6, to: 0x3f5d}, - 149: {from: 0x4375, to: 0x258}, - 150: {from: 0x43c8, to: 0x36c8}, - 151: {from: 0x43ca, to: 0x10e}, - 152: {from: 0x44ac, to: 0x331f}, - 153: {from: 0x44e0, to: 0x510}, - 154: {from: 0x45c7, to: 0x2406}, - 155: {from: 0x45da, to: 0x26d9}, - 156: {from: 0x460d, to: 0x48ab}, - 157: {from: 0x46ab, to: 0x469d}, - 158: {from: 0x473b, to: 0x4742}, - 159: {from: 0x4913, to: 0x31d}, - 160: {from: 0x49a4, to: 0x521}, -} - -// Size: 161 bytes, 161 elements -var langAliasTypes = [161]langAliasType{ - // Entry 0 - 3F - 1, 0, 0, 0, 0, 0, 0, 1, 2, 2, 0, 1, 0, 0, 1, 2, - 1, 1, 2, 0, 1, 0, 1, 2, 1, 1, 0, 0, 2, 1, 1, 0, - 2, 0, 0, 1, 0, 1, 0, 0, 1, 2, 1, 1, 1, 1, 0, 0, - 2, 1, 1, 1, 1, 2, 1, 0, 1, 1, 2, 2, 0, 1, 2, 0, - // Entry 40 - 7F - 1, 0, 1, 1, 1, 1, 0, 0, 2, 1, 0, 0, 0, 1, 1, 1, - 1, 1, 0, 1, 0, 0, 0, 0, 0, 0, 1, 0, 0, 1, 2, 2, - 2, 0, 1, 1, 0, 1, 0, 0, 0, 0, 1, 0, 1, 1, 0, 1, - 0, 2, 1, 1, 0, 0, 1, 0, 0, 0, 0, 1, 1, 2, 0, 2, - // Entry 80 - BF - 1, 1, 1, 0, 0, 0, 2, 0, 0, 0, 0, 0, 0, 1, 1, 0, - 1, 2, 0, 0, 0, 1, 0, 1, 0, 1, 0, 0, 0, 0, 1, 1, - 1, -} - -const ( - _Latn = 82 - _Hani = 50 - _Hans = 52 - _Hant = 53 - _Qaaa = 131 - _Qaai = 139 - _Qabx = 180 - _Zinh = 224 - _Zyyy = 229 - _Zzzz = 230 -) - -// script is an alphabetically sorted list of ISO 15924 codes. The index -// of the script in the string, divided by 4, is the internal scriptID. -const script tag.Index = "" + // Size: 928 bytes - "----AdlmAfakAghbAhomArabAranArmiArmnAvstBaliBamuBassBatkBengBhksBlisBopo" + - "BrahBraiBugiBuhdCakmCansCariChamCherCirtCoptCprtCyrlCyrsDevaDsrtDuplEgyd" + - "EgyhEgypElbaEthiGeokGeorGlagGothGranGrekGujrGuruHanbHangHaniHanoHansHant" + - "HatrHebrHiraHluwHmngHrktHungIndsItalJamoJavaJpanJurcKaliKanaKharKhmrKhoj" + - "KitlKitsKndaKoreKpelKthiLanaLaooLatfLatgLatnLekeLepcLimbLinaLinbLisuLoma" + - "LyciLydiMahjMandManiMarcMayaMendMercMeroMlymModiMongMoonMrooMteiMultMymr" + - "NarbNbatNewaNkgbNkooNshuOgamOlckOrkhOryaOsgeOsmaPalmPaucPermPhagPhliPhlp" + - "PhlvPhnxPiqdPlrdPrtiQaaaQaabQaacQaadQaaeQaafQaagQaahQaaiQaajQaakQaalQaam" + - "QaanQaaoQaapQaaqQaarQaasQaatQaauQaavQaawQaaxQaayQaazQabaQabbQabcQabdQabe" + - "QabfQabgQabhQabiQabjQabkQablQabmQabnQaboQabpQabqQabrQabsQabtQabuQabvQabw" + - "QabxRjngRoroRunrSamrSaraSarbSaurSgnwShawShrdSiddSindSinhSoraSundSyloSyrc" + - "SyreSyrjSyrnTagbTakrTaleTaluTamlTangTavtTeluTengTfngTglgThaaThaiTibtTirh" + - "UgarVaiiVispWaraWoleXpeoXsuxYiiiZinhZmthZsyeZsymZxxxZyyyZzzz\xff\xff\xff" + - "\xff" - -// suppressScript is an index from langID to the dominant script for that language, -// if it exists. If a script is given, it should be suppressed from the language tag. -// Size: 1327 bytes, 1327 elements -var suppressScript = [1327]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x27, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 40 - 7F - 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x1e, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, - // Entry 80 - BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x0e, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - // Entry 100 - 13F - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd4, - 0x00, 0x00, 0x00, 0x00, 0xd6, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x2d, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, 0x52, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x05, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 180 - 1BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x2e, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x37, 0x00, 0x20, 0x00, 0x00, 0x00, - // Entry 1C0 - 1FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x52, 0x00, 0x52, 0x52, 0x00, 0x08, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x52, - 0x00, 0x37, 0x00, 0x00, 0x00, 0x00, 0x41, 0x00, - // Entry 200 - 23F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x29, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 240 - 27F - 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x46, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x4a, - 0x00, 0x00, 0x4b, 0x00, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 280 - 2BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x4f, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - // Entry 2C0 - 2FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x20, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, - // Entry 300 - 33F - 0x00, 0x00, 0x64, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x20, 0x00, 0x00, 0x00, 0x52, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x6b, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - // Entry 340 - 37F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x20, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x70, 0x52, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 380 - 3BF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x75, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x2f, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x05, 0x00, 0x52, 0x00, - // Entry 3C0 - 3FF - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x1e, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 400 - 43F - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0xc1, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 440 - 47F - 0x00, 0x00, 0x52, 0x52, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xcd, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xd0, - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0xd5, 0x00, 0x00, 0x00, 0x27, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x52, 0x00, - // Entry 480 - 4BF - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x1e, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, - // Entry 4C0 - 4FF - 0x00, 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x52, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 500 - 53F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x37, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x10, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x52, 0x00, 0x00, -} - -const ( - _001 = 1 - _419 = 30 - _BR = 64 - _CA = 72 - _ES = 109 - _GB = 122 - _MD = 187 - _PT = 237 - _UK = 305 - _US = 308 - _ZZ = 356 - _XA = 322 - _XC = 324 - _XK = 332 -) - -// isoRegionOffset needs to be added to the index of regionISO to obtain the regionID -// for 2-letter ISO codes. (The first isoRegionOffset regionIDs are reserved for -// the UN.M49 codes used for groups.) -const isoRegionOffset = 31 - -// regionTypes defines the status of a region for various standards. -// Size: 357 bytes, 357 elements -var regionTypes = [357]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x05, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 40 - 7F - 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x04, 0x00, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x04, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 80 - BF - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry C0 - FF - 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x06, 0x06, 0x06, 0x00, 0x06, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x00, 0x06, - 0x06, 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - // Entry 100 - 13F - 0x05, 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x04, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x02, 0x06, 0x04, 0x06, 0x06, 0x06, 0x06, - 0x06, 0x00, 0x06, 0x06, 0x06, 0x06, 0x06, 0x06, - // Entry 140 - 17F - 0x00, 0x06, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, 0x05, - 0x05, 0x05, 0x05, 0x05, 0x04, 0x06, 0x06, 0x04, - 0x06, 0x06, 0x04, 0x06, 0x05, -} - -// regionISO holds a list of alphabetically sorted 2-letter ISO region codes. -// Each 2-letter codes is followed by two bytes with the following meaning: -// - [A-Z}{2}: the first letter of the 2-letter code plus these two -// letters form the 3-letter ISO code. -// - 0, n: index into altRegionISO3. -const regionISO tag.Index = "" + // Size: 1308 bytes - "AAAAACSCADNDAEREAFFGAGTGAIIAALLBAMRMANNTAOGOAQTAARRGASSMATUTAUUSAWBWAXLA" + - "AZZEBAIHBBRBBDGDBEELBFFABGGRBHHRBIDIBJENBLLMBMMUBNRNBOOLBQESBRRABSHSBTTN" + - "BUURBVVTBWWABYLRBZLZCAANCCCKCDODCFAFCGOGCHHECIIVCKOKCLHLCMMRCNHNCOOLCPPT" + - "CRRICS\x00\x00CTTECUUBCVPVCWUWCXXRCYYPCZZEDDDRDEEUDGGADJJIDKNKDMMADOOMDY" + - "HYDZZAEA ECCUEESTEGGYEHSHERRIESSPETTHEU\x00\x03EZ FIINFJJIFKLKFMSMFORO" + - "FQ\x00\x18FRRAFXXXGAABGBBRGDRDGEEOGFUFGGGYGHHAGIIBGLRLGMMBGNINGPLPGQNQGR" + - "RCGS\x00\x06GTTMGUUMGWNBGYUYHKKGHMMDHNNDHRRVHTTIHUUNHVVOIC IDDNIERLILSR" + - "IMMNINNDIOOTIQRQIRRNISSLITTAJEEYJMAMJOORJPPNJTTNKEENKGGZKHHMKIIRKM\x00" + - "\x09KNNAKP\x00\x0cKRORKWWTKY\x00\x0fKZAZLAAOLBBNLCCALIIELKKALRBRLSSOLTTU" + - "LUUXLVVALYBYMAARMCCOMDDAMENEMFAFMGDGMHHLMIIDMKKDMLLIMMMRMNNGMOACMPNPMQTQ" + - "MRRTMSSRMTLTMUUSMVDVMWWIMXEXMYYSMZOZNAAMNCCLNEERNFFKNGGANHHBNIICNLLDNOOR" + - "NPPLNQ\x00\x1eNRRUNTTZNUIUNZZLOMMNPAANPCCIPEERPFYFPGNGPHHLPKAKPLOLPM\x00" + - "\x12PNCNPRRIPSSEPTRTPUUSPWLWPYRYPZCZQAATQMMMQNNNQOOOQPPPQQQQQRRRQSSSQTTT" + - "QU\x00\x03QVVVQWWWQXXXQYYYQZZZREEURHHOROOURS\x00\x15RUUSRWWASAAUSBLBSCYC" + - "SDDNSEWESGGPSHHNSIVNSJJMSKVKSLLESMMRSNENSOOMSRURSSSDSTTPSUUNSVLVSXXMSYYR" + - "SZWZTAAATCCATDCDTF\x00\x18TGGOTHHATJJKTKKLTLLSTMKMTNUNTOONTPMPTRURTTTOTV" + - "UVTWWNTZZAUAKRUGGAUK UMMIUN USSAUYRYUZZBVAATVCCTVDDRVEENVGGBVIIRVNNMVU" + - "UTWFLFWKAKWSSMXAAAXBBBXCCCXDDDXEEEXFFFXGGGXHHHXIIIXJJJXKKKXLLLXMMMXNNNXO" + - "OOXPPPXQQQXRRRXSSSXTTTXUUUXVVVXWWWXXXXXYYYXZZZYDMDYEEMYT\x00\x1bYUUGZAAF" + - "ZMMBZRARZWWEZZZZ\xff\xff\xff\xff" - -// altRegionISO3 holds a list of 3-letter region codes that cannot be -// mapped to 2-letter codes using the default algorithm. This is a short list. -const altRegionISO3 string = "SCGQUUSGSCOMPRKCYMSPMSRBATFMYTATN" - -// altRegionIDs holds a list of regionIDs the positions of which match those -// of the 3-letter ISO codes in altRegionISO3. -// Size: 22 bytes, 11 elements -var altRegionIDs = [11]uint16{ - 0x0056, 0x006f, 0x0087, 0x00a7, 0x00a9, 0x00ac, 0x00e9, 0x0104, - 0x0120, 0x015e, 0x00db, -} - -// Size: 80 bytes, 20 elements -var regionOldMap = [20]fromTo{ - 0: {from: 0x43, to: 0xc3}, - 1: {from: 0x57, to: 0xa6}, - 2: {from: 0x5e, to: 0x5f}, - 3: {from: 0x65, to: 0x3a}, - 4: {from: 0x78, to: 0x77}, - 5: {from: 0x92, to: 0x36}, - 6: {from: 0xa2, to: 0x132}, - 7: {from: 0xc0, to: 0x132}, - 8: {from: 0xd6, to: 0x13e}, - 9: {from: 0xdb, to: 0x2a}, - 10: {from: 0xee, to: 0x132}, - 11: {from: 0xf1, to: 0xe1}, - 12: {from: 0xfb, to: 0x6f}, - 13: {from: 0x102, to: 0x163}, - 14: {from: 0x129, to: 0x125}, - 15: {from: 0x131, to: 0x7a}, - 16: {from: 0x139, to: 0x13d}, - 17: {from: 0x140, to: 0x132}, - 18: {from: 0x15c, to: 0x15d}, - 19: {from: 0x162, to: 0x4a}, -} - -// m49 maps regionIDs to UN.M49 codes. The first isoRegionOffset entries are -// codes indicating collections of regions. -// Size: 714 bytes, 357 elements -var m49 = [357]int16{ - // Entry 0 - 3F - 0, 1, 2, 3, 5, 9, 11, 13, - 14, 15, 17, 18, 19, 21, 29, 30, - 34, 35, 39, 53, 54, 57, 61, 142, - 143, 145, 150, 151, 154, 155, 419, 958, - 0, 20, 784, 4, 28, 660, 8, 51, - 530, 24, 10, 32, 16, 40, 36, 533, - 248, 31, 70, 52, 50, 56, 854, 100, - 48, 108, 204, 652, 60, 96, 68, 535, - // Entry 40 - 7F - 76, 44, 64, 104, 74, 72, 112, 84, - 124, 166, 180, 140, 178, 756, 384, 184, - 152, 120, 156, 170, 0, 188, 891, 296, - 192, 132, 531, 162, 196, 203, 278, 276, - 0, 262, 208, 212, 214, 204, 12, 0, - 218, 233, 818, 732, 232, 724, 231, 967, - 0, 246, 242, 238, 583, 234, 0, 250, - 249, 266, 826, 308, 268, 254, 831, 288, - // Entry 80 - BF - 292, 304, 270, 324, 312, 226, 300, 239, - 320, 316, 624, 328, 344, 334, 340, 191, - 332, 348, 854, 0, 360, 372, 376, 833, - 356, 86, 368, 364, 352, 380, 832, 388, - 400, 392, 581, 404, 417, 116, 296, 174, - 659, 408, 410, 414, 136, 398, 418, 422, - 662, 438, 144, 430, 426, 440, 442, 428, - 434, 504, 492, 498, 499, 663, 450, 584, - // Entry C0 - FF - 581, 807, 466, 104, 496, 446, 580, 474, - 478, 500, 470, 480, 462, 454, 484, 458, - 508, 516, 540, 562, 574, 566, 548, 558, - 528, 578, 524, 10, 520, 536, 570, 554, - 512, 591, 0, 604, 258, 598, 608, 586, - 616, 666, 612, 630, 275, 620, 581, 585, - 600, 591, 634, 959, 960, 961, 962, 963, - 964, 965, 966, 967, 968, 969, 970, 971, - // Entry 100 - 13F - 972, 638, 716, 642, 688, 643, 646, 682, - 90, 690, 729, 752, 702, 654, 705, 744, - 703, 694, 674, 686, 706, 740, 728, 678, - 810, 222, 534, 760, 748, 0, 796, 148, - 260, 768, 764, 762, 772, 626, 795, 788, - 776, 626, 792, 780, 798, 158, 834, 804, - 800, 826, 581, 0, 840, 858, 860, 336, - 670, 704, 862, 92, 850, 704, 548, 876, - // Entry 140 - 17F - 581, 882, 973, 974, 975, 976, 977, 978, - 979, 980, 981, 982, 983, 984, 985, 986, - 987, 988, 989, 990, 991, 992, 993, 994, - 995, 996, 997, 998, 720, 887, 175, 891, - 710, 894, 180, 716, 999, -} - -// m49Index gives indexes into fromM49 based on the three most significant bits -// of a 10-bit UN.M49 code. To search an UN.M49 code in fromM49, search in -// fromM49[m49Index[msb39(code)]:m49Index[msb3(code)+1]] -// for an entry where the first 7 bits match the 7 lsb of the UN.M49 code. -// The region code is stored in the 9 lsb of the indexed value. -// Size: 18 bytes, 9 elements -var m49Index = [9]int16{ - 0, 59, 107, 142, 180, 219, 258, 290, - 332, -} - -// fromM49 contains entries to map UN.M49 codes to regions. See m49Index for details. -// Size: 664 bytes, 332 elements -var fromM49 = [332]uint16{ - // Entry 0 - 3F - 0x0201, 0x0402, 0x0603, 0x0823, 0x0a04, 0x1026, 0x1205, 0x142a, - 0x1606, 0x1866, 0x1a07, 0x1c08, 0x1e09, 0x202c, 0x220a, 0x240b, - 0x260c, 0x2821, 0x2a0d, 0x3029, 0x3824, 0x3a0e, 0x3c0f, 0x3e31, - 0x402b, 0x4410, 0x4611, 0x482e, 0x4e12, 0x502d, 0x5841, 0x6038, - 0x6434, 0x6627, 0x6833, 0x6a13, 0x6c14, 0x7035, 0x7215, 0x783c, - 0x7a16, 0x8042, 0x883e, 0x8c32, 0x9045, 0x9444, 0x9840, 0xa847, - 0xac99, 0xb508, 0xb93b, 0xc03d, 0xc837, 0xd0c3, 0xd839, 0xe046, - 0xe8a5, 0xf051, 0xf848, 0x0859, 0x10ac, 0x184b, 0x1c17, 0x1e18, - // Entry 40 - 7F - 0x20b2, 0x2219, 0x291f, 0x2c1a, 0x2e1b, 0x3050, 0x341c, 0x361d, - 0x3852, 0x3d2d, 0x445b, 0x4c49, 0x5453, 0x5ca7, 0x5f5e, 0x644c, - 0x684a, 0x704f, 0x7855, 0x7e8f, 0x8058, 0x885c, 0x965d, 0x983a, - 0xa062, 0xa863, 0xac64, 0xb468, 0xbd19, 0xc485, 0xcc6e, 0xce6e, - 0xd06c, 0xd269, 0xd475, 0xdc73, 0xde87, 0xe472, 0xec71, 0xf030, - 0xf278, 0xf477, 0xfc7d, 0x04e4, 0x0920, 0x0c61, 0x1479, 0x187c, - 0x1c82, 0x26ec, 0x285f, 0x2c5e, 0x305f, 0x407f, 0x4880, 0x50a6, - 0x5886, 0x6081, 0x687b, 0x7084, 0x7889, 0x8088, 0x8883, 0x908b, - // Entry 80 - BF - 0x9890, 0x9c8d, 0xa137, 0xa88e, 0xb08c, 0xb891, 0xc09c, 0xc898, - 0xd094, 0xd89b, 0xe09a, 0xe895, 0xf096, 0xf89d, 0x004e, 0x089f, - 0x10a1, 0x1cad, 0x20a0, 0x28a3, 0x30a9, 0x34aa, 0x3cab, 0x42a4, - 0x44ae, 0x461e, 0x4caf, 0x54b4, 0x58b7, 0x5cb3, 0x64b8, 0x6cb1, - 0x70b5, 0x74b6, 0x7cc5, 0x84be, 0x8ccd, 0x94cf, 0x9ccc, 0xa4c2, - 0xacca, 0xb4c7, 0xbcc8, 0xc0cb, 0xc8ce, 0xd8ba, 0xe0c4, 0xe4bb, - 0xe6bc, 0xe8c9, 0xf0b9, 0xf8d0, 0x00e0, 0x08d1, 0x10dc, 0x18da, - 0x20d8, 0x2428, 0x265a, 0x2a2f, 0x2d1a, 0x2e3f, 0x30dd, 0x38d2, - // Entry C0 - FF - 0x493e, 0x54df, 0x5cd7, 0x64d3, 0x6cd5, 0x74de, 0x7cd4, 0x84d9, - 0x88c6, 0x8b32, 0x8e74, 0x90bf, 0x92ef, 0x94e7, 0x9ee1, 0xace5, - 0xb0f0, 0xb8e3, 0xc0e6, 0xc8ea, 0xd0e8, 0xd8ed, 0xe08a, 0xe525, - 0xeceb, 0xf4f2, 0xfd01, 0x0503, 0x0705, 0x0d06, 0x183b, 0x1d0d, - 0x26a8, 0x2825, 0x2cb0, 0x2ebd, 0x34e9, 0x3d38, 0x4512, 0x4d17, - 0x5507, 0x5d13, 0x6104, 0x6509, 0x6d11, 0x7d0c, 0x7f10, 0x813d, - 0x830e, 0x8514, 0x8d60, 0x9963, 0xa15c, 0xa86d, 0xb116, 0xb30a, - 0xb86b, 0xc10a, 0xc915, 0xd10f, 0xd91c, 0xe10b, 0xe84d, 0xf11b, - // Entry 100 - 13F - 0xf523, 0xf922, 0x0121, 0x0924, 0x1128, 0x192b, 0x2022, 0x2927, - 0x312a, 0x3726, 0x391e, 0x3d2c, 0x4130, 0x492f, 0x4ec1, 0x5518, - 0x646a, 0x747a, 0x7e7e, 0x809e, 0x8297, 0x852e, 0x9134, 0xa53c, - 0xac36, 0xb535, 0xb936, 0xbd3a, 0xd93f, 0xe541, 0xed5d, 0xef5d, - 0xf656, 0xfd61, 0x7c1f, 0x7ef3, 0x80f4, 0x82f5, 0x84f6, 0x86f7, - 0x88f8, 0x8af9, 0x8cfa, 0x8e6f, 0x90fc, 0x92fd, 0x94fe, 0x96ff, - 0x9900, 0x9b42, 0x9d43, 0x9f44, 0xa145, 0xa346, 0xa547, 0xa748, - 0xa949, 0xab4a, 0xad4b, 0xaf4c, 0xb14d, 0xb34e, 0xb54f, 0xb750, - // Entry 140 - 17F - 0xb951, 0xbb52, 0xbd53, 0xbf54, 0xc155, 0xc356, 0xc557, 0xc758, - 0xc959, 0xcb5a, 0xcd5b, 0xcf64, -} - -// Size: 1463 bytes -var variantIndex = map[string]uint8{ - "1606nict": 0x0, - "1694acad": 0x1, - "1901": 0x2, - "1959acad": 0x3, - "1994": 0x45, - "1996": 0x4, - "abl1943": 0x5, - "alalc97": 0x47, - "aluku": 0x6, - "ao1990": 0x7, - "arevela": 0x8, - "arevmda": 0x9, - "baku1926": 0xa, - "balanka": 0xb, - "barla": 0xc, - "basiceng": 0xd, - "bauddha": 0xe, - "biscayan": 0xf, - "biske": 0x40, - "bohoric": 0x10, - "boont": 0x11, - "colb1945": 0x12, - "cornu": 0x13, - "dajnko": 0x14, - "ekavsk": 0x15, - "emodeng": 0x16, - "fonipa": 0x48, - "fonnapa": 0x49, - "fonupa": 0x4a, - "fonxsamp": 0x4b, - "hepburn": 0x17, - "heploc": 0x46, - "hognorsk": 0x18, - "ijekavsk": 0x19, - "itihasa": 0x1a, - "jauer": 0x1b, - "jyutping": 0x1c, - "kkcor": 0x1d, - "kociewie": 0x1e, - "kscor": 0x1f, - "laukika": 0x20, - "lipaw": 0x41, - "luna1918": 0x21, - "metelko": 0x22, - "monoton": 0x23, - "ndyuka": 0x24, - "nedis": 0x25, - "newfound": 0x26, - "njiva": 0x42, - "nulik": 0x27, - "osojs": 0x43, - "oxendict": 0x28, - "pamaka": 0x29, - "petr1708": 0x2a, - "pinyin": 0x2b, - "polyton": 0x2c, - "puter": 0x2d, - "rigik": 0x2e, - "rozaj": 0x2f, - "rumgr": 0x30, - "scotland": 0x31, - "scouse": 0x32, - "simple": 0x4c, - "solba": 0x44, - "sotav": 0x33, - "surmiran": 0x34, - "sursilv": 0x35, - "sutsilv": 0x36, - "tarask": 0x37, - "uccor": 0x38, - "ucrcor": 0x39, - "ulster": 0x3a, - "unifon": 0x3b, - "vaidika": 0x3c, - "valencia": 0x3d, - "vallader": 0x3e, - "wadegile": 0x3f, -} - -// variantNumSpecialized is the number of specialized variants in variants. -const variantNumSpecialized = 71 - -// nRegionGroups is the number of region groups. -const nRegionGroups = 32 - -type likelyLangRegion struct { - lang uint16 - region uint16 -} - -// likelyScript is a lookup table, indexed by scriptID, for the most likely -// languages and regions given a script. -// Size: 928 bytes, 232 elements -var likelyScript = [232]likelyLangRegion{ - 1: {lang: 0x14d, region: 0x83}, - 3: {lang: 0x2a0, region: 0x105}, - 4: {lang: 0x1f, region: 0x98}, - 5: {lang: 0x3a, region: 0x6a}, - 7: {lang: 0x3b, region: 0x9b}, - 8: {lang: 0x1d5, region: 0x27}, - 9: {lang: 0x13, region: 0x9b}, - 10: {lang: 0x5b, region: 0x94}, - 11: {lang: 0x60, region: 0x51}, - 12: {lang: 0xb9, region: 0xb3}, - 13: {lang: 0x63, region: 0x94}, - 14: {lang: 0xa5, region: 0x34}, - 15: {lang: 0x3e7, region: 0x98}, - 17: {lang: 0x527, region: 0x12d}, - 18: {lang: 0x3af, region: 0x98}, - 19: {lang: 0x15d, region: 0x77}, - 20: {lang: 0xc2, region: 0x94}, - 21: {lang: 0x9d, region: 0xe6}, - 22: {lang: 0xdb, region: 0x34}, - 23: {lang: 0xf2, region: 0x48}, - 24: {lang: 0x4ee, region: 0x12a}, - 25: {lang: 0xe7, region: 0x13d}, - 26: {lang: 0xe5, region: 0x134}, - 28: {lang: 0xf0, region: 0x6a}, - 29: {lang: 0x19e, region: 0x5c}, - 30: {lang: 0x3e0, region: 0x105}, - 32: {lang: 0x1bc, region: 0x98}, - 34: {lang: 0x15d, region: 0x77}, - 37: {lang: 0x132, region: 0x6a}, - 38: {lang: 0x42f, region: 0x26}, - 39: {lang: 0x27, region: 0x6e}, - 41: {lang: 0x20e, region: 0x7c}, - 42: {lang: 0xfd, region: 0x37}, - 43: {lang: 0x19c, region: 0x12f}, - 44: {lang: 0x3e7, region: 0x98}, - 45: {lang: 0x135, region: 0x86}, - 46: {lang: 0x1a2, region: 0x98}, - 47: {lang: 0x39b, region: 0x98}, - 48: {lang: 0x527, region: 0x12d}, - 49: {lang: 0x252, region: 0xaa}, - 50: {lang: 0x527, region: 0x52}, - 51: {lang: 0x1c9, region: 0xe6}, - 52: {lang: 0x527, region: 0x52}, - 53: {lang: 0x527, region: 0x12d}, - 54: {lang: 0x2fb, region: 0x9a}, - 55: {lang: 0x1ba, region: 0x96}, - 56: {lang: 0x1fe, region: 0xa1}, - 57: {lang: 0x1c3, region: 0x12a}, - 58: {lang: 0x1c8, region: 0xae}, - 60: {lang: 0x1d3, region: 0x91}, - 62: {lang: 0x141, region: 0x9d}, - 63: {lang: 0x252, region: 0xaa}, - 64: {lang: 0x20c, region: 0x94}, - 65: {lang: 0x1fe, region: 0xa1}, - 67: {lang: 0x134, region: 0xc3}, - 68: {lang: 0x1fe, region: 0xa1}, - 69: {lang: 0x3b9, region: 0xe7}, - 70: {lang: 0x248, region: 0xa5}, - 71: {lang: 0x3f8, region: 0x98}, - 74: {lang: 0x24f, region: 0x98}, - 75: {lang: 0x252, region: 0xaa}, - 77: {lang: 0x88, region: 0x98}, - 78: {lang: 0x36e, region: 0x122}, - 79: {lang: 0x2b6, region: 0xae}, - 84: {lang: 0x29d, region: 0x98}, - 85: {lang: 0x2a6, region: 0x98}, - 86: {lang: 0x28d, region: 0x86}, - 87: {lang: 0x19e, region: 0x86}, - 88: {lang: 0x2aa, region: 0x52}, - 90: {lang: 0x4f2, region: 0x12a}, - 91: {lang: 0x4f3, region: 0x12a}, - 92: {lang: 0x1bc, region: 0x98}, - 93: {lang: 0x335, region: 0x9b}, - 94: {lang: 0x4f5, region: 0x52}, - 95: {lang: 0xa9, region: 0x52}, - 97: {lang: 0x2e6, region: 0x111}, - 98: {lang: 0x4f6, region: 0x10a}, - 99: {lang: 0x4f6, region: 0x10a}, - 100: {lang: 0x302, region: 0x98}, - 101: {lang: 0x319, region: 0x98}, - 102: {lang: 0x309, region: 0x52}, - 104: {lang: 0x31c, region: 0x34}, - 105: {lang: 0x30c, region: 0x98}, - 106: {lang: 0x412, region: 0xe7}, - 107: {lang: 0x32f, region: 0xc3}, - 108: {lang: 0x4f7, region: 0x107}, - 109: {lang: 0x3b, region: 0xa0}, - 110: {lang: 0x351, region: 0xda}, - 112: {lang: 0x2ce, region: 0x83}, - 114: {lang: 0x401, region: 0x95}, - 115: {lang: 0x3ec, region: 0x98}, - 116: {lang: 0x399, region: 0xc4}, - 117: {lang: 0x393, region: 0x98}, - 118: {lang: 0x397, region: 0x134}, - 119: {lang: 0x427, region: 0x114}, - 120: {lang: 0x3b, region: 0x11b}, - 121: {lang: 0xfc, region: 0xc3}, - 122: {lang: 0x27b, region: 0x105}, - 123: {lang: 0x2c7, region: 0x52}, - 124: {lang: 0x39d, region: 0x9b}, - 125: {lang: 0x39d, region: 0x52}, - 127: {lang: 0x3ab, region: 0xaf}, - 129: {lang: 0x1c4, region: 0x52}, - 130: {lang: 0x4fb, region: 0x9b}, - 181: {lang: 0x3c9, region: 0x94}, - 183: {lang: 0x370, region: 0x10b}, - 184: {lang: 0x41e, region: 0x96}, - 186: {lang: 0x4fd, region: 0x15d}, - 187: {lang: 0x3ee, region: 0x98}, - 188: {lang: 0x45, region: 0x134}, - 189: {lang: 0x138, region: 0x7a}, - 190: {lang: 0x3e7, region: 0x98}, - 191: {lang: 0x3e7, region: 0x98}, - 192: {lang: 0x3f8, region: 0x98}, - 193: {lang: 0x40a, region: 0xb2}, - 194: {lang: 0x431, region: 0x98}, - 195: {lang: 0x43c, region: 0x94}, - 196: {lang: 0x44b, region: 0x34}, - 197: {lang: 0x44c, region: 0x9a}, - 201: {lang: 0x458, region: 0xe6}, - 202: {lang: 0x119, region: 0x98}, - 203: {lang: 0x45c, region: 0x52}, - 204: {lang: 0x230, region: 0x52}, - 205: {lang: 0x44e, region: 0x98}, - 206: {lang: 0x4a3, region: 0x52}, - 207: {lang: 0x9f, region: 0x13d}, - 208: {lang: 0x45f, region: 0x98}, - 210: {lang: 0x526, region: 0xb9}, - 211: {lang: 0x152, region: 0xe6}, - 212: {lang: 0x127, region: 0xcc}, - 213: {lang: 0x469, region: 0x122}, - 214: {lang: 0xa9, region: 0x52}, - 215: {lang: 0x2cc, region: 0x98}, - 216: {lang: 0x4ab, region: 0x11b}, - 217: {lang: 0x4bc, region: 0xb3}, - 219: {lang: 0x1cc, region: 0x98}, - 221: {lang: 0x3a7, region: 0x9b}, - 222: {lang: 0x22, region: 0x9a}, - 223: {lang: 0x1e8, region: 0x52}, -} - -type likelyScriptRegion struct { - region uint16 - script uint8 - flags uint8 -} - -// likelyLang is a lookup table, indexed by langID, for the most likely -// scripts and regions given incomplete information. If more entries exist for a -// given language, region and script are the index and size respectively -// of the list in likelyLangList. -// Size: 5308 bytes, 1327 elements -var likelyLang = [1327]likelyScriptRegion{ - 0: {region: 0x134, script: 0x52, flags: 0x0}, - 1: {region: 0x6e, script: 0x52, flags: 0x0}, - 2: {region: 0x164, script: 0x52, flags: 0x0}, - 3: {region: 0x164, script: 0x52, flags: 0x0}, - 4: {region: 0x164, script: 0x52, flags: 0x0}, - 5: {region: 0x7c, script: 0x1e, flags: 0x0}, - 6: {region: 0x164, script: 0x52, flags: 0x0}, - 7: {region: 0x164, script: 0x1e, flags: 0x0}, - 8: {region: 0x7f, script: 0x52, flags: 0x0}, - 9: {region: 0x164, script: 0x52, flags: 0x0}, - 10: {region: 0x164, script: 0x52, flags: 0x0}, - 11: {region: 0x164, script: 0x52, flags: 0x0}, - 12: {region: 0x94, script: 0x52, flags: 0x0}, - 13: {region: 0x130, script: 0x52, flags: 0x0}, - 14: {region: 0x7f, script: 0x52, flags: 0x0}, - 15: {region: 0x164, script: 0x52, flags: 0x0}, - 16: {region: 0x164, script: 0x52, flags: 0x0}, - 17: {region: 0x105, script: 0x1e, flags: 0x0}, - 18: {region: 0x164, script: 0x52, flags: 0x0}, - 19: {region: 0x9b, script: 0x9, flags: 0x0}, - 20: {region: 0x127, script: 0x5, flags: 0x0}, - 21: {region: 0x164, script: 0x52, flags: 0x0}, - 22: {region: 0x160, script: 0x52, flags: 0x0}, - 23: {region: 0x164, script: 0x52, flags: 0x0}, - 24: {region: 0x164, script: 0x52, flags: 0x0}, - 25: {region: 0x164, script: 0x52, flags: 0x0}, - 26: {region: 0x164, script: 0x52, flags: 0x0}, - 27: {region: 0x164, script: 0x52, flags: 0x0}, - 28: {region: 0x51, script: 0x52, flags: 0x0}, - 29: {region: 0x164, script: 0x52, flags: 0x0}, - 30: {region: 0x164, script: 0x52, flags: 0x0}, - 31: {region: 0x98, script: 0x4, flags: 0x0}, - 32: {region: 0x164, script: 0x52, flags: 0x0}, - 33: {region: 0x7f, script: 0x52, flags: 0x0}, - 34: {region: 0x9a, script: 0xde, flags: 0x0}, - 35: {region: 0x164, script: 0x52, flags: 0x0}, - 36: {region: 0x164, script: 0x52, flags: 0x0}, - 37: {region: 0x14c, script: 0x52, flags: 0x0}, - 38: {region: 0x105, script: 0x1e, flags: 0x0}, - 39: {region: 0x6e, script: 0x27, flags: 0x0}, - 40: {region: 0x164, script: 0x52, flags: 0x0}, - 41: {region: 0x164, script: 0x52, flags: 0x0}, - 42: {region: 0xd5, script: 0x52, flags: 0x0}, - 43: {region: 0x164, script: 0x52, flags: 0x0}, - 45: {region: 0x164, script: 0x52, flags: 0x0}, - 46: {region: 0x164, script: 0x52, flags: 0x0}, - 47: {region: 0x164, script: 0x52, flags: 0x0}, - 48: {region: 0x164, script: 0x52, flags: 0x0}, - 49: {region: 0x164, script: 0x52, flags: 0x0}, - 50: {region: 0x164, script: 0x52, flags: 0x0}, - 51: {region: 0x94, script: 0x52, flags: 0x0}, - 52: {region: 0x164, script: 0x5, flags: 0x0}, - 53: {region: 0x121, script: 0x5, flags: 0x0}, - 54: {region: 0x164, script: 0x52, flags: 0x0}, - 55: {region: 0x164, script: 0x52, flags: 0x0}, - 56: {region: 0x164, script: 0x52, flags: 0x0}, - 57: {region: 0x164, script: 0x52, flags: 0x0}, - 58: {region: 0x6a, script: 0x5, flags: 0x0}, - 59: {region: 0x0, script: 0x3, flags: 0x1}, - 60: {region: 0x164, script: 0x52, flags: 0x0}, - 61: {region: 0x50, script: 0x52, flags: 0x0}, - 62: {region: 0x3e, script: 0x52, flags: 0x0}, - 63: {region: 0x66, script: 0x5, flags: 0x0}, - 65: {region: 0xb9, script: 0x5, flags: 0x0}, - 66: {region: 0x6a, script: 0x5, flags: 0x0}, - 67: {region: 0x98, script: 0xe, flags: 0x0}, - 68: {region: 0x12e, script: 0x52, flags: 0x0}, - 69: {region: 0x134, script: 0xbc, flags: 0x0}, - 70: {region: 0x164, script: 0x52, flags: 0x0}, - 71: {region: 0x164, script: 0x52, flags: 0x0}, - 72: {region: 0x6d, script: 0x52, flags: 0x0}, - 73: {region: 0x164, script: 0x52, flags: 0x0}, - 74: {region: 0x164, script: 0x52, flags: 0x0}, - 75: {region: 0x48, script: 0x52, flags: 0x0}, - 76: {region: 0x164, script: 0x52, flags: 0x0}, - 77: {region: 0x105, script: 0x1e, flags: 0x0}, - 78: {region: 0x164, script: 0x5, flags: 0x0}, - 79: {region: 0x164, script: 0x52, flags: 0x0}, - 80: {region: 0x164, script: 0x52, flags: 0x0}, - 81: {region: 0x164, script: 0x52, flags: 0x0}, - 82: {region: 0x98, script: 0x20, flags: 0x0}, - 83: {region: 0x164, script: 0x52, flags: 0x0}, - 84: {region: 0x164, script: 0x52, flags: 0x0}, - 85: {region: 0x164, script: 0x52, flags: 0x0}, - 86: {region: 0x3e, script: 0x52, flags: 0x0}, - 87: {region: 0x164, script: 0x52, flags: 0x0}, - 88: {region: 0x3, script: 0x5, flags: 0x1}, - 89: {region: 0x105, script: 0x1e, flags: 0x0}, - 90: {region: 0xe7, script: 0x5, flags: 0x0}, - 91: {region: 0x94, script: 0x52, flags: 0x0}, - 92: {region: 0xda, script: 0x20, flags: 0x0}, - 93: {region: 0x2d, script: 0x52, flags: 0x0}, - 94: {region: 0x51, script: 0x52, flags: 0x0}, - 95: {region: 0x164, script: 0x52, flags: 0x0}, - 96: {region: 0x51, script: 0xb, flags: 0x0}, - 97: {region: 0x164, script: 0x52, flags: 0x0}, - 98: {region: 0x164, script: 0x52, flags: 0x0}, - 99: {region: 0x94, script: 0x52, flags: 0x0}, - 100: {region: 0x164, script: 0x52, flags: 0x0}, - 101: {region: 0x51, script: 0x52, flags: 0x0}, - 102: {region: 0x164, script: 0x52, flags: 0x0}, - 103: {region: 0x164, script: 0x52, flags: 0x0}, - 104: {region: 0x164, script: 0x52, flags: 0x0}, - 105: {region: 0x164, script: 0x52, flags: 0x0}, - 106: {region: 0x4e, script: 0x52, flags: 0x0}, - 107: {region: 0x164, script: 0x52, flags: 0x0}, - 108: {region: 0x164, script: 0x52, flags: 0x0}, - 109: {region: 0x164, script: 0x52, flags: 0x0}, - 110: {region: 0x164, script: 0x27, flags: 0x0}, - 111: {region: 0x164, script: 0x52, flags: 0x0}, - 112: {region: 0x164, script: 0x52, flags: 0x0}, - 113: {region: 0x46, script: 0x1e, flags: 0x0}, - 114: {region: 0x164, script: 0x52, flags: 0x0}, - 115: {region: 0x164, script: 0x52, flags: 0x0}, - 116: {region: 0x10a, script: 0x5, flags: 0x0}, - 117: {region: 0x161, script: 0x52, flags: 0x0}, - 118: {region: 0x164, script: 0x52, flags: 0x0}, - 119: {region: 0x94, script: 0x52, flags: 0x0}, - 120: {region: 0x164, script: 0x52, flags: 0x0}, - 121: {region: 0x12e, script: 0x52, flags: 0x0}, - 122: {region: 0x51, script: 0x52, flags: 0x0}, - 123: {region: 0x98, script: 0xcd, flags: 0x0}, - 124: {region: 0xe7, script: 0x5, flags: 0x0}, - 125: {region: 0x98, script: 0x20, flags: 0x0}, - 126: {region: 0x37, script: 0x1e, flags: 0x0}, - 127: {region: 0x98, script: 0x20, flags: 0x0}, - 128: {region: 0xe7, script: 0x5, flags: 0x0}, - 129: {region: 0x12a, script: 0x2d, flags: 0x0}, - 131: {region: 0x98, script: 0x20, flags: 0x0}, - 132: {region: 0x164, script: 0x52, flags: 0x0}, - 133: {region: 0x98, script: 0x20, flags: 0x0}, - 134: {region: 0xe6, script: 0x52, flags: 0x0}, - 135: {region: 0x164, script: 0x52, flags: 0x0}, - 136: {region: 0x98, script: 0x20, flags: 0x0}, - 137: {region: 0x164, script: 0x52, flags: 0x0}, - 138: {region: 0x13e, script: 0x52, flags: 0x0}, - 139: {region: 0x164, script: 0x52, flags: 0x0}, - 140: {region: 0x164, script: 0x52, flags: 0x0}, - 141: {region: 0xe6, script: 0x52, flags: 0x0}, - 142: {region: 0x164, script: 0x52, flags: 0x0}, - 143: {region: 0xd5, script: 0x52, flags: 0x0}, - 144: {region: 0x164, script: 0x52, flags: 0x0}, - 145: {region: 0x164, script: 0x52, flags: 0x0}, - 146: {region: 0x164, script: 0x52, flags: 0x0}, - 147: {region: 0x164, script: 0x27, flags: 0x0}, - 148: {region: 0x98, script: 0x20, flags: 0x0}, - 149: {region: 0x94, script: 0x52, flags: 0x0}, - 150: {region: 0x164, script: 0x52, flags: 0x0}, - 151: {region: 0x164, script: 0x52, flags: 0x0}, - 152: {region: 0x113, script: 0x52, flags: 0x0}, - 153: {region: 0x164, script: 0x52, flags: 0x0}, - 154: {region: 0x164, script: 0x52, flags: 0x0}, - 155: {region: 0x51, script: 0x52, flags: 0x0}, - 156: {region: 0x164, script: 0x52, flags: 0x0}, - 157: {region: 0xe6, script: 0x52, flags: 0x0}, - 158: {region: 0x164, script: 0x52, flags: 0x0}, - 159: {region: 0x13d, script: 0xcf, flags: 0x0}, - 160: {region: 0xc2, script: 0x52, flags: 0x0}, - 161: {region: 0x164, script: 0x52, flags: 0x0}, - 162: {region: 0x164, script: 0x52, flags: 0x0}, - 163: {region: 0xc2, script: 0x52, flags: 0x0}, - 164: {region: 0x164, script: 0x52, flags: 0x0}, - 165: {region: 0x34, script: 0xe, flags: 0x0}, - 166: {region: 0x164, script: 0x52, flags: 0x0}, - 167: {region: 0x164, script: 0x52, flags: 0x0}, - 168: {region: 0x164, script: 0x52, flags: 0x0}, - 169: {region: 0x52, script: 0xd6, flags: 0x0}, - 170: {region: 0x164, script: 0x52, flags: 0x0}, - 171: {region: 0x164, script: 0x52, flags: 0x0}, - 172: {region: 0x164, script: 0x52, flags: 0x0}, - 173: {region: 0x98, script: 0xe, flags: 0x0}, - 174: {region: 0x164, script: 0x52, flags: 0x0}, - 175: {region: 0x9b, script: 0x5, flags: 0x0}, - 176: {region: 0x164, script: 0x52, flags: 0x0}, - 177: {region: 0x4e, script: 0x52, flags: 0x0}, - 178: {region: 0x77, script: 0x52, flags: 0x0}, - 179: {region: 0x98, script: 0x20, flags: 0x0}, - 180: {region: 0xe7, script: 0x5, flags: 0x0}, - 181: {region: 0x98, script: 0x20, flags: 0x0}, - 182: {region: 0x164, script: 0x52, flags: 0x0}, - 183: {region: 0x32, script: 0x52, flags: 0x0}, - 184: {region: 0x164, script: 0x52, flags: 0x0}, - 185: {region: 0xb3, script: 0xc, flags: 0x0}, - 186: {region: 0x51, script: 0x52, flags: 0x0}, - 187: {region: 0x164, script: 0x27, flags: 0x0}, - 188: {region: 0xe6, script: 0x52, flags: 0x0}, - 189: {region: 0x164, script: 0x52, flags: 0x0}, - 190: {region: 0xe7, script: 0x20, flags: 0x0}, - 191: {region: 0x105, script: 0x1e, flags: 0x0}, - 192: {region: 0x15e, script: 0x52, flags: 0x0}, - 193: {region: 0x164, script: 0x52, flags: 0x0}, - 194: {region: 0x94, script: 0x52, flags: 0x0}, - 195: {region: 0x164, script: 0x52, flags: 0x0}, - 196: {region: 0x51, script: 0x52, flags: 0x0}, - 197: {region: 0x164, script: 0x52, flags: 0x0}, - 198: {region: 0x164, script: 0x52, flags: 0x0}, - 199: {region: 0x164, script: 0x52, flags: 0x0}, - 200: {region: 0x85, script: 0x52, flags: 0x0}, - 201: {region: 0x164, script: 0x52, flags: 0x0}, - 202: {region: 0x164, script: 0x52, flags: 0x0}, - 203: {region: 0x164, script: 0x52, flags: 0x0}, - 204: {region: 0x164, script: 0x52, flags: 0x0}, - 205: {region: 0x6c, script: 0x27, flags: 0x0}, - 206: {region: 0x164, script: 0x52, flags: 0x0}, - 207: {region: 0x164, script: 0x52, flags: 0x0}, - 208: {region: 0x51, script: 0x52, flags: 0x0}, - 209: {region: 0x164, script: 0x52, flags: 0x0}, - 210: {region: 0x164, script: 0x52, flags: 0x0}, - 211: {region: 0xc2, script: 0x52, flags: 0x0}, - 212: {region: 0x164, script: 0x52, flags: 0x0}, - 213: {region: 0x164, script: 0x52, flags: 0x0}, - 214: {region: 0x164, script: 0x52, flags: 0x0}, - 215: {region: 0x6d, script: 0x52, flags: 0x0}, - 216: {region: 0x164, script: 0x52, flags: 0x0}, - 217: {region: 0x164, script: 0x52, flags: 0x0}, - 218: {region: 0xd5, script: 0x52, flags: 0x0}, - 219: {region: 0x34, script: 0x16, flags: 0x0}, - 220: {region: 0x105, script: 0x1e, flags: 0x0}, - 221: {region: 0xe6, script: 0x52, flags: 0x0}, - 222: {region: 0x164, script: 0x52, flags: 0x0}, - 223: {region: 0x130, script: 0x52, flags: 0x0}, - 224: {region: 0x89, script: 0x52, flags: 0x0}, - 225: {region: 0x74, script: 0x52, flags: 0x0}, - 226: {region: 0x105, script: 0x1e, flags: 0x0}, - 227: {region: 0x134, script: 0x52, flags: 0x0}, - 228: {region: 0x48, script: 0x52, flags: 0x0}, - 229: {region: 0x134, script: 0x1a, flags: 0x0}, - 230: {region: 0xa5, script: 0x5, flags: 0x0}, - 231: {region: 0x13d, script: 0x19, flags: 0x0}, - 232: {region: 0x164, script: 0x52, flags: 0x0}, - 233: {region: 0x9a, script: 0x5, flags: 0x0}, - 234: {region: 0x164, script: 0x52, flags: 0x0}, - 235: {region: 0x164, script: 0x52, flags: 0x0}, - 236: {region: 0x164, script: 0x52, flags: 0x0}, - 237: {region: 0x164, script: 0x52, flags: 0x0}, - 238: {region: 0x164, script: 0x52, flags: 0x0}, - 239: {region: 0x77, script: 0x52, flags: 0x0}, - 240: {region: 0x6a, script: 0x1c, flags: 0x0}, - 241: {region: 0xe6, script: 0x52, flags: 0x0}, - 242: {region: 0x48, script: 0x17, flags: 0x0}, - 243: {region: 0x12f, script: 0x1e, flags: 0x0}, - 244: {region: 0x48, script: 0x17, flags: 0x0}, - 245: {region: 0x48, script: 0x17, flags: 0x0}, - 246: {region: 0x48, script: 0x17, flags: 0x0}, - 247: {region: 0x48, script: 0x17, flags: 0x0}, - 248: {region: 0x109, script: 0x52, flags: 0x0}, - 249: {region: 0x5d, script: 0x52, flags: 0x0}, - 250: {region: 0xe8, script: 0x52, flags: 0x0}, - 251: {region: 0x48, script: 0x17, flags: 0x0}, - 252: {region: 0xc3, script: 0x79, flags: 0x0}, - 253: {region: 0x8, script: 0x2, flags: 0x1}, - 254: {region: 0x105, script: 0x1e, flags: 0x0}, - 255: {region: 0x7a, script: 0x52, flags: 0x0}, - 256: {region: 0x62, script: 0x52, flags: 0x0}, - 257: {region: 0x164, script: 0x52, flags: 0x0}, - 258: {region: 0x164, script: 0x52, flags: 0x0}, - 259: {region: 0x164, script: 0x52, flags: 0x0}, - 260: {region: 0x164, script: 0x52, flags: 0x0}, - 261: {region: 0x134, script: 0x52, flags: 0x0}, - 262: {region: 0x105, script: 0x1e, flags: 0x0}, - 263: {region: 0xa3, script: 0x52, flags: 0x0}, - 264: {region: 0x164, script: 0x52, flags: 0x0}, - 265: {region: 0x164, script: 0x52, flags: 0x0}, - 266: {region: 0x98, script: 0x5, flags: 0x0}, - 267: {region: 0x164, script: 0x52, flags: 0x0}, - 268: {region: 0x5f, script: 0x52, flags: 0x0}, - 269: {region: 0x164, script: 0x52, flags: 0x0}, - 270: {region: 0x48, script: 0x52, flags: 0x0}, - 271: {region: 0x164, script: 0x52, flags: 0x0}, - 272: {region: 0x164, script: 0x52, flags: 0x0}, - 273: {region: 0x164, script: 0x52, flags: 0x0}, - 274: {region: 0x164, script: 0x5, flags: 0x0}, - 275: {region: 0x48, script: 0x52, flags: 0x0}, - 276: {region: 0x164, script: 0x52, flags: 0x0}, - 277: {region: 0x164, script: 0x52, flags: 0x0}, - 278: {region: 0xd3, script: 0x52, flags: 0x0}, - 279: {region: 0x4e, script: 0x52, flags: 0x0}, - 280: {region: 0x164, script: 0x52, flags: 0x0}, - 281: {region: 0x98, script: 0x5, flags: 0x0}, - 282: {region: 0x164, script: 0x52, flags: 0x0}, - 283: {region: 0x164, script: 0x52, flags: 0x0}, - 284: {region: 0x164, script: 0x52, flags: 0x0}, - 285: {region: 0x164, script: 0x27, flags: 0x0}, - 286: {region: 0x5f, script: 0x52, flags: 0x0}, - 287: {region: 0xc2, script: 0x52, flags: 0x0}, - 288: {region: 0xcf, script: 0x52, flags: 0x0}, - 289: {region: 0x164, script: 0x52, flags: 0x0}, - 290: {region: 0xda, script: 0x20, flags: 0x0}, - 291: {region: 0x51, script: 0x52, flags: 0x0}, - 292: {region: 0x164, script: 0x52, flags: 0x0}, - 293: {region: 0x164, script: 0x52, flags: 0x0}, - 294: {region: 0x164, script: 0x52, flags: 0x0}, - 295: {region: 0xcc, script: 0xd4, flags: 0x0}, - 296: {region: 0x164, script: 0x52, flags: 0x0}, - 297: {region: 0x164, script: 0x52, flags: 0x0}, - 298: {region: 0x113, script: 0x52, flags: 0x0}, - 299: {region: 0x36, script: 0x52, flags: 0x0}, - 300: {region: 0x42, script: 0xd6, flags: 0x0}, - 301: {region: 0x164, script: 0x52, flags: 0x0}, - 302: {region: 0xa3, script: 0x52, flags: 0x0}, - 303: {region: 0x7f, script: 0x52, flags: 0x0}, - 304: {region: 0xd5, script: 0x52, flags: 0x0}, - 305: {region: 0x9d, script: 0x52, flags: 0x0}, - 306: {region: 0x6a, script: 0x25, flags: 0x0}, - 307: {region: 0x164, script: 0x52, flags: 0x0}, - 308: {region: 0xc3, script: 0x43, flags: 0x0}, - 309: {region: 0x86, script: 0x2d, flags: 0x0}, - 310: {region: 0x164, script: 0x52, flags: 0x0}, - 311: {region: 0x164, script: 0x52, flags: 0x0}, - 312: {region: 0xa, script: 0x2, flags: 0x1}, - 313: {region: 0x164, script: 0x52, flags: 0x0}, - 314: {region: 0x164, script: 0x52, flags: 0x0}, - 315: {region: 0x1, script: 0x52, flags: 0x0}, - 316: {region: 0x164, script: 0x52, flags: 0x0}, - 317: {region: 0x6d, script: 0x52, flags: 0x0}, - 318: {region: 0x134, script: 0x52, flags: 0x0}, - 319: {region: 0x69, script: 0x52, flags: 0x0}, - 320: {region: 0x164, script: 0x52, flags: 0x0}, - 321: {region: 0x9d, script: 0x3e, flags: 0x0}, - 322: {region: 0x164, script: 0x52, flags: 0x0}, - 323: {region: 0x164, script: 0x52, flags: 0x0}, - 324: {region: 0x6d, script: 0x52, flags: 0x0}, - 325: {region: 0x51, script: 0x52, flags: 0x0}, - 326: {region: 0x6d, script: 0x52, flags: 0x0}, - 327: {region: 0x9b, script: 0x5, flags: 0x0}, - 328: {region: 0x164, script: 0x52, flags: 0x0}, - 329: {region: 0x164, script: 0x52, flags: 0x0}, - 330: {region: 0x164, script: 0x52, flags: 0x0}, - 331: {region: 0x164, script: 0x52, flags: 0x0}, - 332: {region: 0x85, script: 0x52, flags: 0x0}, - 333: {region: 0xc, script: 0x2, flags: 0x1}, - 334: {region: 0x164, script: 0x52, flags: 0x0}, - 335: {region: 0xc2, script: 0x52, flags: 0x0}, - 336: {region: 0x71, script: 0x52, flags: 0x0}, - 337: {region: 0x10a, script: 0x5, flags: 0x0}, - 338: {region: 0xe6, script: 0x52, flags: 0x0}, - 339: {region: 0x10b, script: 0x52, flags: 0x0}, - 340: {region: 0x72, script: 0x52, flags: 0x0}, - 341: {region: 0x164, script: 0x52, flags: 0x0}, - 342: {region: 0x164, script: 0x52, flags: 0x0}, - 343: {region: 0x75, script: 0x52, flags: 0x0}, - 344: {region: 0x164, script: 0x52, flags: 0x0}, - 345: {region: 0x3a, script: 0x52, flags: 0x0}, - 346: {region: 0x164, script: 0x52, flags: 0x0}, - 347: {region: 0x164, script: 0x52, flags: 0x0}, - 348: {region: 0x164, script: 0x52, flags: 0x0}, - 349: {region: 0x77, script: 0x52, flags: 0x0}, - 350: {region: 0x134, script: 0x52, flags: 0x0}, - 351: {region: 0x77, script: 0x52, flags: 0x0}, - 352: {region: 0x5f, script: 0x52, flags: 0x0}, - 353: {region: 0x5f, script: 0x52, flags: 0x0}, - 354: {region: 0x51, script: 0x5, flags: 0x0}, - 355: {region: 0x13f, script: 0x52, flags: 0x0}, - 356: {region: 0x164, script: 0x52, flags: 0x0}, - 357: {region: 0x83, script: 0x52, flags: 0x0}, - 358: {region: 0x164, script: 0x52, flags: 0x0}, - 359: {region: 0xd3, script: 0x52, flags: 0x0}, - 360: {region: 0x9d, script: 0x52, flags: 0x0}, - 361: {region: 0xd5, script: 0x52, flags: 0x0}, - 362: {region: 0x164, script: 0x52, flags: 0x0}, - 363: {region: 0x10a, script: 0x52, flags: 0x0}, - 364: {region: 0xd8, script: 0x52, flags: 0x0}, - 365: {region: 0x95, script: 0x52, flags: 0x0}, - 366: {region: 0x7f, script: 0x52, flags: 0x0}, - 367: {region: 0x164, script: 0x52, flags: 0x0}, - 368: {region: 0xbb, script: 0x52, flags: 0x0}, - 369: {region: 0x164, script: 0x52, flags: 0x0}, - 370: {region: 0x164, script: 0x52, flags: 0x0}, - 371: {region: 0x164, script: 0x52, flags: 0x0}, - 372: {region: 0x52, script: 0x34, flags: 0x0}, - 373: {region: 0x164, script: 0x52, flags: 0x0}, - 374: {region: 0x94, script: 0x52, flags: 0x0}, - 375: {region: 0x164, script: 0x52, flags: 0x0}, - 376: {region: 0x98, script: 0x20, flags: 0x0}, - 377: {region: 0x164, script: 0x52, flags: 0x0}, - 378: {region: 0x9b, script: 0x5, flags: 0x0}, - 379: {region: 0x7d, script: 0x52, flags: 0x0}, - 380: {region: 0x7a, script: 0x52, flags: 0x0}, - 381: {region: 0x164, script: 0x52, flags: 0x0}, - 382: {region: 0x164, script: 0x52, flags: 0x0}, - 383: {region: 0x164, script: 0x52, flags: 0x0}, - 384: {region: 0x164, script: 0x52, flags: 0x0}, - 385: {region: 0x164, script: 0x52, flags: 0x0}, - 386: {region: 0x164, script: 0x52, flags: 0x0}, - 387: {region: 0x6e, script: 0x27, flags: 0x0}, - 388: {region: 0x164, script: 0x52, flags: 0x0}, - 389: {region: 0xda, script: 0x20, flags: 0x0}, - 390: {region: 0x164, script: 0x52, flags: 0x0}, - 391: {region: 0xa6, script: 0x52, flags: 0x0}, - 392: {region: 0x164, script: 0x52, flags: 0x0}, - 393: {region: 0xe7, script: 0x5, flags: 0x0}, - 394: {region: 0x164, script: 0x52, flags: 0x0}, - 395: {region: 0xe7, script: 0x5, flags: 0x0}, - 396: {region: 0x164, script: 0x52, flags: 0x0}, - 397: {region: 0x164, script: 0x52, flags: 0x0}, - 398: {region: 0x6d, script: 0x52, flags: 0x0}, - 399: {region: 0x9b, script: 0x5, flags: 0x0}, - 400: {region: 0x164, script: 0x52, flags: 0x0}, - 401: {region: 0x164, script: 0x27, flags: 0x0}, - 402: {region: 0xf0, script: 0x52, flags: 0x0}, - 403: {region: 0x164, script: 0x52, flags: 0x0}, - 404: {region: 0x164, script: 0x52, flags: 0x0}, - 405: {region: 0x164, script: 0x52, flags: 0x0}, - 406: {region: 0x164, script: 0x27, flags: 0x0}, - 407: {region: 0x164, script: 0x52, flags: 0x0}, - 408: {region: 0x98, script: 0x20, flags: 0x0}, - 409: {region: 0x98, script: 0xd0, flags: 0x0}, - 410: {region: 0x94, script: 0x52, flags: 0x0}, - 411: {region: 0xd8, script: 0x52, flags: 0x0}, - 412: {region: 0x12f, script: 0x2b, flags: 0x0}, - 413: {region: 0x164, script: 0x52, flags: 0x0}, - 414: {region: 0xe, script: 0x2, flags: 0x1}, - 415: {region: 0x98, script: 0xe, flags: 0x0}, - 416: {region: 0x164, script: 0x52, flags: 0x0}, - 417: {region: 0x4d, script: 0x52, flags: 0x0}, - 418: {region: 0x98, script: 0x2e, flags: 0x0}, - 419: {region: 0x40, script: 0x52, flags: 0x0}, - 420: {region: 0x53, script: 0x52, flags: 0x0}, - 421: {region: 0x164, script: 0x52, flags: 0x0}, - 422: {region: 0x7f, script: 0x52, flags: 0x0}, - 423: {region: 0x164, script: 0x52, flags: 0x0}, - 424: {region: 0x164, script: 0x52, flags: 0x0}, - 425: {region: 0xa3, script: 0x52, flags: 0x0}, - 426: {region: 0x97, script: 0x52, flags: 0x0}, - 427: {region: 0x164, script: 0x52, flags: 0x0}, - 428: {region: 0xda, script: 0x20, flags: 0x0}, - 429: {region: 0x164, script: 0x52, flags: 0x0}, - 430: {region: 0x164, script: 0x5, flags: 0x0}, - 431: {region: 0x48, script: 0x52, flags: 0x0}, - 432: {region: 0x164, script: 0x5, flags: 0x0}, - 433: {region: 0x164, script: 0x52, flags: 0x0}, - 434: {region: 0x10, script: 0x3, flags: 0x1}, - 435: {region: 0x164, script: 0x52, flags: 0x0}, - 436: {region: 0x52, script: 0x34, flags: 0x0}, - 437: {region: 0x164, script: 0x52, flags: 0x0}, - 438: {region: 0x134, script: 0x52, flags: 0x0}, - 439: {region: 0x23, script: 0x5, flags: 0x0}, - 440: {region: 0x164, script: 0x52, flags: 0x0}, - 441: {region: 0x164, script: 0x27, flags: 0x0}, - 442: {region: 0x96, script: 0x37, flags: 0x0}, - 443: {region: 0x164, script: 0x52, flags: 0x0}, - 444: {region: 0x98, script: 0x20, flags: 0x0}, - 445: {region: 0x164, script: 0x52, flags: 0x0}, - 446: {region: 0x72, script: 0x52, flags: 0x0}, - 447: {region: 0x164, script: 0x52, flags: 0x0}, - 448: {region: 0x164, script: 0x52, flags: 0x0}, - 449: {region: 0xe6, script: 0x52, flags: 0x0}, - 450: {region: 0x164, script: 0x52, flags: 0x0}, - 451: {region: 0x12a, script: 0x39, flags: 0x0}, - 452: {region: 0x52, script: 0x81, flags: 0x0}, - 453: {region: 0x164, script: 0x52, flags: 0x0}, - 454: {region: 0xe7, script: 0x5, flags: 0x0}, - 455: {region: 0x98, script: 0x20, flags: 0x0}, - 456: {region: 0xae, script: 0x3a, flags: 0x0}, - 457: {region: 0xe6, script: 0x52, flags: 0x0}, - 458: {region: 0xe7, script: 0x5, flags: 0x0}, - 459: {region: 0xe5, script: 0x52, flags: 0x0}, - 460: {region: 0x98, script: 0x20, flags: 0x0}, - 461: {region: 0x98, script: 0x20, flags: 0x0}, - 462: {region: 0x164, script: 0x52, flags: 0x0}, - 463: {region: 0x8f, script: 0x52, flags: 0x0}, - 464: {region: 0x5f, script: 0x52, flags: 0x0}, - 465: {region: 0x52, script: 0x34, flags: 0x0}, - 466: {region: 0x90, script: 0x52, flags: 0x0}, - 467: {region: 0x91, script: 0x52, flags: 0x0}, - 468: {region: 0x164, script: 0x52, flags: 0x0}, - 469: {region: 0x27, script: 0x8, flags: 0x0}, - 470: {region: 0xd1, script: 0x52, flags: 0x0}, - 471: {region: 0x77, script: 0x52, flags: 0x0}, - 472: {region: 0x164, script: 0x52, flags: 0x0}, - 473: {region: 0x164, script: 0x52, flags: 0x0}, - 474: {region: 0xcf, script: 0x52, flags: 0x0}, - 475: {region: 0xd5, script: 0x52, flags: 0x0}, - 476: {region: 0x164, script: 0x52, flags: 0x0}, - 477: {region: 0x164, script: 0x52, flags: 0x0}, - 478: {region: 0x164, script: 0x52, flags: 0x0}, - 479: {region: 0x94, script: 0x52, flags: 0x0}, - 480: {region: 0x164, script: 0x52, flags: 0x0}, - 481: {region: 0x164, script: 0x52, flags: 0x0}, - 482: {region: 0x164, script: 0x52, flags: 0x0}, - 484: {region: 0x121, script: 0x52, flags: 0x0}, - 485: {region: 0xd5, script: 0x52, flags: 0x0}, - 486: {region: 0x164, script: 0x52, flags: 0x0}, - 487: {region: 0x164, script: 0x52, flags: 0x0}, - 488: {region: 0x52, script: 0xdf, flags: 0x0}, - 489: {region: 0x164, script: 0x52, flags: 0x0}, - 490: {region: 0x134, script: 0x52, flags: 0x0}, - 491: {region: 0x164, script: 0x52, flags: 0x0}, - 492: {region: 0x48, script: 0x52, flags: 0x0}, - 493: {region: 0x164, script: 0x52, flags: 0x0}, - 494: {region: 0x164, script: 0x52, flags: 0x0}, - 495: {region: 0xe6, script: 0x52, flags: 0x0}, - 496: {region: 0x164, script: 0x52, flags: 0x0}, - 497: {region: 0x94, script: 0x52, flags: 0x0}, - 498: {region: 0x105, script: 0x1e, flags: 0x0}, - 500: {region: 0x164, script: 0x52, flags: 0x0}, - 501: {region: 0x164, script: 0x52, flags: 0x0}, - 502: {region: 0x9c, script: 0x52, flags: 0x0}, - 503: {region: 0x9d, script: 0x52, flags: 0x0}, - 504: {region: 0x48, script: 0x17, flags: 0x0}, - 505: {region: 0x96, script: 0x37, flags: 0x0}, - 506: {region: 0x164, script: 0x52, flags: 0x0}, - 507: {region: 0x164, script: 0x52, flags: 0x0}, - 508: {region: 0x105, script: 0x52, flags: 0x0}, - 509: {region: 0x164, script: 0x52, flags: 0x0}, - 510: {region: 0xa1, script: 0x41, flags: 0x0}, - 511: {region: 0x164, script: 0x52, flags: 0x0}, - 512: {region: 0x9f, script: 0x52, flags: 0x0}, - 514: {region: 0x164, script: 0x52, flags: 0x0}, - 515: {region: 0x164, script: 0x52, flags: 0x0}, - 516: {region: 0x164, script: 0x52, flags: 0x0}, - 517: {region: 0x51, script: 0x52, flags: 0x0}, - 518: {region: 0x12f, script: 0x37, flags: 0x0}, - 519: {region: 0x164, script: 0x52, flags: 0x0}, - 520: {region: 0x12e, script: 0x52, flags: 0x0}, - 521: {region: 0xda, script: 0x20, flags: 0x0}, - 522: {region: 0x164, script: 0x52, flags: 0x0}, - 523: {region: 0x62, script: 0x52, flags: 0x0}, - 524: {region: 0x94, script: 0x52, flags: 0x0}, - 525: {region: 0x94, script: 0x52, flags: 0x0}, - 526: {region: 0x7c, script: 0x29, flags: 0x0}, - 527: {region: 0x136, script: 0x1e, flags: 0x0}, - 528: {region: 0x66, script: 0x52, flags: 0x0}, - 529: {region: 0xc3, script: 0x52, flags: 0x0}, - 530: {region: 0x164, script: 0x52, flags: 0x0}, - 531: {region: 0x164, script: 0x52, flags: 0x0}, - 532: {region: 0xd5, script: 0x52, flags: 0x0}, - 533: {region: 0xa3, script: 0x52, flags: 0x0}, - 534: {region: 0xc2, script: 0x52, flags: 0x0}, - 535: {region: 0x105, script: 0x1e, flags: 0x0}, - 536: {region: 0x164, script: 0x52, flags: 0x0}, - 537: {region: 0x164, script: 0x52, flags: 0x0}, - 538: {region: 0x164, script: 0x52, flags: 0x0}, - 539: {region: 0x164, script: 0x52, flags: 0x0}, - 540: {region: 0xd3, script: 0x5, flags: 0x0}, - 541: {region: 0xd5, script: 0x52, flags: 0x0}, - 542: {region: 0x163, script: 0x52, flags: 0x0}, - 543: {region: 0x164, script: 0x52, flags: 0x0}, - 544: {region: 0x164, script: 0x52, flags: 0x0}, - 545: {region: 0x12e, script: 0x52, flags: 0x0}, - 546: {region: 0x121, script: 0x5, flags: 0x0}, - 547: {region: 0x164, script: 0x52, flags: 0x0}, - 548: {region: 0x122, script: 0xd5, flags: 0x0}, - 549: {region: 0x59, script: 0x52, flags: 0x0}, - 550: {region: 0x51, script: 0x52, flags: 0x0}, - 551: {region: 0x164, script: 0x52, flags: 0x0}, - 552: {region: 0x4e, script: 0x52, flags: 0x0}, - 553: {region: 0x98, script: 0x20, flags: 0x0}, - 554: {region: 0x98, script: 0x20, flags: 0x0}, - 555: {region: 0x4a, script: 0x52, flags: 0x0}, - 556: {region: 0x94, script: 0x52, flags: 0x0}, - 557: {region: 0x164, script: 0x52, flags: 0x0}, - 558: {region: 0x40, script: 0x52, flags: 0x0}, - 559: {region: 0x98, script: 0x52, flags: 0x0}, - 560: {region: 0x52, script: 0xcc, flags: 0x0}, - 561: {region: 0x98, script: 0x20, flags: 0x0}, - 562: {region: 0xc2, script: 0x52, flags: 0x0}, - 563: {region: 0x164, script: 0x52, flags: 0x0}, - 564: {region: 0x98, script: 0x6b, flags: 0x0}, - 565: {region: 0xe7, script: 0x5, flags: 0x0}, - 566: {region: 0x164, script: 0x52, flags: 0x0}, - 567: {region: 0xa3, script: 0x52, flags: 0x0}, - 568: {region: 0x164, script: 0x52, flags: 0x0}, - 569: {region: 0x12a, script: 0x52, flags: 0x0}, - 570: {region: 0x164, script: 0x52, flags: 0x0}, - 571: {region: 0xd1, script: 0x52, flags: 0x0}, - 572: {region: 0x164, script: 0x52, flags: 0x0}, - 573: {region: 0xae, script: 0x4f, flags: 0x0}, - 574: {region: 0x164, script: 0x52, flags: 0x0}, - 575: {region: 0x164, script: 0x52, flags: 0x0}, - 576: {region: 0x13, script: 0x6, flags: 0x1}, - 577: {region: 0x164, script: 0x52, flags: 0x0}, - 578: {region: 0x51, script: 0x52, flags: 0x0}, - 579: {region: 0x81, script: 0x52, flags: 0x0}, - 580: {region: 0xa3, script: 0x52, flags: 0x0}, - 581: {region: 0x164, script: 0x52, flags: 0x0}, - 582: {region: 0x164, script: 0x52, flags: 0x0}, - 583: {region: 0x164, script: 0x52, flags: 0x0}, - 584: {region: 0xa5, script: 0x46, flags: 0x0}, - 585: {region: 0x29, script: 0x52, flags: 0x0}, - 586: {region: 0x164, script: 0x52, flags: 0x0}, - 587: {region: 0x164, script: 0x52, flags: 0x0}, - 588: {region: 0x164, script: 0x52, flags: 0x0}, - 589: {region: 0x164, script: 0x52, flags: 0x0}, - 590: {region: 0x164, script: 0x52, flags: 0x0}, - 591: {region: 0x98, script: 0x4a, flags: 0x0}, - 592: {region: 0x113, script: 0x52, flags: 0x0}, - 593: {region: 0x164, script: 0x52, flags: 0x0}, - 594: {region: 0xaa, script: 0x4b, flags: 0x0}, - 595: {region: 0x105, script: 0x1e, flags: 0x0}, - 596: {region: 0x98, script: 0x20, flags: 0x0}, - 597: {region: 0x164, script: 0x52, flags: 0x0}, - 598: {region: 0x74, script: 0x52, flags: 0x0}, - 599: {region: 0x164, script: 0x52, flags: 0x0}, - 600: {region: 0xb3, script: 0x52, flags: 0x0}, - 601: {region: 0x164, script: 0x52, flags: 0x0}, - 602: {region: 0x164, script: 0x52, flags: 0x0}, - 603: {region: 0x164, script: 0x52, flags: 0x0}, - 604: {region: 0x164, script: 0x52, flags: 0x0}, - 605: {region: 0x164, script: 0x52, flags: 0x0}, - 606: {region: 0x164, script: 0x52, flags: 0x0}, - 607: {region: 0x164, script: 0x52, flags: 0x0}, - 608: {region: 0x164, script: 0x27, flags: 0x0}, - 610: {region: 0x105, script: 0x1e, flags: 0x0}, - 611: {region: 0x111, script: 0x52, flags: 0x0}, - 612: {region: 0xe6, script: 0x52, flags: 0x0}, - 613: {region: 0x105, script: 0x52, flags: 0x0}, - 614: {region: 0x164, script: 0x52, flags: 0x0}, - 615: {region: 0x98, script: 0x20, flags: 0x0}, - 616: {region: 0x98, script: 0x5, flags: 0x0}, - 617: {region: 0x12e, script: 0x52, flags: 0x0}, - 618: {region: 0x164, script: 0x52, flags: 0x0}, - 619: {region: 0x51, script: 0x52, flags: 0x0}, - 620: {region: 0x5f, script: 0x52, flags: 0x0}, - 621: {region: 0x164, script: 0x52, flags: 0x0}, - 622: {region: 0x164, script: 0x52, flags: 0x0}, - 623: {region: 0x164, script: 0x27, flags: 0x0}, - 624: {region: 0x164, script: 0x52, flags: 0x0}, - 625: {region: 0x164, script: 0x52, flags: 0x0}, - 626: {region: 0x19, script: 0x3, flags: 0x1}, - 627: {region: 0x164, script: 0x52, flags: 0x0}, - 628: {region: 0x164, script: 0x52, flags: 0x0}, - 629: {region: 0x164, script: 0x52, flags: 0x0}, - 630: {region: 0x164, script: 0x52, flags: 0x0}, - 631: {region: 0x105, script: 0x1e, flags: 0x0}, - 632: {region: 0x164, script: 0x52, flags: 0x0}, - 633: {region: 0x164, script: 0x52, flags: 0x0}, - 634: {region: 0x164, script: 0x52, flags: 0x0}, - 635: {region: 0x105, script: 0x1e, flags: 0x0}, - 636: {region: 0x164, script: 0x52, flags: 0x0}, - 637: {region: 0x94, script: 0x52, flags: 0x0}, - 638: {region: 0xe7, script: 0x5, flags: 0x0}, - 639: {region: 0x7a, script: 0x52, flags: 0x0}, - 640: {region: 0x164, script: 0x52, flags: 0x0}, - 641: {region: 0x164, script: 0x52, flags: 0x0}, - 642: {region: 0x164, script: 0x52, flags: 0x0}, - 643: {region: 0x164, script: 0x27, flags: 0x0}, - 644: {region: 0x122, script: 0xd5, flags: 0x0}, - 645: {region: 0xe7, script: 0x5, flags: 0x0}, - 646: {region: 0x164, script: 0x52, flags: 0x0}, - 647: {region: 0x164, script: 0x52, flags: 0x0}, - 648: {region: 0x1c, script: 0x5, flags: 0x1}, - 649: {region: 0x164, script: 0x52, flags: 0x0}, - 650: {region: 0x164, script: 0x52, flags: 0x0}, - 651: {region: 0x164, script: 0x52, flags: 0x0}, - 652: {region: 0x137, script: 0x52, flags: 0x0}, - 653: {region: 0x86, script: 0x56, flags: 0x0}, - 654: {region: 0x96, script: 0x37, flags: 0x0}, - 655: {region: 0x12e, script: 0x52, flags: 0x0}, - 656: {region: 0xe7, script: 0x5, flags: 0x0}, - 657: {region: 0x130, script: 0x52, flags: 0x0}, - 658: {region: 0x164, script: 0x52, flags: 0x0}, - 659: {region: 0xb6, script: 0x52, flags: 0x0}, - 660: {region: 0x105, script: 0x1e, flags: 0x0}, - 661: {region: 0x164, script: 0x52, flags: 0x0}, - 662: {region: 0x94, script: 0x52, flags: 0x0}, - 663: {region: 0x164, script: 0x52, flags: 0x0}, - 664: {region: 0x52, script: 0xd5, flags: 0x0}, - 665: {region: 0x164, script: 0x52, flags: 0x0}, - 666: {region: 0x164, script: 0x52, flags: 0x0}, - 667: {region: 0x164, script: 0x52, flags: 0x0}, - 668: {region: 0x164, script: 0x52, flags: 0x0}, - 669: {region: 0x98, script: 0x54, flags: 0x0}, - 670: {region: 0x164, script: 0x52, flags: 0x0}, - 671: {region: 0x164, script: 0x52, flags: 0x0}, - 672: {region: 0x105, script: 0x1e, flags: 0x0}, - 673: {region: 0x130, script: 0x52, flags: 0x0}, - 674: {region: 0x164, script: 0x52, flags: 0x0}, - 675: {region: 0xd8, script: 0x52, flags: 0x0}, - 676: {region: 0x164, script: 0x52, flags: 0x0}, - 677: {region: 0x164, script: 0x52, flags: 0x0}, - 678: {region: 0x21, script: 0x2, flags: 0x1}, - 679: {region: 0x164, script: 0x52, flags: 0x0}, - 680: {region: 0x164, script: 0x52, flags: 0x0}, - 681: {region: 0x9d, script: 0x52, flags: 0x0}, - 682: {region: 0x52, script: 0x58, flags: 0x0}, - 683: {region: 0x94, script: 0x52, flags: 0x0}, - 684: {region: 0x9b, script: 0x5, flags: 0x0}, - 685: {region: 0x134, script: 0x52, flags: 0x0}, - 686: {region: 0x164, script: 0x52, flags: 0x0}, - 687: {region: 0x164, script: 0x52, flags: 0x0}, - 688: {region: 0x98, script: 0xd0, flags: 0x0}, - 689: {region: 0x9d, script: 0x52, flags: 0x0}, - 690: {region: 0x164, script: 0x52, flags: 0x0}, - 691: {region: 0x4a, script: 0x52, flags: 0x0}, - 692: {region: 0x164, script: 0x52, flags: 0x0}, - 693: {region: 0x164, script: 0x52, flags: 0x0}, - 694: {region: 0xae, script: 0x4f, flags: 0x0}, - 695: {region: 0x164, script: 0x52, flags: 0x0}, - 696: {region: 0x164, script: 0x52, flags: 0x0}, - 697: {region: 0x4a, script: 0x52, flags: 0x0}, - 698: {region: 0x164, script: 0x52, flags: 0x0}, - 699: {region: 0x164, script: 0x52, flags: 0x0}, - 700: {region: 0x161, script: 0x52, flags: 0x0}, - 701: {region: 0x9b, script: 0x5, flags: 0x0}, - 702: {region: 0xb5, script: 0x52, flags: 0x0}, - 703: {region: 0xb7, script: 0x52, flags: 0x0}, - 704: {region: 0x4a, script: 0x52, flags: 0x0}, - 705: {region: 0x4a, script: 0x52, flags: 0x0}, - 706: {region: 0xa3, script: 0x52, flags: 0x0}, - 707: {region: 0xa3, script: 0x52, flags: 0x0}, - 708: {region: 0x9b, script: 0x5, flags: 0x0}, - 709: {region: 0xb7, script: 0x52, flags: 0x0}, - 710: {region: 0x122, script: 0xd5, flags: 0x0}, - 711: {region: 0x52, script: 0x34, flags: 0x0}, - 712: {region: 0x12a, script: 0x52, flags: 0x0}, - 713: {region: 0x94, script: 0x52, flags: 0x0}, - 714: {region: 0x51, script: 0x52, flags: 0x0}, - 715: {region: 0x98, script: 0x20, flags: 0x0}, - 716: {region: 0x98, script: 0x20, flags: 0x0}, - 717: {region: 0x94, script: 0x52, flags: 0x0}, - 718: {region: 0x23, script: 0x3, flags: 0x1}, - 719: {region: 0xa3, script: 0x52, flags: 0x0}, - 720: {region: 0x164, script: 0x52, flags: 0x0}, - 721: {region: 0xce, script: 0x52, flags: 0x0}, - 722: {region: 0x164, script: 0x52, flags: 0x0}, - 723: {region: 0x164, script: 0x52, flags: 0x0}, - 724: {region: 0x164, script: 0x52, flags: 0x0}, - 725: {region: 0x164, script: 0x52, flags: 0x0}, - 726: {region: 0x164, script: 0x52, flags: 0x0}, - 727: {region: 0x164, script: 0x52, flags: 0x0}, - 728: {region: 0x164, script: 0x52, flags: 0x0}, - 729: {region: 0x164, script: 0x52, flags: 0x0}, - 730: {region: 0x164, script: 0x52, flags: 0x0}, - 731: {region: 0x164, script: 0x52, flags: 0x0}, - 732: {region: 0x164, script: 0x52, flags: 0x0}, - 733: {region: 0x164, script: 0x5, flags: 0x0}, - 734: {region: 0x105, script: 0x1e, flags: 0x0}, - 735: {region: 0xe6, script: 0x52, flags: 0x0}, - 736: {region: 0x164, script: 0x52, flags: 0x0}, - 737: {region: 0x94, script: 0x52, flags: 0x0}, - 738: {region: 0x164, script: 0x27, flags: 0x0}, - 739: {region: 0x164, script: 0x52, flags: 0x0}, - 740: {region: 0x164, script: 0x52, flags: 0x0}, - 741: {region: 0x164, script: 0x52, flags: 0x0}, - 742: {region: 0x111, script: 0x52, flags: 0x0}, - 743: {region: 0xa3, script: 0x52, flags: 0x0}, - 744: {region: 0x164, script: 0x52, flags: 0x0}, - 745: {region: 0x164, script: 0x52, flags: 0x0}, - 746: {region: 0x122, script: 0x5, flags: 0x0}, - 747: {region: 0xcb, script: 0x52, flags: 0x0}, - 748: {region: 0x164, script: 0x52, flags: 0x0}, - 749: {region: 0x164, script: 0x52, flags: 0x0}, - 750: {region: 0x164, script: 0x52, flags: 0x0}, - 751: {region: 0xbe, script: 0x52, flags: 0x0}, - 752: {region: 0xd0, script: 0x52, flags: 0x0}, - 753: {region: 0x164, script: 0x52, flags: 0x0}, - 754: {region: 0x51, script: 0x52, flags: 0x0}, - 755: {region: 0xda, script: 0x20, flags: 0x0}, - 756: {region: 0x12e, script: 0x52, flags: 0x0}, - 757: {region: 0xbf, script: 0x52, flags: 0x0}, - 758: {region: 0x164, script: 0x52, flags: 0x0}, - 759: {region: 0x164, script: 0x52, flags: 0x0}, - 760: {region: 0xdf, script: 0x52, flags: 0x0}, - 761: {region: 0x164, script: 0x52, flags: 0x0}, - 762: {region: 0x94, script: 0x52, flags: 0x0}, - 763: {region: 0x9a, script: 0x36, flags: 0x0}, - 764: {region: 0x164, script: 0x52, flags: 0x0}, - 765: {region: 0xc1, script: 0x1e, flags: 0x0}, - 766: {region: 0x164, script: 0x5, flags: 0x0}, - 767: {region: 0x164, script: 0x52, flags: 0x0}, - 768: {region: 0x164, script: 0x52, flags: 0x0}, - 769: {region: 0x164, script: 0x52, flags: 0x0}, - 770: {region: 0x98, script: 0x64, flags: 0x0}, - 771: {region: 0x164, script: 0x52, flags: 0x0}, - 772: {region: 0x164, script: 0x52, flags: 0x0}, - 773: {region: 0x10a, script: 0x52, flags: 0x0}, - 774: {region: 0x164, script: 0x52, flags: 0x0}, - 775: {region: 0x164, script: 0x52, flags: 0x0}, - 776: {region: 0x164, script: 0x52, flags: 0x0}, - 777: {region: 0x26, script: 0x3, flags: 0x1}, - 778: {region: 0x164, script: 0x52, flags: 0x0}, - 779: {region: 0x164, script: 0x52, flags: 0x0}, - 780: {region: 0x98, script: 0xe, flags: 0x0}, - 781: {region: 0xc3, script: 0x6b, flags: 0x0}, - 783: {region: 0x164, script: 0x52, flags: 0x0}, - 784: {region: 0x48, script: 0x52, flags: 0x0}, - 785: {region: 0x48, script: 0x52, flags: 0x0}, - 786: {region: 0x36, script: 0x52, flags: 0x0}, - 787: {region: 0x164, script: 0x52, flags: 0x0}, - 788: {region: 0x164, script: 0x52, flags: 0x0}, - 789: {region: 0x164, script: 0x52, flags: 0x0}, - 790: {region: 0x164, script: 0x52, flags: 0x0}, - 791: {region: 0x164, script: 0x52, flags: 0x0}, - 792: {region: 0x164, script: 0x52, flags: 0x0}, - 793: {region: 0x98, script: 0x20, flags: 0x0}, - 794: {region: 0xda, script: 0x20, flags: 0x0}, - 795: {region: 0x105, script: 0x1e, flags: 0x0}, - 796: {region: 0x34, script: 0x68, flags: 0x0}, - 797: {region: 0x29, script: 0x3, flags: 0x1}, - 798: {region: 0xca, script: 0x52, flags: 0x0}, - 799: {region: 0x164, script: 0x52, flags: 0x0}, - 800: {region: 0x164, script: 0x52, flags: 0x0}, - 801: {region: 0x164, script: 0x52, flags: 0x0}, - 802: {region: 0x98, script: 0x20, flags: 0x0}, - 803: {region: 0x51, script: 0x52, flags: 0x0}, - 805: {region: 0x164, script: 0x52, flags: 0x0}, - 806: {region: 0x134, script: 0x52, flags: 0x0}, - 807: {region: 0x164, script: 0x52, flags: 0x0}, - 808: {region: 0x164, script: 0x52, flags: 0x0}, - 809: {region: 0xe7, script: 0x5, flags: 0x0}, - 810: {region: 0xc2, script: 0x52, flags: 0x0}, - 811: {region: 0x98, script: 0x20, flags: 0x0}, - 812: {region: 0x94, script: 0x52, flags: 0x0}, - 813: {region: 0x163, script: 0x52, flags: 0x0}, - 814: {region: 0x164, script: 0x52, flags: 0x0}, - 815: {region: 0xc3, script: 0x6b, flags: 0x0}, - 816: {region: 0x164, script: 0x52, flags: 0x0}, - 817: {region: 0x164, script: 0x27, flags: 0x0}, - 818: {region: 0x105, script: 0x1e, flags: 0x0}, - 819: {region: 0x164, script: 0x52, flags: 0x0}, - 820: {region: 0x130, script: 0x52, flags: 0x0}, - 821: {region: 0x9b, script: 0x5d, flags: 0x0}, - 822: {region: 0x164, script: 0x52, flags: 0x0}, - 823: {region: 0x164, script: 0x52, flags: 0x0}, - 824: {region: 0x9b, script: 0x5, flags: 0x0}, - 825: {region: 0x164, script: 0x52, flags: 0x0}, - 826: {region: 0x164, script: 0x52, flags: 0x0}, - 827: {region: 0x164, script: 0x52, flags: 0x0}, - 828: {region: 0xdc, script: 0x52, flags: 0x0}, - 829: {region: 0x164, script: 0x52, flags: 0x0}, - 830: {region: 0x164, script: 0x52, flags: 0x0}, - 832: {region: 0x164, script: 0x52, flags: 0x0}, - 833: {region: 0x52, script: 0x34, flags: 0x0}, - 834: {region: 0x9d, script: 0x52, flags: 0x0}, - 835: {region: 0xd1, script: 0x52, flags: 0x0}, - 836: {region: 0x164, script: 0x52, flags: 0x0}, - 837: {region: 0xd9, script: 0x52, flags: 0x0}, - 838: {region: 0x164, script: 0x52, flags: 0x0}, - 839: {region: 0x164, script: 0x52, flags: 0x0}, - 840: {region: 0x164, script: 0x52, flags: 0x0}, - 841: {region: 0xce, script: 0x52, flags: 0x0}, - 842: {region: 0x164, script: 0x52, flags: 0x0}, - 843: {region: 0x164, script: 0x52, flags: 0x0}, - 844: {region: 0x163, script: 0x52, flags: 0x0}, - 845: {region: 0xd0, script: 0x52, flags: 0x0}, - 846: {region: 0x5f, script: 0x52, flags: 0x0}, - 847: {region: 0xda, script: 0x20, flags: 0x0}, - 848: {region: 0x164, script: 0x52, flags: 0x0}, - 849: {region: 0xda, script: 0x20, flags: 0x0}, - 850: {region: 0x164, script: 0x52, flags: 0x0}, - 851: {region: 0x164, script: 0x52, flags: 0x0}, - 852: {region: 0xd1, script: 0x52, flags: 0x0}, - 853: {region: 0x164, script: 0x52, flags: 0x0}, - 854: {region: 0x164, script: 0x52, flags: 0x0}, - 855: {region: 0xd0, script: 0x52, flags: 0x0}, - 856: {region: 0x164, script: 0x52, flags: 0x0}, - 857: {region: 0xce, script: 0x52, flags: 0x0}, - 858: {region: 0xce, script: 0x52, flags: 0x0}, - 859: {region: 0x164, script: 0x52, flags: 0x0}, - 860: {region: 0x164, script: 0x52, flags: 0x0}, - 861: {region: 0x94, script: 0x52, flags: 0x0}, - 862: {region: 0x164, script: 0x52, flags: 0x0}, - 863: {region: 0xde, script: 0x52, flags: 0x0}, - 864: {region: 0x164, script: 0x52, flags: 0x0}, - 865: {region: 0x164, script: 0x52, flags: 0x0}, - 866: {region: 0x98, script: 0x52, flags: 0x0}, - 867: {region: 0x164, script: 0x52, flags: 0x0}, - 868: {region: 0x164, script: 0x52, flags: 0x0}, - 869: {region: 0xd8, script: 0x52, flags: 0x0}, - 870: {region: 0x51, script: 0x52, flags: 0x0}, - 871: {region: 0x164, script: 0x52, flags: 0x0}, - 872: {region: 0xd9, script: 0x52, flags: 0x0}, - 873: {region: 0x164, script: 0x52, flags: 0x0}, - 874: {region: 0x51, script: 0x52, flags: 0x0}, - 875: {region: 0x164, script: 0x52, flags: 0x0}, - 876: {region: 0x164, script: 0x52, flags: 0x0}, - 877: {region: 0xd9, script: 0x52, flags: 0x0}, - 878: {region: 0x122, script: 0x4e, flags: 0x0}, - 879: {region: 0x98, script: 0x20, flags: 0x0}, - 880: {region: 0x10b, script: 0xb7, flags: 0x0}, - 881: {region: 0x164, script: 0x52, flags: 0x0}, - 882: {region: 0x164, script: 0x52, flags: 0x0}, - 883: {region: 0x83, script: 0x70, flags: 0x0}, - 884: {region: 0x160, script: 0x52, flags: 0x0}, - 885: {region: 0x164, script: 0x52, flags: 0x0}, - 886: {region: 0x48, script: 0x17, flags: 0x0}, - 887: {region: 0x164, script: 0x52, flags: 0x0}, - 888: {region: 0x160, script: 0x52, flags: 0x0}, - 889: {region: 0x164, script: 0x52, flags: 0x0}, - 890: {region: 0x164, script: 0x52, flags: 0x0}, - 891: {region: 0x164, script: 0x52, flags: 0x0}, - 892: {region: 0x164, script: 0x52, flags: 0x0}, - 893: {region: 0x164, script: 0x52, flags: 0x0}, - 894: {region: 0x116, script: 0x52, flags: 0x0}, - 895: {region: 0x164, script: 0x52, flags: 0x0}, - 896: {region: 0x164, script: 0x52, flags: 0x0}, - 897: {region: 0x134, script: 0x52, flags: 0x0}, - 898: {region: 0x164, script: 0x52, flags: 0x0}, - 899: {region: 0x52, script: 0x52, flags: 0x0}, - 900: {region: 0x164, script: 0x52, flags: 0x0}, - 901: {region: 0xcd, script: 0x52, flags: 0x0}, - 902: {region: 0x12e, script: 0x52, flags: 0x0}, - 903: {region: 0x130, script: 0x52, flags: 0x0}, - 904: {region: 0x7f, script: 0x52, flags: 0x0}, - 905: {region: 0x77, script: 0x52, flags: 0x0}, - 906: {region: 0x164, script: 0x52, flags: 0x0}, - 908: {region: 0x164, script: 0x52, flags: 0x0}, - 909: {region: 0x164, script: 0x52, flags: 0x0}, - 910: {region: 0x6e, script: 0x52, flags: 0x0}, - 911: {region: 0x164, script: 0x52, flags: 0x0}, - 912: {region: 0x164, script: 0x52, flags: 0x0}, - 913: {region: 0x164, script: 0x52, flags: 0x0}, - 914: {region: 0x164, script: 0x52, flags: 0x0}, - 915: {region: 0x98, script: 0x75, flags: 0x0}, - 916: {region: 0x164, script: 0x52, flags: 0x0}, - 917: {region: 0x164, script: 0x5, flags: 0x0}, - 918: {region: 0x7c, script: 0x1e, flags: 0x0}, - 919: {region: 0x134, script: 0x76, flags: 0x0}, - 920: {region: 0x164, script: 0x5, flags: 0x0}, - 921: {region: 0xc4, script: 0x74, flags: 0x0}, - 922: {region: 0x164, script: 0x52, flags: 0x0}, - 923: {region: 0x2c, script: 0x3, flags: 0x1}, - 924: {region: 0xe6, script: 0x52, flags: 0x0}, - 925: {region: 0x2f, script: 0x2, flags: 0x1}, - 926: {region: 0xe6, script: 0x52, flags: 0x0}, - 927: {region: 0x2f, script: 0x52, flags: 0x0}, - 928: {region: 0xef, script: 0x52, flags: 0x0}, - 929: {region: 0x164, script: 0x52, flags: 0x0}, - 930: {region: 0x77, script: 0x52, flags: 0x0}, - 931: {region: 0xd5, script: 0x52, flags: 0x0}, - 932: {region: 0x134, script: 0x52, flags: 0x0}, - 933: {region: 0x48, script: 0x52, flags: 0x0}, - 934: {region: 0x164, script: 0x52, flags: 0x0}, - 935: {region: 0x9b, script: 0xdd, flags: 0x0}, - 936: {region: 0x164, script: 0x52, flags: 0x0}, - 937: {region: 0x5f, script: 0x52, flags: 0x0}, - 938: {region: 0x164, script: 0x5, flags: 0x0}, - 939: {region: 0xaf, script: 0x7f, flags: 0x0}, - 941: {region: 0x164, script: 0x52, flags: 0x0}, - 942: {region: 0x164, script: 0x52, flags: 0x0}, - 943: {region: 0x98, script: 0x12, flags: 0x0}, - 944: {region: 0xa3, script: 0x52, flags: 0x0}, - 945: {region: 0xe8, script: 0x52, flags: 0x0}, - 946: {region: 0x164, script: 0x52, flags: 0x0}, - 947: {region: 0x9d, script: 0x52, flags: 0x0}, - 948: {region: 0x164, script: 0x52, flags: 0x0}, - 949: {region: 0x164, script: 0x52, flags: 0x0}, - 950: {region: 0x86, script: 0x2d, flags: 0x0}, - 951: {region: 0x74, script: 0x52, flags: 0x0}, - 952: {region: 0x164, script: 0x52, flags: 0x0}, - 953: {region: 0xe7, script: 0x45, flags: 0x0}, - 954: {region: 0x9b, script: 0x5, flags: 0x0}, - 955: {region: 0x1, script: 0x52, flags: 0x0}, - 956: {region: 0x23, script: 0x5, flags: 0x0}, - 957: {region: 0x164, script: 0x52, flags: 0x0}, - 958: {region: 0x40, script: 0x52, flags: 0x0}, - 959: {region: 0x164, script: 0x52, flags: 0x0}, - 960: {region: 0x79, script: 0x52, flags: 0x0}, - 961: {region: 0x164, script: 0x52, flags: 0x0}, - 962: {region: 0xe3, script: 0x52, flags: 0x0}, - 963: {region: 0x88, script: 0x52, flags: 0x0}, - 964: {region: 0x68, script: 0x52, flags: 0x0}, - 965: {region: 0x164, script: 0x52, flags: 0x0}, - 966: {region: 0x98, script: 0x20, flags: 0x0}, - 967: {region: 0x164, script: 0x52, flags: 0x0}, - 968: {region: 0x101, script: 0x52, flags: 0x0}, - 969: {region: 0x94, script: 0x52, flags: 0x0}, - 970: {region: 0x164, script: 0x52, flags: 0x0}, - 971: {region: 0x164, script: 0x52, flags: 0x0}, - 972: {region: 0x9d, script: 0x52, flags: 0x0}, - 973: {region: 0x164, script: 0x5, flags: 0x0}, - 974: {region: 0x98, script: 0x52, flags: 0x0}, - 975: {region: 0x31, script: 0x2, flags: 0x1}, - 976: {region: 0xda, script: 0x20, flags: 0x0}, - 977: {region: 0x34, script: 0xe, flags: 0x0}, - 978: {region: 0x4d, script: 0x52, flags: 0x0}, - 979: {region: 0x71, script: 0x52, flags: 0x0}, - 980: {region: 0x4d, script: 0x52, flags: 0x0}, - 981: {region: 0x9b, script: 0x5, flags: 0x0}, - 982: {region: 0x10b, script: 0x52, flags: 0x0}, - 983: {region: 0x39, script: 0x52, flags: 0x0}, - 984: {region: 0x164, script: 0x52, flags: 0x0}, - 985: {region: 0xd0, script: 0x52, flags: 0x0}, - 986: {region: 0x103, script: 0x52, flags: 0x0}, - 987: {region: 0x94, script: 0x52, flags: 0x0}, - 988: {region: 0x12e, script: 0x52, flags: 0x0}, - 989: {region: 0x164, script: 0x52, flags: 0x0}, - 990: {region: 0x164, script: 0x52, flags: 0x0}, - 991: {region: 0x72, script: 0x52, flags: 0x0}, - 992: {region: 0x105, script: 0x1e, flags: 0x0}, - 993: {region: 0x12f, script: 0x1e, flags: 0x0}, - 994: {region: 0x108, script: 0x52, flags: 0x0}, - 995: {region: 0x106, script: 0x52, flags: 0x0}, - 996: {region: 0x12e, script: 0x52, flags: 0x0}, - 997: {region: 0x164, script: 0x52, flags: 0x0}, - 998: {region: 0xa1, script: 0x44, flags: 0x0}, - 999: {region: 0x98, script: 0x20, flags: 0x0}, - 1000: {region: 0x7f, script: 0x52, flags: 0x0}, - 1001: {region: 0x105, script: 0x1e, flags: 0x0}, - 1002: {region: 0xa3, script: 0x52, flags: 0x0}, - 1003: {region: 0x94, script: 0x52, flags: 0x0}, - 1004: {region: 0x98, script: 0x52, flags: 0x0}, - 1005: {region: 0x113, script: 0x52, flags: 0x0}, - 1006: {region: 0x98, script: 0xbb, flags: 0x0}, - 1007: {region: 0x164, script: 0x52, flags: 0x0}, - 1008: {region: 0x164, script: 0x52, flags: 0x0}, - 1009: {region: 0x12e, script: 0x52, flags: 0x0}, - 1010: {region: 0x9d, script: 0x52, flags: 0x0}, - 1011: {region: 0x98, script: 0x20, flags: 0x0}, - 1012: {region: 0x164, script: 0x5, flags: 0x0}, - 1013: {region: 0x9d, script: 0x52, flags: 0x0}, - 1014: {region: 0x7a, script: 0x52, flags: 0x0}, - 1015: {region: 0x48, script: 0x52, flags: 0x0}, - 1016: {region: 0x33, script: 0x4, flags: 0x1}, - 1017: {region: 0x9d, script: 0x52, flags: 0x0}, - 1018: {region: 0x9b, script: 0x5, flags: 0x0}, - 1019: {region: 0xd9, script: 0x52, flags: 0x0}, - 1020: {region: 0x4e, script: 0x52, flags: 0x0}, - 1021: {region: 0xd0, script: 0x52, flags: 0x0}, - 1022: {region: 0xce, script: 0x52, flags: 0x0}, - 1023: {region: 0xc2, script: 0x52, flags: 0x0}, - 1024: {region: 0x4b, script: 0x52, flags: 0x0}, - 1025: {region: 0x95, script: 0x72, flags: 0x0}, - 1026: {region: 0xb5, script: 0x52, flags: 0x0}, - 1027: {region: 0x164, script: 0x27, flags: 0x0}, - 1028: {region: 0x164, script: 0x52, flags: 0x0}, - 1030: {region: 0xb9, script: 0xd2, flags: 0x0}, - 1031: {region: 0x164, script: 0x52, flags: 0x0}, - 1032: {region: 0xc3, script: 0x6b, flags: 0x0}, - 1033: {region: 0x164, script: 0x5, flags: 0x0}, - 1034: {region: 0xb2, script: 0xc1, flags: 0x0}, - 1035: {region: 0x6e, script: 0x52, flags: 0x0}, - 1036: {region: 0x164, script: 0x52, flags: 0x0}, - 1037: {region: 0x164, script: 0x52, flags: 0x0}, - 1038: {region: 0x164, script: 0x52, flags: 0x0}, - 1039: {region: 0x164, script: 0x52, flags: 0x0}, - 1040: {region: 0x110, script: 0x52, flags: 0x0}, - 1041: {region: 0x164, script: 0x52, flags: 0x0}, - 1042: {region: 0xe7, script: 0x5, flags: 0x0}, - 1043: {region: 0x164, script: 0x52, flags: 0x0}, - 1044: {region: 0x10e, script: 0x52, flags: 0x0}, - 1045: {region: 0x164, script: 0x52, flags: 0x0}, - 1046: {region: 0xe8, script: 0x52, flags: 0x0}, - 1047: {region: 0x164, script: 0x52, flags: 0x0}, - 1048: {region: 0x94, script: 0x52, flags: 0x0}, - 1049: {region: 0x141, script: 0x52, flags: 0x0}, - 1050: {region: 0x10b, script: 0x52, flags: 0x0}, - 1052: {region: 0x10b, script: 0x52, flags: 0x0}, - 1053: {region: 0x71, script: 0x52, flags: 0x0}, - 1054: {region: 0x96, script: 0xb8, flags: 0x0}, - 1055: {region: 0x164, script: 0x52, flags: 0x0}, - 1056: {region: 0x71, script: 0x52, flags: 0x0}, - 1057: {region: 0x163, script: 0x52, flags: 0x0}, - 1058: {region: 0x164, script: 0x52, flags: 0x0}, - 1059: {region: 0xc2, script: 0x52, flags: 0x0}, - 1060: {region: 0x164, script: 0x52, flags: 0x0}, - 1061: {region: 0x164, script: 0x52, flags: 0x0}, - 1062: {region: 0x164, script: 0x52, flags: 0x0}, - 1063: {region: 0x114, script: 0x52, flags: 0x0}, - 1064: {region: 0x164, script: 0x52, flags: 0x0}, - 1065: {region: 0x164, script: 0x52, flags: 0x0}, - 1066: {region: 0x122, script: 0xd5, flags: 0x0}, - 1067: {region: 0x164, script: 0x52, flags: 0x0}, - 1068: {region: 0x164, script: 0x52, flags: 0x0}, - 1069: {region: 0x164, script: 0x52, flags: 0x0}, - 1070: {region: 0x164, script: 0x52, flags: 0x0}, - 1071: {region: 0x26, script: 0x52, flags: 0x0}, - 1072: {region: 0x37, script: 0x5, flags: 0x1}, - 1073: {region: 0x98, script: 0xc2, flags: 0x0}, - 1074: {region: 0x115, script: 0x52, flags: 0x0}, - 1075: {region: 0x113, script: 0x52, flags: 0x0}, - 1076: {region: 0x98, script: 0x20, flags: 0x0}, - 1077: {region: 0x160, script: 0x52, flags: 0x0}, - 1078: {region: 0x164, script: 0x52, flags: 0x0}, - 1079: {region: 0x164, script: 0x52, flags: 0x0}, - 1080: {region: 0x6c, script: 0x52, flags: 0x0}, - 1081: {region: 0x160, script: 0x52, flags: 0x0}, - 1082: {region: 0x164, script: 0x52, flags: 0x0}, - 1083: {region: 0x5f, script: 0x52, flags: 0x0}, - 1084: {region: 0x94, script: 0x52, flags: 0x0}, - 1085: {region: 0x164, script: 0x52, flags: 0x0}, - 1086: {region: 0x164, script: 0x52, flags: 0x0}, - 1087: {region: 0x12e, script: 0x52, flags: 0x0}, - 1088: {region: 0x164, script: 0x52, flags: 0x0}, - 1089: {region: 0x83, script: 0x52, flags: 0x0}, - 1090: {region: 0x10b, script: 0x52, flags: 0x0}, - 1091: {region: 0x12e, script: 0x52, flags: 0x0}, - 1092: {region: 0x15e, script: 0x5, flags: 0x0}, - 1093: {region: 0x4a, script: 0x52, flags: 0x0}, - 1094: {region: 0x5f, script: 0x52, flags: 0x0}, - 1095: {region: 0x164, script: 0x52, flags: 0x0}, - 1096: {region: 0x98, script: 0x20, flags: 0x0}, - 1097: {region: 0x94, script: 0x52, flags: 0x0}, - 1098: {region: 0x164, script: 0x52, flags: 0x0}, - 1099: {region: 0x34, script: 0xe, flags: 0x0}, - 1100: {region: 0x9a, script: 0xc5, flags: 0x0}, - 1101: {region: 0xe8, script: 0x52, flags: 0x0}, - 1102: {region: 0x98, script: 0xcd, flags: 0x0}, - 1103: {region: 0xda, script: 0x20, flags: 0x0}, - 1104: {region: 0x164, script: 0x52, flags: 0x0}, - 1105: {region: 0x164, script: 0x52, flags: 0x0}, - 1106: {region: 0x164, script: 0x52, flags: 0x0}, - 1107: {region: 0x164, script: 0x52, flags: 0x0}, - 1108: {region: 0x164, script: 0x52, flags: 0x0}, - 1109: {region: 0x164, script: 0x52, flags: 0x0}, - 1110: {region: 0x164, script: 0x52, flags: 0x0}, - 1111: {region: 0x164, script: 0x52, flags: 0x0}, - 1112: {region: 0xe6, script: 0x52, flags: 0x0}, - 1113: {region: 0x164, script: 0x52, flags: 0x0}, - 1114: {region: 0x164, script: 0x52, flags: 0x0}, - 1115: {region: 0x98, script: 0x4a, flags: 0x0}, - 1116: {region: 0x52, script: 0xcb, flags: 0x0}, - 1117: {region: 0xda, script: 0x20, flags: 0x0}, - 1118: {region: 0xda, script: 0x20, flags: 0x0}, - 1119: {region: 0x98, script: 0xd0, flags: 0x0}, - 1120: {region: 0x164, script: 0x52, flags: 0x0}, - 1121: {region: 0x111, script: 0x52, flags: 0x0}, - 1122: {region: 0x130, script: 0x52, flags: 0x0}, - 1123: {region: 0x125, script: 0x52, flags: 0x0}, - 1124: {region: 0x164, script: 0x52, flags: 0x0}, - 1125: {region: 0x3c, script: 0x3, flags: 0x1}, - 1126: {region: 0x164, script: 0x52, flags: 0x0}, - 1127: {region: 0x164, script: 0x52, flags: 0x0}, - 1128: {region: 0x164, script: 0x52, flags: 0x0}, - 1129: {region: 0x122, script: 0xd5, flags: 0x0}, - 1130: {region: 0xda, script: 0x20, flags: 0x0}, - 1131: {region: 0xda, script: 0x20, flags: 0x0}, - 1132: {region: 0xda, script: 0x20, flags: 0x0}, - 1133: {region: 0x6e, script: 0x27, flags: 0x0}, - 1134: {region: 0x164, script: 0x52, flags: 0x0}, - 1135: {region: 0x6c, script: 0x27, flags: 0x0}, - 1136: {region: 0x164, script: 0x52, flags: 0x0}, - 1137: {region: 0x164, script: 0x52, flags: 0x0}, - 1138: {region: 0x164, script: 0x52, flags: 0x0}, - 1139: {region: 0xd5, script: 0x52, flags: 0x0}, - 1140: {region: 0x126, script: 0x52, flags: 0x0}, - 1141: {region: 0x124, script: 0x52, flags: 0x0}, - 1142: {region: 0x31, script: 0x52, flags: 0x0}, - 1143: {region: 0xda, script: 0x20, flags: 0x0}, - 1144: {region: 0xe6, script: 0x52, flags: 0x0}, - 1145: {region: 0x164, script: 0x52, flags: 0x0}, - 1146: {region: 0x164, script: 0x52, flags: 0x0}, - 1147: {region: 0x31, script: 0x52, flags: 0x0}, - 1148: {region: 0xd3, script: 0x52, flags: 0x0}, - 1149: {region: 0x164, script: 0x52, flags: 0x0}, - 1150: {region: 0x160, script: 0x52, flags: 0x0}, - 1151: {region: 0x164, script: 0x52, flags: 0x0}, - 1152: {region: 0x128, script: 0x52, flags: 0x0}, - 1153: {region: 0x164, script: 0x52, flags: 0x0}, - 1154: {region: 0xcd, script: 0x52, flags: 0x0}, - 1155: {region: 0x164, script: 0x52, flags: 0x0}, - 1156: {region: 0xe5, script: 0x52, flags: 0x0}, - 1157: {region: 0x164, script: 0x52, flags: 0x0}, - 1158: {region: 0x164, script: 0x52, flags: 0x0}, - 1159: {region: 0x164, script: 0x52, flags: 0x0}, - 1160: {region: 0x12a, script: 0x52, flags: 0x0}, - 1161: {region: 0x12a, script: 0x52, flags: 0x0}, - 1162: {region: 0x12d, script: 0x52, flags: 0x0}, - 1163: {region: 0x164, script: 0x5, flags: 0x0}, - 1164: {region: 0x160, script: 0x52, flags: 0x0}, - 1165: {region: 0x86, script: 0x2d, flags: 0x0}, - 1166: {region: 0xda, script: 0x20, flags: 0x0}, - 1167: {region: 0xe6, script: 0x52, flags: 0x0}, - 1168: {region: 0x42, script: 0xd6, flags: 0x0}, - 1169: {region: 0x164, script: 0x52, flags: 0x0}, - 1170: {region: 0x105, script: 0x1e, flags: 0x0}, - 1171: {region: 0x164, script: 0x52, flags: 0x0}, - 1172: {region: 0x164, script: 0x52, flags: 0x0}, - 1173: {region: 0x130, script: 0x52, flags: 0x0}, - 1174: {region: 0x164, script: 0x52, flags: 0x0}, - 1175: {region: 0x122, script: 0xd5, flags: 0x0}, - 1176: {region: 0x31, script: 0x52, flags: 0x0}, - 1177: {region: 0x164, script: 0x52, flags: 0x0}, - 1178: {region: 0x164, script: 0x52, flags: 0x0}, - 1179: {region: 0xcd, script: 0x52, flags: 0x0}, - 1180: {region: 0x164, script: 0x52, flags: 0x0}, - 1181: {region: 0x164, script: 0x52, flags: 0x0}, - 1182: {region: 0x12c, script: 0x52, flags: 0x0}, - 1183: {region: 0x164, script: 0x52, flags: 0x0}, - 1185: {region: 0x164, script: 0x52, flags: 0x0}, - 1186: {region: 0xd3, script: 0x52, flags: 0x0}, - 1187: {region: 0x52, script: 0xce, flags: 0x0}, - 1188: {region: 0xe4, script: 0x52, flags: 0x0}, - 1189: {region: 0x164, script: 0x52, flags: 0x0}, - 1190: {region: 0x105, script: 0x1e, flags: 0x0}, - 1191: {region: 0xb9, script: 0x52, flags: 0x0}, - 1192: {region: 0x164, script: 0x52, flags: 0x0}, - 1193: {region: 0x105, script: 0x1e, flags: 0x0}, - 1194: {region: 0x3f, script: 0x4, flags: 0x1}, - 1195: {region: 0x11b, script: 0xd8, flags: 0x0}, - 1196: {region: 0x12f, script: 0x1e, flags: 0x0}, - 1197: {region: 0x74, script: 0x52, flags: 0x0}, - 1198: {region: 0x29, script: 0x52, flags: 0x0}, - 1200: {region: 0x43, script: 0x3, flags: 0x1}, - 1201: {region: 0x98, script: 0xe, flags: 0x0}, - 1202: {region: 0xe7, script: 0x5, flags: 0x0}, - 1203: {region: 0x164, script: 0x52, flags: 0x0}, - 1204: {region: 0x164, script: 0x52, flags: 0x0}, - 1205: {region: 0x164, script: 0x52, flags: 0x0}, - 1206: {region: 0x164, script: 0x52, flags: 0x0}, - 1207: {region: 0x164, script: 0x52, flags: 0x0}, - 1208: {region: 0x164, script: 0x52, flags: 0x0}, - 1209: {region: 0x164, script: 0x52, flags: 0x0}, - 1210: {region: 0x46, script: 0x4, flags: 0x1}, - 1211: {region: 0x164, script: 0x52, flags: 0x0}, - 1212: {region: 0xb3, script: 0xd9, flags: 0x0}, - 1213: {region: 0x164, script: 0x52, flags: 0x0}, - 1214: {region: 0x160, script: 0x52, flags: 0x0}, - 1215: {region: 0x9d, script: 0x52, flags: 0x0}, - 1216: {region: 0x105, script: 0x52, flags: 0x0}, - 1217: {region: 0x13d, script: 0x52, flags: 0x0}, - 1218: {region: 0x11a, script: 0x52, flags: 0x0}, - 1219: {region: 0x164, script: 0x52, flags: 0x0}, - 1220: {region: 0x35, script: 0x52, flags: 0x0}, - 1221: {region: 0x5f, script: 0x52, flags: 0x0}, - 1222: {region: 0xd0, script: 0x52, flags: 0x0}, - 1223: {region: 0x1, script: 0x52, flags: 0x0}, - 1224: {region: 0x105, script: 0x52, flags: 0x0}, - 1225: {region: 0x69, script: 0x52, flags: 0x0}, - 1226: {region: 0x12e, script: 0x52, flags: 0x0}, - 1227: {region: 0x164, script: 0x52, flags: 0x0}, - 1228: {region: 0x35, script: 0x52, flags: 0x0}, - 1229: {region: 0x4d, script: 0x52, flags: 0x0}, - 1230: {region: 0x164, script: 0x52, flags: 0x0}, - 1231: {region: 0x6e, script: 0x27, flags: 0x0}, - 1232: {region: 0x164, script: 0x52, flags: 0x0}, - 1233: {region: 0xe6, script: 0x52, flags: 0x0}, - 1234: {region: 0x2e, script: 0x52, flags: 0x0}, - 1235: {region: 0x98, script: 0xd0, flags: 0x0}, - 1236: {region: 0x98, script: 0x20, flags: 0x0}, - 1237: {region: 0x164, script: 0x52, flags: 0x0}, - 1238: {region: 0x164, script: 0x52, flags: 0x0}, - 1239: {region: 0x164, script: 0x52, flags: 0x0}, - 1240: {region: 0x164, script: 0x52, flags: 0x0}, - 1241: {region: 0x164, script: 0x52, flags: 0x0}, - 1242: {region: 0x164, script: 0x52, flags: 0x0}, - 1243: {region: 0x164, script: 0x52, flags: 0x0}, - 1244: {region: 0x164, script: 0x52, flags: 0x0}, - 1245: {region: 0x164, script: 0x52, flags: 0x0}, - 1246: {region: 0x13f, script: 0x52, flags: 0x0}, - 1247: {region: 0x164, script: 0x52, flags: 0x0}, - 1248: {region: 0x164, script: 0x52, flags: 0x0}, - 1249: {region: 0xa7, script: 0x5, flags: 0x0}, - 1250: {region: 0x164, script: 0x52, flags: 0x0}, - 1251: {region: 0x113, script: 0x52, flags: 0x0}, - 1252: {region: 0x164, script: 0x52, flags: 0x0}, - 1253: {region: 0x164, script: 0x52, flags: 0x0}, - 1254: {region: 0x164, script: 0x52, flags: 0x0}, - 1255: {region: 0x164, script: 0x52, flags: 0x0}, - 1256: {region: 0x98, script: 0x20, flags: 0x0}, - 1257: {region: 0x52, script: 0x34, flags: 0x0}, - 1258: {region: 0x164, script: 0x52, flags: 0x0}, - 1259: {region: 0x164, script: 0x52, flags: 0x0}, - 1260: {region: 0x40, script: 0x52, flags: 0x0}, - 1261: {region: 0x164, script: 0x52, flags: 0x0}, - 1262: {region: 0x12a, script: 0x18, flags: 0x0}, - 1263: {region: 0x164, script: 0x52, flags: 0x0}, - 1264: {region: 0x160, script: 0x52, flags: 0x0}, - 1265: {region: 0x164, script: 0x52, flags: 0x0}, - 1266: {region: 0x12a, script: 0x5a, flags: 0x0}, - 1267: {region: 0x12a, script: 0x5b, flags: 0x0}, - 1268: {region: 0x7c, script: 0x29, flags: 0x0}, - 1269: {region: 0x52, script: 0x5e, flags: 0x0}, - 1270: {region: 0x10a, script: 0x62, flags: 0x0}, - 1271: {region: 0x107, script: 0x6c, flags: 0x0}, - 1272: {region: 0x98, script: 0x20, flags: 0x0}, - 1273: {region: 0x130, script: 0x52, flags: 0x0}, - 1274: {region: 0x164, script: 0x52, flags: 0x0}, - 1275: {region: 0x9b, script: 0x82, flags: 0x0}, - 1276: {region: 0x164, script: 0x52, flags: 0x0}, - 1277: {region: 0x15d, script: 0xba, flags: 0x0}, - 1278: {region: 0x164, script: 0x52, flags: 0x0}, - 1279: {region: 0x164, script: 0x52, flags: 0x0}, - 1280: {region: 0xda, script: 0x20, flags: 0x0}, - 1281: {region: 0x164, script: 0x52, flags: 0x0}, - 1282: {region: 0x164, script: 0x52, flags: 0x0}, - 1283: {region: 0xd0, script: 0x52, flags: 0x0}, - 1284: {region: 0x74, script: 0x52, flags: 0x0}, - 1285: {region: 0x164, script: 0x52, flags: 0x0}, - 1286: {region: 0x164, script: 0x52, flags: 0x0}, - 1287: {region: 0x51, script: 0x52, flags: 0x0}, - 1288: {region: 0x164, script: 0x52, flags: 0x0}, - 1289: {region: 0x164, script: 0x52, flags: 0x0}, - 1290: {region: 0x164, script: 0x52, flags: 0x0}, - 1291: {region: 0x51, script: 0x52, flags: 0x0}, - 1292: {region: 0x164, script: 0x52, flags: 0x0}, - 1293: {region: 0x164, script: 0x52, flags: 0x0}, - 1294: {region: 0x164, script: 0x52, flags: 0x0}, - 1295: {region: 0x164, script: 0x52, flags: 0x0}, - 1296: {region: 0x1, script: 0x37, flags: 0x0}, - 1297: {region: 0x164, script: 0x52, flags: 0x0}, - 1298: {region: 0x164, script: 0x52, flags: 0x0}, - 1299: {region: 0x164, script: 0x52, flags: 0x0}, - 1300: {region: 0x164, script: 0x52, flags: 0x0}, - 1301: {region: 0x164, script: 0x52, flags: 0x0}, - 1302: {region: 0xd5, script: 0x52, flags: 0x0}, - 1303: {region: 0x164, script: 0x52, flags: 0x0}, - 1304: {region: 0x164, script: 0x52, flags: 0x0}, - 1305: {region: 0x164, script: 0x52, flags: 0x0}, - 1306: {region: 0x40, script: 0x52, flags: 0x0}, - 1307: {region: 0x164, script: 0x52, flags: 0x0}, - 1308: {region: 0xce, script: 0x52, flags: 0x0}, - 1309: {region: 0x4a, script: 0x3, flags: 0x1}, - 1310: {region: 0x164, script: 0x52, flags: 0x0}, - 1311: {region: 0x164, script: 0x52, flags: 0x0}, - 1312: {region: 0x164, script: 0x52, flags: 0x0}, - 1313: {region: 0x52, script: 0x52, flags: 0x0}, - 1314: {region: 0x10a, script: 0x52, flags: 0x0}, - 1316: {region: 0xa7, script: 0x5, flags: 0x0}, - 1317: {region: 0xd8, script: 0x52, flags: 0x0}, - 1318: {region: 0xb9, script: 0xd2, flags: 0x0}, - 1319: {region: 0x4d, script: 0x14, flags: 0x1}, - 1320: {region: 0x164, script: 0x52, flags: 0x0}, - 1321: {region: 0x121, script: 0x52, flags: 0x0}, - 1322: {region: 0xcf, script: 0x52, flags: 0x0}, - 1323: {region: 0x164, script: 0x52, flags: 0x0}, - 1324: {region: 0x160, script: 0x52, flags: 0x0}, - 1326: {region: 0x12a, script: 0x52, flags: 0x0}, -} - -// likelyLangList holds lists info associated with likelyLang. -// Size: 388 bytes, 97 elements -var likelyLangList = [97]likelyScriptRegion{ - 0: {region: 0x9b, script: 0x7, flags: 0x0}, - 1: {region: 0xa0, script: 0x6d, flags: 0x2}, - 2: {region: 0x11b, script: 0x78, flags: 0x2}, - 3: {region: 0x31, script: 0x52, flags: 0x0}, - 4: {region: 0x9a, script: 0x5, flags: 0x4}, - 5: {region: 0x9b, script: 0x5, flags: 0x4}, - 6: {region: 0x105, script: 0x1e, flags: 0x4}, - 7: {region: 0x9b, script: 0x5, flags: 0x2}, - 8: {region: 0x105, script: 0x1e, flags: 0x0}, - 9: {region: 0x37, script: 0x2a, flags: 0x2}, - 10: {region: 0x134, script: 0x52, flags: 0x0}, - 11: {region: 0x7a, script: 0xbd, flags: 0x2}, - 12: {region: 0x113, script: 0x52, flags: 0x0}, - 13: {region: 0x83, script: 0x1, flags: 0x2}, - 14: {region: 0x5c, script: 0x1d, flags: 0x0}, - 15: {region: 0x86, script: 0x57, flags: 0x2}, - 16: {region: 0xd5, script: 0x52, flags: 0x0}, - 17: {region: 0x51, script: 0x5, flags: 0x4}, - 18: {region: 0x10a, script: 0x5, flags: 0x4}, - 19: {region: 0xad, script: 0x1e, flags: 0x0}, - 20: {region: 0x23, script: 0x5, flags: 0x4}, - 21: {region: 0x52, script: 0x5, flags: 0x4}, - 22: {region: 0x9b, script: 0x5, flags: 0x4}, - 23: {region: 0xc4, script: 0x5, flags: 0x4}, - 24: {region: 0x52, script: 0x5, flags: 0x2}, - 25: {region: 0x12a, script: 0x52, flags: 0x0}, - 26: {region: 0xaf, script: 0x5, flags: 0x4}, - 27: {region: 0x9a, script: 0x5, flags: 0x2}, - 28: {region: 0xa4, script: 0x1e, flags: 0x0}, - 29: {region: 0x52, script: 0x5, flags: 0x4}, - 30: {region: 0x12a, script: 0x52, flags: 0x4}, - 31: {region: 0x52, script: 0x5, flags: 0x2}, - 32: {region: 0x12a, script: 0x52, flags: 0x2}, - 33: {region: 0xda, script: 0x20, flags: 0x0}, - 34: {region: 0x98, script: 0x55, flags: 0x2}, - 35: {region: 0x82, script: 0x52, flags: 0x0}, - 36: {region: 0x83, script: 0x70, flags: 0x4}, - 37: {region: 0x83, script: 0x70, flags: 0x2}, - 38: {region: 0xc4, script: 0x1e, flags: 0x0}, - 39: {region: 0x52, script: 0x66, flags: 0x4}, - 40: {region: 0x52, script: 0x66, flags: 0x2}, - 41: {region: 0xcf, script: 0x52, flags: 0x0}, - 42: {region: 0x49, script: 0x5, flags: 0x4}, - 43: {region: 0x94, script: 0x5, flags: 0x4}, - 44: {region: 0x98, script: 0x2f, flags: 0x0}, - 45: {region: 0xe7, script: 0x5, flags: 0x4}, - 46: {region: 0xe7, script: 0x5, flags: 0x2}, - 47: {region: 0x9b, script: 0x7c, flags: 0x0}, - 48: {region: 0x52, script: 0x7d, flags: 0x2}, - 49: {region: 0xb9, script: 0xd2, flags: 0x0}, - 50: {region: 0xd8, script: 0x52, flags: 0x4}, - 51: {region: 0xe7, script: 0x5, flags: 0x0}, - 52: {region: 0x98, script: 0x20, flags: 0x2}, - 53: {region: 0x98, script: 0x47, flags: 0x2}, - 54: {region: 0x98, script: 0xc0, flags: 0x2}, - 55: {region: 0x104, script: 0x1e, flags: 0x0}, - 56: {region: 0xbc, script: 0x52, flags: 0x4}, - 57: {region: 0x103, script: 0x52, flags: 0x4}, - 58: {region: 0x105, script: 0x52, flags: 0x4}, - 59: {region: 0x12a, script: 0x52, flags: 0x4}, - 60: {region: 0x123, script: 0x1e, flags: 0x0}, - 61: {region: 0xe7, script: 0x5, flags: 0x4}, - 62: {region: 0xe7, script: 0x5, flags: 0x2}, - 63: {region: 0x52, script: 0x5, flags: 0x0}, - 64: {region: 0xad, script: 0x1e, flags: 0x4}, - 65: {region: 0xc4, script: 0x1e, flags: 0x4}, - 66: {region: 0xad, script: 0x1e, flags: 0x2}, - 67: {region: 0x98, script: 0xe, flags: 0x0}, - 68: {region: 0xda, script: 0x20, flags: 0x4}, - 69: {region: 0xda, script: 0x20, flags: 0x2}, - 70: {region: 0x136, script: 0x52, flags: 0x0}, - 71: {region: 0x23, script: 0x5, flags: 0x4}, - 72: {region: 0x52, script: 0x1e, flags: 0x4}, - 73: {region: 0x23, script: 0x5, flags: 0x2}, - 74: {region: 0x8c, script: 0x35, flags: 0x0}, - 75: {region: 0x52, script: 0x34, flags: 0x4}, - 76: {region: 0x52, script: 0x34, flags: 0x2}, - 77: {region: 0x52, script: 0x34, flags: 0x0}, - 78: {region: 0x2e, script: 0x35, flags: 0x4}, - 79: {region: 0x3d, script: 0x35, flags: 0x4}, - 80: {region: 0x7a, script: 0x35, flags: 0x4}, - 81: {region: 0x7d, script: 0x35, flags: 0x4}, - 82: {region: 0x8c, script: 0x35, flags: 0x4}, - 83: {region: 0x94, script: 0x35, flags: 0x4}, - 84: {region: 0xc5, script: 0x35, flags: 0x4}, - 85: {region: 0xcf, script: 0x35, flags: 0x4}, - 86: {region: 0xe1, script: 0x35, flags: 0x4}, - 87: {region: 0xe4, script: 0x35, flags: 0x4}, - 88: {region: 0xe6, script: 0x35, flags: 0x4}, - 89: {region: 0x115, script: 0x35, flags: 0x4}, - 90: {region: 0x122, script: 0x35, flags: 0x4}, - 91: {region: 0x12d, script: 0x35, flags: 0x4}, - 92: {region: 0x134, script: 0x35, flags: 0x4}, - 93: {region: 0x13d, script: 0x35, flags: 0x4}, - 94: {region: 0x12d, script: 0x11, flags: 0x2}, - 95: {region: 0x12d, script: 0x30, flags: 0x2}, - 96: {region: 0x12d, script: 0x35, flags: 0x2}, -} - -type likelyLangScript struct { - lang uint16 - script uint8 - flags uint8 -} - -// likelyRegion is a lookup table, indexed by regionID, for the most likely -// languages and scripts given incomplete information. If more entries exist -// for a given regionID, lang and script are the index and size respectively -// of the list in likelyRegionList. -// TODO: exclude containers and user-definable regions from the list. -// Size: 1428 bytes, 357 elements -var likelyRegion = [357]likelyLangScript{ - 33: {lang: 0xd7, script: 0x52, flags: 0x0}, - 34: {lang: 0x3a, script: 0x5, flags: 0x0}, - 35: {lang: 0x0, script: 0x2, flags: 0x1}, - 38: {lang: 0x2, script: 0x2, flags: 0x1}, - 39: {lang: 0x4, script: 0x2, flags: 0x1}, - 41: {lang: 0x3be, script: 0x52, flags: 0x0}, - 42: {lang: 0x0, script: 0x52, flags: 0x0}, - 43: {lang: 0x13d, script: 0x52, flags: 0x0}, - 44: {lang: 0x419, script: 0x52, flags: 0x0}, - 45: {lang: 0x10c, script: 0x52, flags: 0x0}, - 47: {lang: 0x365, script: 0x52, flags: 0x0}, - 48: {lang: 0x442, script: 0x52, flags: 0x0}, - 49: {lang: 0x58, script: 0x52, flags: 0x0}, - 50: {lang: 0x6, script: 0x2, flags: 0x1}, - 52: {lang: 0xa5, script: 0xe, flags: 0x0}, - 53: {lang: 0x365, script: 0x52, flags: 0x0}, - 54: {lang: 0x15d, script: 0x52, flags: 0x0}, - 55: {lang: 0x7e, script: 0x1e, flags: 0x0}, - 56: {lang: 0x3a, script: 0x5, flags: 0x0}, - 57: {lang: 0x3d7, script: 0x52, flags: 0x0}, - 58: {lang: 0x15d, script: 0x52, flags: 0x0}, - 59: {lang: 0x15d, script: 0x52, flags: 0x0}, - 61: {lang: 0x31d, script: 0x52, flags: 0x0}, - 62: {lang: 0x13d, script: 0x52, flags: 0x0}, - 63: {lang: 0x39f, script: 0x52, flags: 0x0}, - 64: {lang: 0x3be, script: 0x52, flags: 0x0}, - 66: {lang: 0x8, script: 0x2, flags: 0x1}, - 68: {lang: 0x0, script: 0x52, flags: 0x0}, - 70: {lang: 0x71, script: 0x1e, flags: 0x0}, - 72: {lang: 0x510, script: 0x37, flags: 0x2}, - 73: {lang: 0x31d, script: 0x5, flags: 0x2}, - 74: {lang: 0x443, script: 0x52, flags: 0x0}, - 75: {lang: 0x15d, script: 0x52, flags: 0x0}, - 76: {lang: 0x15d, script: 0x52, flags: 0x0}, - 77: {lang: 0x10c, script: 0x52, flags: 0x0}, - 78: {lang: 0x15d, script: 0x52, flags: 0x0}, - 80: {lang: 0x13d, script: 0x52, flags: 0x0}, - 81: {lang: 0x15d, script: 0x52, flags: 0x0}, - 82: {lang: 0xa, script: 0x5, flags: 0x1}, - 83: {lang: 0x13d, script: 0x52, flags: 0x0}, - 84: {lang: 0x0, script: 0x52, flags: 0x0}, - 85: {lang: 0x13d, script: 0x52, flags: 0x0}, - 88: {lang: 0x13d, script: 0x52, flags: 0x0}, - 89: {lang: 0x3be, script: 0x52, flags: 0x0}, - 90: {lang: 0x39f, script: 0x52, flags: 0x0}, - 92: {lang: 0xf, script: 0x2, flags: 0x1}, - 93: {lang: 0xf9, script: 0x52, flags: 0x0}, - 95: {lang: 0x10c, script: 0x52, flags: 0x0}, - 97: {lang: 0x1, script: 0x52, flags: 0x0}, - 98: {lang: 0x100, script: 0x52, flags: 0x0}, - 100: {lang: 0x13d, script: 0x52, flags: 0x0}, - 102: {lang: 0x11, script: 0x2, flags: 0x1}, - 103: {lang: 0x13d, script: 0x52, flags: 0x0}, - 104: {lang: 0x13d, script: 0x52, flags: 0x0}, - 105: {lang: 0x13f, script: 0x52, flags: 0x0}, - 106: {lang: 0x3a, script: 0x5, flags: 0x0}, - 107: {lang: 0x3a, script: 0x5, flags: 0x0}, - 108: {lang: 0x46d, script: 0x27, flags: 0x0}, - 109: {lang: 0x13d, script: 0x52, flags: 0x0}, - 110: {lang: 0x13, script: 0x2, flags: 0x1}, - 112: {lang: 0x10c, script: 0x52, flags: 0x0}, - 113: {lang: 0x150, script: 0x52, flags: 0x0}, - 114: {lang: 0x1be, script: 0x20, flags: 0x2}, - 117: {lang: 0x157, script: 0x52, flags: 0x0}, - 119: {lang: 0x15d, script: 0x52, flags: 0x0}, - 121: {lang: 0x15d, script: 0x52, flags: 0x0}, - 122: {lang: 0x15, script: 0x2, flags: 0x1}, - 124: {lang: 0x17, script: 0x3, flags: 0x1}, - 125: {lang: 0x15d, script: 0x52, flags: 0x0}, - 127: {lang: 0x21, script: 0x52, flags: 0x0}, - 129: {lang: 0x243, script: 0x52, flags: 0x0}, - 131: {lang: 0x15d, script: 0x52, flags: 0x0}, - 132: {lang: 0x15d, script: 0x52, flags: 0x0}, - 133: {lang: 0x13d, script: 0x52, flags: 0x0}, - 134: {lang: 0x1a, script: 0x2, flags: 0x1}, - 135: {lang: 0x0, script: 0x52, flags: 0x0}, - 136: {lang: 0x13d, script: 0x52, flags: 0x0}, - 138: {lang: 0x3be, script: 0x52, flags: 0x0}, - 140: {lang: 0x527, script: 0x35, flags: 0x0}, - 141: {lang: 0x0, script: 0x52, flags: 0x0}, - 142: {lang: 0x13d, script: 0x52, flags: 0x0}, - 143: {lang: 0x1cf, script: 0x52, flags: 0x0}, - 144: {lang: 0x1d2, script: 0x52, flags: 0x0}, - 145: {lang: 0x1d3, script: 0x52, flags: 0x0}, - 147: {lang: 0x13d, script: 0x52, flags: 0x0}, - 148: {lang: 0x1c, script: 0x2, flags: 0x1}, - 150: {lang: 0x1ba, script: 0x37, flags: 0x0}, - 152: {lang: 0x1e, script: 0x3, flags: 0x1}, - 154: {lang: 0x3a, script: 0x5, flags: 0x0}, - 155: {lang: 0x21, script: 0x2, flags: 0x1}, - 156: {lang: 0x1f6, script: 0x52, flags: 0x0}, - 157: {lang: 0x1f7, script: 0x52, flags: 0x0}, - 160: {lang: 0x3a, script: 0x5, flags: 0x0}, - 161: {lang: 0x1fe, script: 0x41, flags: 0x0}, - 163: {lang: 0x443, script: 0x52, flags: 0x0}, - 164: {lang: 0x288, script: 0x1e, flags: 0x0}, - 165: {lang: 0x23, script: 0x3, flags: 0x1}, - 167: {lang: 0x26, script: 0x2, flags: 0x1}, - 169: {lang: 0x252, script: 0x4b, flags: 0x0}, - 170: {lang: 0x252, script: 0x4b, flags: 0x0}, - 171: {lang: 0x3a, script: 0x5, flags: 0x0}, - 173: {lang: 0x3e0, script: 0x1e, flags: 0x0}, - 174: {lang: 0x28, script: 0x2, flags: 0x1}, - 175: {lang: 0x3a, script: 0x5, flags: 0x0}, - 177: {lang: 0x10c, script: 0x52, flags: 0x0}, - 178: {lang: 0x40a, script: 0xc1, flags: 0x0}, - 180: {lang: 0x439, script: 0x52, flags: 0x0}, - 181: {lang: 0x2be, script: 0x52, flags: 0x0}, - 182: {lang: 0x15d, script: 0x52, flags: 0x0}, - 183: {lang: 0x2c5, script: 0x52, flags: 0x0}, - 184: {lang: 0x3a, script: 0x5, flags: 0x0}, - 185: {lang: 0x2a, script: 0x2, flags: 0x1}, - 186: {lang: 0x15d, script: 0x52, flags: 0x0}, - 187: {lang: 0x2c, script: 0x2, flags: 0x1}, - 188: {lang: 0x430, script: 0x52, flags: 0x0}, - 189: {lang: 0x15d, script: 0x52, flags: 0x0}, - 190: {lang: 0x2ef, script: 0x52, flags: 0x0}, - 193: {lang: 0x2e, script: 0x2, flags: 0x1}, - 194: {lang: 0xa0, script: 0x52, flags: 0x0}, - 195: {lang: 0x30, script: 0x2, flags: 0x1}, - 196: {lang: 0x32, script: 0x2, flags: 0x1}, - 197: {lang: 0x34, script: 0x2, flags: 0x1}, - 199: {lang: 0x15d, script: 0x52, flags: 0x0}, - 200: {lang: 0x36, script: 0x2, flags: 0x1}, - 202: {lang: 0x31e, script: 0x52, flags: 0x0}, - 203: {lang: 0x38, script: 0x3, flags: 0x1}, - 204: {lang: 0x127, script: 0xd4, flags: 0x0}, - 206: {lang: 0x13d, script: 0x52, flags: 0x0}, - 207: {lang: 0x31d, script: 0x52, flags: 0x0}, - 208: {lang: 0x3be, script: 0x52, flags: 0x0}, - 209: {lang: 0x16, script: 0x52, flags: 0x0}, - 210: {lang: 0x15d, script: 0x52, flags: 0x0}, - 211: {lang: 0x1b2, script: 0x52, flags: 0x0}, - 213: {lang: 0x1b2, script: 0x5, flags: 0x2}, - 215: {lang: 0x13d, script: 0x52, flags: 0x0}, - 216: {lang: 0x365, script: 0x52, flags: 0x0}, - 217: {lang: 0x345, script: 0x52, flags: 0x0}, - 218: {lang: 0x34f, script: 0x20, flags: 0x0}, - 224: {lang: 0x3a, script: 0x5, flags: 0x0}, - 225: {lang: 0x13d, script: 0x52, flags: 0x0}, - 227: {lang: 0x13d, script: 0x52, flags: 0x0}, - 228: {lang: 0x15d, script: 0x52, flags: 0x0}, - 229: {lang: 0x484, script: 0x52, flags: 0x0}, - 230: {lang: 0x152, script: 0x52, flags: 0x0}, - 231: {lang: 0x3b, script: 0x3, flags: 0x1}, - 232: {lang: 0x3b1, script: 0x52, flags: 0x0}, - 233: {lang: 0x15d, script: 0x52, flags: 0x0}, - 235: {lang: 0x13d, script: 0x52, flags: 0x0}, - 236: {lang: 0x3a, script: 0x5, flags: 0x0}, - 237: {lang: 0x3be, script: 0x52, flags: 0x0}, - 239: {lang: 0x3a0, script: 0x52, flags: 0x0}, - 240: {lang: 0x192, script: 0x52, flags: 0x0}, - 242: {lang: 0x3a, script: 0x5, flags: 0x0}, - 257: {lang: 0x15d, script: 0x52, flags: 0x0}, - 259: {lang: 0x3e, script: 0x2, flags: 0x1}, - 260: {lang: 0x430, script: 0x1e, flags: 0x0}, - 261: {lang: 0x40, script: 0x2, flags: 0x1}, - 262: {lang: 0x3e3, script: 0x52, flags: 0x0}, - 263: {lang: 0x3a, script: 0x5, flags: 0x0}, - 265: {lang: 0x15d, script: 0x52, flags: 0x0}, - 266: {lang: 0x3a, script: 0x5, flags: 0x0}, - 267: {lang: 0x42, script: 0x2, flags: 0x1}, - 270: {lang: 0x414, script: 0x52, flags: 0x0}, - 271: {lang: 0x345, script: 0x52, flags: 0x0}, - 272: {lang: 0x44, script: 0x2, flags: 0x1}, - 274: {lang: 0x1f7, script: 0x52, flags: 0x0}, - 275: {lang: 0x15d, script: 0x52, flags: 0x0}, - 276: {lang: 0x427, script: 0x52, flags: 0x0}, - 277: {lang: 0x365, script: 0x52, flags: 0x0}, - 279: {lang: 0x3be, script: 0x52, flags: 0x0}, - 281: {lang: 0x13d, script: 0x52, flags: 0x0}, - 283: {lang: 0x46, script: 0x2, flags: 0x1}, - 287: {lang: 0x15d, script: 0x52, flags: 0x0}, - 288: {lang: 0x15d, script: 0x52, flags: 0x0}, - 289: {lang: 0x48, script: 0x2, flags: 0x1}, - 290: {lang: 0x4a, script: 0x3, flags: 0x1}, - 291: {lang: 0x4d, script: 0x2, flags: 0x1}, - 292: {lang: 0x475, script: 0x52, flags: 0x0}, - 293: {lang: 0x3be, script: 0x52, flags: 0x0}, - 294: {lang: 0x474, script: 0x52, flags: 0x0}, - 295: {lang: 0x4f, script: 0x2, flags: 0x1}, - 296: {lang: 0x480, script: 0x52, flags: 0x0}, - 298: {lang: 0x51, script: 0x4, flags: 0x1}, - 300: {lang: 0x49e, script: 0x52, flags: 0x0}, - 301: {lang: 0x55, script: 0x2, flags: 0x1}, - 302: {lang: 0x443, script: 0x52, flags: 0x0}, - 303: {lang: 0x57, script: 0x3, flags: 0x1}, - 304: {lang: 0x443, script: 0x52, flags: 0x0}, - 308: {lang: 0x510, script: 0x37, flags: 0x2}, - 309: {lang: 0x13d, script: 0x52, flags: 0x0}, - 310: {lang: 0x4ba, script: 0x52, flags: 0x0}, - 311: {lang: 0x1f7, script: 0x52, flags: 0x0}, - 314: {lang: 0x13d, script: 0x52, flags: 0x0}, - 317: {lang: 0x4c1, script: 0x52, flags: 0x0}, - 318: {lang: 0x8a, script: 0x52, flags: 0x0}, - 319: {lang: 0x15d, script: 0x52, flags: 0x0}, - 321: {lang: 0x419, script: 0x52, flags: 0x0}, - 332: {lang: 0x5a, script: 0x2, flags: 0x1}, - 349: {lang: 0x3a, script: 0x5, flags: 0x0}, - 350: {lang: 0x5c, script: 0x2, flags: 0x1}, - 355: {lang: 0x421, script: 0x52, flags: 0x0}, -} - -// likelyRegionList holds lists info associated with likelyRegion. -// Size: 376 bytes, 94 elements -var likelyRegionList = [94]likelyLangScript{ - 0: {lang: 0x147, script: 0x5, flags: 0x0}, - 1: {lang: 0x474, script: 0x52, flags: 0x0}, - 2: {lang: 0x42f, script: 0x52, flags: 0x0}, - 3: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 4: {lang: 0x1d5, script: 0x8, flags: 0x0}, - 5: {lang: 0x272, script: 0x52, flags: 0x0}, - 6: {lang: 0xb7, script: 0x52, flags: 0x0}, - 7: {lang: 0x430, script: 0x1e, flags: 0x0}, - 8: {lang: 0x12c, script: 0xd6, flags: 0x0}, - 9: {lang: 0x34f, script: 0x20, flags: 0x0}, - 10: {lang: 0x527, script: 0x34, flags: 0x0}, - 11: {lang: 0x4aa, script: 0x5, flags: 0x0}, - 12: {lang: 0x51d, script: 0x35, flags: 0x0}, - 13: {lang: 0x521, script: 0x52, flags: 0x0}, - 14: {lang: 0x298, script: 0xd5, flags: 0x0}, - 15: {lang: 0x135, script: 0x2d, flags: 0x0}, - 16: {lang: 0x488, script: 0x52, flags: 0x0}, - 17: {lang: 0x3a, script: 0x5, flags: 0x0}, - 18: {lang: 0x15d, script: 0x52, flags: 0x0}, - 19: {lang: 0x27, script: 0x27, flags: 0x0}, - 20: {lang: 0x138, script: 0x52, flags: 0x0}, - 21: {lang: 0x268, script: 0x5, flags: 0x2}, - 22: {lang: 0x510, script: 0x37, flags: 0x2}, - 23: {lang: 0x20e, script: 0x29, flags: 0x0}, - 24: {lang: 0x5, script: 0x1e, flags: 0x0}, - 25: {lang: 0x272, script: 0x52, flags: 0x0}, - 26: {lang: 0x135, script: 0x2d, flags: 0x0}, - 27: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 28: {lang: 0x1df, script: 0x52, flags: 0x0}, - 29: {lang: 0x31d, script: 0x5, flags: 0x0}, - 30: {lang: 0x1bc, script: 0x20, flags: 0x0}, - 31: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 32: {lang: 0x234, script: 0x6b, flags: 0x0}, - 33: {lang: 0x147, script: 0x5, flags: 0x0}, - 34: {lang: 0x474, script: 0x52, flags: 0x0}, - 35: {lang: 0x248, script: 0x46, flags: 0x0}, - 36: {lang: 0xe6, script: 0x5, flags: 0x0}, - 37: {lang: 0x224, script: 0xd5, flags: 0x0}, - 38: {lang: 0x3a, script: 0x5, flags: 0x0}, - 39: {lang: 0x15d, script: 0x52, flags: 0x0}, - 40: {lang: 0x2b6, script: 0x4f, flags: 0x0}, - 41: {lang: 0x224, script: 0xd5, flags: 0x0}, - 42: {lang: 0x3a, script: 0x5, flags: 0x0}, - 43: {lang: 0x15d, script: 0x52, flags: 0x0}, - 44: {lang: 0x3da, script: 0x52, flags: 0x0}, - 45: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 46: {lang: 0x2fd, script: 0x1e, flags: 0x0}, - 47: {lang: 0x42f, script: 0x52, flags: 0x0}, - 48: {lang: 0x32f, script: 0x6b, flags: 0x0}, - 49: {lang: 0x211, script: 0x52, flags: 0x0}, - 50: {lang: 0x309, script: 0x1e, flags: 0x0}, - 51: {lang: 0x240, script: 0x5, flags: 0x0}, - 52: {lang: 0x527, script: 0x35, flags: 0x0}, - 53: {lang: 0x3be, script: 0x52, flags: 0x0}, - 54: {lang: 0x3a, script: 0x5, flags: 0x0}, - 55: {lang: 0x15d, script: 0x52, flags: 0x0}, - 56: {lang: 0x2eb, script: 0x52, flags: 0x0}, - 57: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 58: {lang: 0x88, script: 0x20, flags: 0x0}, - 59: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 60: {lang: 0x4b2, script: 0x5, flags: 0x0}, - 61: {lang: 0xbe, script: 0x20, flags: 0x0}, - 62: {lang: 0x3da, script: 0x52, flags: 0x0}, - 63: {lang: 0x7e, script: 0x1e, flags: 0x0}, - 64: {lang: 0x3e0, script: 0x1e, flags: 0x0}, - 65: {lang: 0x265, script: 0x52, flags: 0x0}, - 66: {lang: 0x442, script: 0x52, flags: 0x0}, - 67: {lang: 0x510, script: 0x37, flags: 0x0}, - 68: {lang: 0x410, script: 0x52, flags: 0x0}, - 69: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 70: {lang: 0x3a, script: 0x5, flags: 0x0}, - 71: {lang: 0x15d, script: 0x52, flags: 0x0}, - 72: {lang: 0x15d, script: 0x52, flags: 0x0}, - 73: {lang: 0x35, script: 0x5, flags: 0x0}, - 74: {lang: 0x469, script: 0xd5, flags: 0x0}, - 75: {lang: 0x2ea, script: 0x5, flags: 0x0}, - 76: {lang: 0x30d, script: 0x6b, flags: 0x0}, - 77: {lang: 0x465, script: 0x1e, flags: 0x0}, - 78: {lang: 0x147, script: 0x5, flags: 0x0}, - 79: {lang: 0x3a, script: 0x5, flags: 0x0}, - 80: {lang: 0x15d, script: 0x52, flags: 0x0}, - 81: {lang: 0x488, script: 0x52, flags: 0x0}, - 82: {lang: 0x58, script: 0x5, flags: 0x0}, - 83: {lang: 0x217, script: 0x1e, flags: 0x0}, - 84: {lang: 0x81, script: 0x2d, flags: 0x0}, - 85: {lang: 0x527, script: 0x35, flags: 0x0}, - 86: {lang: 0x48a, script: 0x52, flags: 0x0}, - 87: {lang: 0x4ac, script: 0x1e, flags: 0x0}, - 88: {lang: 0x510, script: 0x37, flags: 0x0}, - 89: {lang: 0x3b1, script: 0x52, flags: 0x0}, - 90: {lang: 0x42f, script: 0x52, flags: 0x0}, - 91: {lang: 0x430, script: 0x1e, flags: 0x0}, - 92: {lang: 0x15d, script: 0x52, flags: 0x0}, - 93: {lang: 0x444, script: 0x5, flags: 0x0}, -} - -type likelyTag struct { - lang uint16 - region uint16 - script uint8 -} - -// Size: 192 bytes, 32 elements -var likelyRegionGroup = [32]likelyTag{ - 1: {lang: 0x138, region: 0xd5, script: 0x52}, - 2: {lang: 0x138, region: 0x134, script: 0x52}, - 3: {lang: 0x3be, region: 0x40, script: 0x52}, - 4: {lang: 0x138, region: 0x2e, script: 0x52}, - 5: {lang: 0x138, region: 0xd5, script: 0x52}, - 6: {lang: 0x13d, region: 0xce, script: 0x52}, - 7: {lang: 0x443, region: 0x12e, script: 0x52}, - 8: {lang: 0x3a, region: 0x6a, script: 0x5}, - 9: {lang: 0x443, region: 0x4a, script: 0x52}, - 10: {lang: 0x138, region: 0x160, script: 0x52}, - 11: {lang: 0x138, region: 0x134, script: 0x52}, - 12: {lang: 0x138, region: 0x134, script: 0x52}, - 13: {lang: 0x13d, region: 0x58, script: 0x52}, - 14: {lang: 0x527, region: 0x52, script: 0x34}, - 15: {lang: 0x1bc, region: 0x98, script: 0x20}, - 16: {lang: 0x1df, region: 0x94, script: 0x52}, - 17: {lang: 0x1f7, region: 0x9d, script: 0x52}, - 18: {lang: 0x138, region: 0x2e, script: 0x52}, - 19: {lang: 0x138, region: 0xe5, script: 0x52}, - 20: {lang: 0x138, region: 0x89, script: 0x52}, - 21: {lang: 0x419, region: 0x141, script: 0x52}, - 22: {lang: 0x527, region: 0x52, script: 0x34}, - 23: {lang: 0x4ba, region: 0x136, script: 0x52}, - 24: {lang: 0x3a, region: 0x107, script: 0x5}, - 25: {lang: 0x3e0, region: 0x105, script: 0x1e}, - 26: {lang: 0x3e0, region: 0x105, script: 0x1e}, - 27: {lang: 0x138, region: 0x7a, script: 0x52}, - 28: {lang: 0x10c, region: 0x5f, script: 0x52}, - 29: {lang: 0x13d, region: 0x1e, script: 0x52}, - 30: {lang: 0x138, region: 0x99, script: 0x52}, - 31: {lang: 0x138, region: 0x7a, script: 0x52}, -} - -// Size: 357 bytes, 357 elements -var regionToGroups = [357]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x04, 0x01, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x04, 0x04, - // Entry 40 - 7F - 0x04, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, - 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x04, 0x00, 0x08, 0x00, - 0x04, 0x00, 0x00, 0x08, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, - // Entry 80 - BF - 0x00, 0x04, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x04, 0x01, 0x00, 0x04, 0x02, 0x00, 0x04, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x08, 0x08, 0x00, 0x00, 0x00, 0x04, 0x00, 0x01, - // Entry C0 - FF - 0x00, 0x00, 0x00, 0x00, 0x00, 0x02, 0x01, 0x04, - 0x08, 0x04, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x04, 0x00, 0x05, 0x00, 0x00, 0x00, 0x00, - 0x04, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - // Entry 100 - 13F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, - 0x00, 0x04, 0x04, 0x00, 0x00, 0x00, 0x04, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x08, - 0x00, 0x00, 0x00, 0x04, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x01, 0x00, 0x05, 0x04, 0x00, 0x00, - 0x04, 0x00, 0x04, 0x04, 0x05, 0x00, 0x00, 0x00, - // Entry 140 - 17F - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, - 0x00, 0x00, 0x00, 0x00, 0x00, -} - -type mutualIntelligibility struct { - want uint16 - have uint16 - distance uint8 - oneway bool -} - -type scriptIntelligibility struct { - wantLang uint16 - haveLang uint16 - wantScript uint8 - haveScript uint8 - distance uint8 -} - -type regionIntelligibility struct { - lang uint16 - script uint8 - group uint8 - distance uint8 -} - -// matchLang holds pairs of langIDs of base languages that are typically -// mutually intelligible. Each pair is associated with a confidence and -// whether the intelligibility goes one or both ways. -// Size: 690 bytes, 115 elements -var matchLang = [115]mutualIntelligibility{ - 0: {want: 0x1cf, have: 0xb7, distance: 0x4, oneway: false}, - 1: {want: 0x405, have: 0xb7, distance: 0x4, oneway: false}, - 2: {want: 0x405, have: 0x1cf, distance: 0x4, oneway: false}, - 3: {want: 0x405, have: 0x430, distance: 0x4, oneway: false}, - 4: {want: 0x438, have: 0x1, distance: 0x4, oneway: false}, - 5: {want: 0x1a1, have: 0x10c, distance: 0x4, oneway: true}, - 6: {want: 0x293, have: 0x10c, distance: 0x4, oneway: true}, - 7: {want: 0x430, have: 0x1cf, distance: 0x5, oneway: false}, - 8: {want: 0x430, have: 0xb7, distance: 0x5, oneway: false}, - 9: {want: 0x100, have: 0x36d, distance: 0x8, oneway: false}, - 10: {want: 0x100, have: 0x345, distance: 0x8, oneway: false}, - 11: {want: 0x5, have: 0x3e0, distance: 0xa, oneway: true}, - 12: {want: 0xd, have: 0x138, distance: 0xa, oneway: true}, - 13: {want: 0x16, have: 0x365, distance: 0xa, oneway: true}, - 14: {want: 0x21, have: 0x138, distance: 0xa, oneway: true}, - 15: {want: 0x56, have: 0x13d, distance: 0xa, oneway: true}, - 16: {want: 0x58, have: 0x3e0, distance: 0xa, oneway: true}, - 17: {want: 0x71, have: 0x3e0, distance: 0xa, oneway: true}, - 18: {want: 0x75, have: 0x138, distance: 0xa, oneway: true}, - 19: {want: 0x82, have: 0x1bc, distance: 0xa, oneway: true}, - 20: {want: 0xa5, have: 0x138, distance: 0xa, oneway: true}, - 21: {want: 0xb2, have: 0x15d, distance: 0xa, oneway: true}, - 22: {want: 0xdd, have: 0x152, distance: 0xa, oneway: true}, - 23: {want: 0xe5, have: 0x138, distance: 0xa, oneway: true}, - 24: {want: 0xe9, have: 0x3a, distance: 0xa, oneway: true}, - 25: {want: 0xef, have: 0x15d, distance: 0xa, oneway: true}, - 26: {want: 0xf8, have: 0x15d, distance: 0xa, oneway: true}, - 27: {want: 0xff, have: 0x138, distance: 0xa, oneway: true}, - 28: {want: 0x12f, have: 0x138, distance: 0xa, oneway: true}, - 29: {want: 0x13b, have: 0x138, distance: 0xa, oneway: true}, - 30: {want: 0x13f, have: 0x150, distance: 0xa, oneway: true}, - 31: {want: 0x144, have: 0x13d, distance: 0xa, oneway: true}, - 32: {want: 0x157, have: 0x100, distance: 0xa, oneway: true}, - 33: {want: 0x16c, have: 0x365, distance: 0xa, oneway: true}, - 34: {want: 0x16d, have: 0x138, distance: 0xa, oneway: true}, - 35: {want: 0x16e, have: 0x138, distance: 0xa, oneway: true}, - 36: {want: 0x17c, have: 0x138, distance: 0xa, oneway: true}, - 37: {want: 0x18e, have: 0x13d, distance: 0xa, oneway: true}, - 38: {want: 0x192, have: 0x13d, distance: 0xa, oneway: true}, - 39: {want: 0x1a2, have: 0x1bc, distance: 0xa, oneway: true}, - 40: {want: 0x1b2, have: 0x138, distance: 0xa, oneway: true}, - 41: {want: 0x1b6, have: 0x138, distance: 0xa, oneway: true}, - 42: {want: 0x1d2, have: 0x15d, distance: 0xa, oneway: true}, - 43: {want: 0x1d5, have: 0x3e0, distance: 0xa, oneway: true}, - 44: {want: 0x1d7, have: 0x138, distance: 0xa, oneway: true}, - 45: {want: 0x1e5, have: 0x138, distance: 0xa, oneway: true}, - 46: {want: 0x1f6, have: 0x138, distance: 0xa, oneway: true}, - 47: {want: 0x20c, have: 0x1df, distance: 0xa, oneway: true}, - 48: {want: 0x20e, have: 0x138, distance: 0xa, oneway: true}, - 49: {want: 0x22b, have: 0x15d, distance: 0xa, oneway: true}, - 50: {want: 0x240, have: 0x3e0, distance: 0xa, oneway: true}, - 51: {want: 0x248, have: 0x138, distance: 0xa, oneway: true}, - 52: {want: 0x24f, have: 0x138, distance: 0xa, oneway: true}, - 53: {want: 0x263, have: 0x138, distance: 0xa, oneway: true}, - 54: {want: 0x272, have: 0x488, distance: 0xa, oneway: true}, - 55: {want: 0x288, have: 0x3e0, distance: 0xa, oneway: true}, - 56: {want: 0x28c, have: 0x1f7, distance: 0xa, oneway: true}, - 57: {want: 0x2a1, have: 0x138, distance: 0xa, oneway: true}, - 58: {want: 0x2b3, have: 0x15d, distance: 0xa, oneway: true}, - 59: {want: 0x2b6, have: 0x138, distance: 0xa, oneway: true}, - 60: {want: 0x2bc, have: 0x138, distance: 0xa, oneway: true}, - 61: {want: 0x2c1, have: 0x15d, distance: 0xa, oneway: true}, - 62: {want: 0x2eb, have: 0x138, distance: 0xa, oneway: true}, - 63: {want: 0x2ef, have: 0x15d, distance: 0xa, oneway: true}, - 64: {want: 0x2f8, have: 0x138, distance: 0xa, oneway: true}, - 65: {want: 0x2fd, have: 0x7e, distance: 0xa, oneway: true}, - 66: {want: 0x302, have: 0x138, distance: 0xa, oneway: true}, - 67: {want: 0x309, have: 0x3e0, distance: 0xa, oneway: true}, - 68: {want: 0x319, have: 0x1bc, distance: 0xa, oneway: true}, - 69: {want: 0x31d, have: 0x1df, distance: 0xa, oneway: true}, - 70: {want: 0x31e, have: 0x138, distance: 0xa, oneway: true}, - 71: {want: 0x32f, have: 0x138, distance: 0xa, oneway: true}, - 72: {want: 0x34f, have: 0x138, distance: 0xa, oneway: true}, - 73: {want: 0x368, have: 0x345, distance: 0xa, oneway: false}, - 74: {want: 0x368, have: 0x36d, distance: 0xa, oneway: true}, - 75: {want: 0x378, have: 0x138, distance: 0xa, oneway: true}, - 76: {want: 0x385, have: 0x138, distance: 0xa, oneway: true}, - 77: {want: 0x387, have: 0x138, distance: 0xa, oneway: true}, - 78: {want: 0x389, have: 0x15d, distance: 0xa, oneway: true}, - 79: {want: 0x38e, have: 0x138, distance: 0xa, oneway: true}, - 80: {want: 0x393, have: 0x138, distance: 0xa, oneway: true}, - 81: {want: 0x39b, have: 0x138, distance: 0xa, oneway: true}, - 82: {want: 0x3a3, have: 0x138, distance: 0xa, oneway: true}, - 83: {want: 0x3bc, have: 0x138, distance: 0xa, oneway: true}, - 84: {want: 0x3c2, have: 0x13d, distance: 0xa, oneway: true}, - 85: {want: 0x3d2, have: 0x10c, distance: 0xa, oneway: true}, - 86: {want: 0x3d7, have: 0x138, distance: 0xa, oneway: true}, - 87: {want: 0x3e3, have: 0x15d, distance: 0xa, oneway: true}, - 88: {want: 0x3e7, have: 0x1bc, distance: 0xa, oneway: true}, - 89: {want: 0x3f8, have: 0x138, distance: 0xa, oneway: true}, - 90: {want: 0x40a, have: 0x138, distance: 0xa, oneway: true}, - 91: {want: 0x421, have: 0x138, distance: 0xa, oneway: true}, - 92: {want: 0x427, have: 0x138, distance: 0xa, oneway: true}, - 93: {want: 0x42f, have: 0x138, distance: 0xa, oneway: true}, - 94: {want: 0x439, have: 0x138, distance: 0xa, oneway: true}, - 95: {want: 0x43c, have: 0x1df, distance: 0xa, oneway: true}, - 96: {want: 0x443, have: 0x138, distance: 0xa, oneway: true}, - 97: {want: 0x44e, have: 0x138, distance: 0xa, oneway: true}, - 98: {want: 0x45f, have: 0x138, distance: 0xa, oneway: true}, - 99: {want: 0x465, have: 0x3e0, distance: 0xa, oneway: true}, - 100: {want: 0x46d, have: 0x138, distance: 0xa, oneway: true}, - 101: {want: 0x474, have: 0x3e0, distance: 0xa, oneway: true}, - 102: {want: 0x3880, have: 0x138, distance: 0xa, oneway: true}, - 103: {want: 0x47e, have: 0x138, distance: 0xa, oneway: true}, - 104: {want: 0x480, have: 0x138, distance: 0xa, oneway: true}, - 105: {want: 0x492, have: 0x3e0, distance: 0xa, oneway: true}, - 106: {want: 0x49b, have: 0x138, distance: 0xa, oneway: true}, - 107: {want: 0x4aa, have: 0x527, distance: 0xa, oneway: true}, - 108: {want: 0x4b2, have: 0x138, distance: 0xa, oneway: true}, - 109: {want: 0x4ba, have: 0x3e0, distance: 0xa, oneway: true}, - 110: {want: 0x4e3, have: 0x15d, distance: 0xa, oneway: true}, - 111: {want: 0x4f0, have: 0x138, distance: 0xa, oneway: true}, - 112: {want: 0x510, have: 0x138, distance: 0xa, oneway: true}, - 113: {want: 0x516, have: 0x138, distance: 0xa, oneway: true}, - 114: {want: 0x52c, have: 0x138, distance: 0xa, oneway: true}, -} - -// matchScript holds pairs of scriptIDs where readers of one script -// can typically also read the other. Each is associated with a confidence. -// Size: 208 bytes, 26 elements -var matchScript = [26]scriptIntelligibility{ - 0: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x52, haveScript: 0x1e, distance: 0x5}, - 1: {wantLang: 0x430, haveLang: 0x430, wantScript: 0x1e, haveScript: 0x52, distance: 0x5}, - 2: {wantLang: 0x58, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, - 3: {wantLang: 0xa5, haveLang: 0x138, wantScript: 0xe, haveScript: 0x52, distance: 0xa}, - 4: {wantLang: 0x1d5, haveLang: 0x3e0, wantScript: 0x8, haveScript: 0x1e, distance: 0xa}, - 5: {wantLang: 0x20e, haveLang: 0x138, wantScript: 0x29, haveScript: 0x52, distance: 0xa}, - 6: {wantLang: 0x248, haveLang: 0x138, wantScript: 0x46, haveScript: 0x52, distance: 0xa}, - 7: {wantLang: 0x24f, haveLang: 0x138, wantScript: 0x4a, haveScript: 0x52, distance: 0xa}, - 8: {wantLang: 0x2b6, haveLang: 0x138, wantScript: 0x4f, haveScript: 0x52, distance: 0xa}, - 9: {wantLang: 0x302, haveLang: 0x138, wantScript: 0x64, haveScript: 0x52, distance: 0xa}, - 10: {wantLang: 0x32f, haveLang: 0x138, wantScript: 0x6b, haveScript: 0x52, distance: 0xa}, - 11: {wantLang: 0x34f, haveLang: 0x138, wantScript: 0x20, haveScript: 0x52, distance: 0xa}, - 12: {wantLang: 0x393, haveLang: 0x138, wantScript: 0x75, haveScript: 0x52, distance: 0xa}, - 13: {wantLang: 0x39b, haveLang: 0x138, wantScript: 0x2f, haveScript: 0x52, distance: 0xa}, - 14: {wantLang: 0x3bc, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, - 15: {wantLang: 0x3f8, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, - 16: {wantLang: 0x40a, haveLang: 0x138, wantScript: 0xc1, haveScript: 0x52, distance: 0xa}, - 17: {wantLang: 0x44e, haveLang: 0x138, wantScript: 0xcd, haveScript: 0x52, distance: 0xa}, - 18: {wantLang: 0x45f, haveLang: 0x138, wantScript: 0xd0, haveScript: 0x52, distance: 0xa}, - 19: {wantLang: 0x46d, haveLang: 0x138, wantScript: 0x27, haveScript: 0x52, distance: 0xa}, - 20: {wantLang: 0x474, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, - 21: {wantLang: 0x4b2, haveLang: 0x138, wantScript: 0x5, haveScript: 0x52, distance: 0xa}, - 22: {wantLang: 0x4ba, haveLang: 0x3e0, wantScript: 0x52, haveScript: 0x1e, distance: 0xa}, - 23: {wantLang: 0x510, haveLang: 0x138, wantScript: 0x37, haveScript: 0x52, distance: 0xa}, - 24: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x34, haveScript: 0x35, distance: 0xf}, - 25: {wantLang: 0x527, haveLang: 0x527, wantScript: 0x35, haveScript: 0x34, distance: 0x13}, -} - -// Size: 90 bytes, 15 elements -var matchRegion = [15]regionIntelligibility{ - 0: {lang: 0x3a, script: 0x0, group: 0x4, distance: 0x4}, - 1: {lang: 0x3a, script: 0x0, group: 0x84, distance: 0x4}, - 2: {lang: 0x138, script: 0x0, group: 0x1, distance: 0x4}, - 3: {lang: 0x138, script: 0x0, group: 0x81, distance: 0x4}, - 4: {lang: 0x13d, script: 0x0, group: 0x3, distance: 0x4}, - 5: {lang: 0x13d, script: 0x0, group: 0x83, distance: 0x4}, - 6: {lang: 0x3be, script: 0x0, group: 0x3, distance: 0x4}, - 7: {lang: 0x3be, script: 0x0, group: 0x83, distance: 0x4}, - 8: {lang: 0x527, script: 0x35, group: 0x2, distance: 0x4}, - 9: {lang: 0x527, script: 0x35, group: 0x82, distance: 0x4}, - 10: {lang: 0x3a, script: 0x0, group: 0x80, distance: 0x5}, - 11: {lang: 0x138, script: 0x0, group: 0x80, distance: 0x5}, - 12: {lang: 0x13d, script: 0x0, group: 0x80, distance: 0x5}, - 13: {lang: 0x3be, script: 0x0, group: 0x80, distance: 0x5}, - 14: {lang: 0x527, script: 0x35, group: 0x80, distance: 0x5}, -} - -// Size: 128 bytes, 32 elements -var regionContainment = [32]uint32{ - 0xffffffff, 0x000007a2, 0x00003044, 0x00000008, - 0x403c0010, 0x00000020, 0x00000040, 0x00000080, - 0x00000100, 0x00000200, 0x00000400, 0x2000384c, - 0x00001000, 0x00002000, 0x00004000, 0x00008000, - 0x00010000, 0x00020000, 0x00040000, 0x00080000, - 0x00100000, 0x00200000, 0x01c1c000, 0x00800000, - 0x01000000, 0x1e020000, 0x04000000, 0x08000000, - 0x10000000, 0x20002048, 0x40000000, 0x80000000, -} - -// regionInclusion maps region identifiers to sets of regions in regionInclusionBits, -// where each set holds all groupings that are directly connected in a region -// containment graph. -// Size: 357 bytes, 357 elements -var regionInclusion = [357]uint8{ - // Entry 0 - 3F - 0x00, 0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, - 0x07, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, - 0x0f, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16, - 0x17, 0x18, 0x19, 0x1a, 0x1b, 0x1c, 0x1d, 0x20, - 0x21, 0x22, 0x23, 0x24, 0x25, 0x25, 0x22, 0x23, - 0x25, 0x26, 0x21, 0x27, 0x28, 0x29, 0x2a, 0x25, - 0x2b, 0x23, 0x22, 0x25, 0x24, 0x29, 0x2c, 0x2d, - 0x23, 0x2e, 0x2c, 0x25, 0x2f, 0x30, 0x27, 0x25, - // Entry 40 - 7F - 0x27, 0x25, 0x24, 0x30, 0x21, 0x31, 0x32, 0x33, - 0x2f, 0x21, 0x26, 0x26, 0x26, 0x34, 0x2c, 0x28, - 0x27, 0x26, 0x35, 0x27, 0x21, 0x33, 0x22, 0x20, - 0x25, 0x2c, 0x25, 0x21, 0x36, 0x2d, 0x34, 0x29, - 0x21, 0x2e, 0x37, 0x25, 0x25, 0x20, 0x38, 0x38, - 0x27, 0x37, 0x38, 0x38, 0x2e, 0x39, 0x2e, 0x1f, - 0x20, 0x37, 0x3a, 0x27, 0x3b, 0x2b, 0x20, 0x29, - 0x34, 0x26, 0x37, 0x25, 0x23, 0x27, 0x2b, 0x2c, - // Entry 80 - BF - 0x22, 0x2f, 0x2c, 0x2c, 0x25, 0x26, 0x39, 0x21, - 0x33, 0x3b, 0x2c, 0x27, 0x35, 0x21, 0x33, 0x39, - 0x25, 0x2d, 0x20, 0x38, 0x30, 0x37, 0x23, 0x2b, - 0x24, 0x21, 0x23, 0x24, 0x2b, 0x39, 0x2b, 0x25, - 0x23, 0x35, 0x20, 0x2e, 0x3c, 0x30, 0x3b, 0x2e, - 0x25, 0x35, 0x35, 0x23, 0x25, 0x3c, 0x30, 0x23, - 0x25, 0x34, 0x24, 0x2c, 0x31, 0x37, 0x29, 0x37, - 0x38, 0x38, 0x34, 0x32, 0x22, 0x25, 0x2e, 0x3b, - // Entry C0 - FF - 0x20, 0x22, 0x2c, 0x30, 0x35, 0x35, 0x3b, 0x25, - 0x2c, 0x25, 0x39, 0x2e, 0x24, 0x2e, 0x33, 0x30, - 0x2e, 0x31, 0x3a, 0x2c, 0x2a, 0x2c, 0x20, 0x33, - 0x29, 0x2b, 0x24, 0x20, 0x3b, 0x23, 0x28, 0x2a, - 0x23, 0x33, 0x20, 0x27, 0x28, 0x3a, 0x30, 0x24, - 0x2d, 0x2f, 0x28, 0x25, 0x23, 0x39, 0x20, 0x3b, - 0x27, 0x20, 0x23, 0x20, 0x20, 0x1e, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - // Entry 100 - 13F - 0x20, 0x2e, 0x20, 0x2d, 0x22, 0x32, 0x2e, 0x23, - 0x3a, 0x2e, 0x38, 0x37, 0x30, 0x2c, 0x39, 0x2b, - 0x2d, 0x2c, 0x22, 0x2c, 0x2e, 0x27, 0x2e, 0x26, - 0x32, 0x33, 0x25, 0x23, 0x31, 0x21, 0x25, 0x26, - 0x21, 0x2c, 0x30, 0x3c, 0x28, 0x30, 0x3c, 0x38, - 0x28, 0x30, 0x23, 0x25, 0x28, 0x35, 0x2e, 0x32, - 0x2e, 0x20, 0x21, 0x20, 0x2f, 0x27, 0x3c, 0x22, - 0x25, 0x20, 0x27, 0x25, 0x25, 0x30, 0x3a, 0x28, - // Entry 140 - 17F - 0x20, 0x28, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x22, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, 0x20, - 0x20, 0x20, 0x20, 0x20, 0x23, 0x23, 0x2e, 0x22, - 0x31, 0x2e, 0x26, 0x2e, 0x20, -} - -// regionInclusionBits is an array of bit vectors where every vector represents -// a set of region groupings. These sets are used to compute the distance -// between two regions for the purpose of language matching. -// Size: 288 bytes, 72 elements -var regionInclusionBits = [72]uint32{ - // Entry 0 - 1F - 0x82400813, 0x000007a3, 0x00003844, 0x20000808, - 0x403c0011, 0x00000022, 0x20000844, 0x00000082, - 0x00000102, 0x00000202, 0x00000402, 0x2000384d, - 0x00001804, 0x20002804, 0x00404000, 0x00408000, - 0x00410000, 0x02020000, 0x00040010, 0x00080010, - 0x00100010, 0x00200010, 0x01c1c001, 0x00c00000, - 0x01400000, 0x1e020001, 0x06000000, 0x0a000000, - 0x12000000, 0x20002848, 0x40000010, 0x80000001, - // Entry 20 - 3F - 0x00000001, 0x40000000, 0x00020000, 0x01000000, - 0x00008000, 0x00002000, 0x00000200, 0x00000008, - 0x00200000, 0x90000000, 0x00040000, 0x08000000, - 0x00000020, 0x84000000, 0x00000080, 0x00001000, - 0x00010000, 0x00000400, 0x04000000, 0x00000040, - 0x10000000, 0x00004000, 0x81000000, 0x88000000, - 0x00000100, 0x80020000, 0x00080000, 0x00100000, - 0x00800000, 0xffffffff, 0x82400fb3, 0xc27c0813, - // Entry 40 - 5F - 0xa240385f, 0x83c1c813, 0x9e420813, 0x92000001, - 0x86000001, 0x81400001, 0x8a000001, 0x82020001, -} - -// regionInclusionNext marks, for each entry in regionInclusionBits, the set of -// all groups that are reachable from the groups set in the respective entry. -// Size: 72 bytes, 72 elements -var regionInclusionNext = [72]uint8{ - // Entry 0 - 3F - 0x3d, 0x3e, 0x0b, 0x0b, 0x3f, 0x01, 0x0b, 0x01, - 0x01, 0x01, 0x01, 0x40, 0x0b, 0x0b, 0x16, 0x16, - 0x16, 0x19, 0x04, 0x04, 0x04, 0x04, 0x41, 0x16, - 0x16, 0x42, 0x19, 0x19, 0x19, 0x0b, 0x04, 0x00, - 0x00, 0x1e, 0x11, 0x18, 0x0f, 0x0d, 0x09, 0x03, - 0x15, 0x43, 0x12, 0x1b, 0x05, 0x44, 0x07, 0x0c, - 0x10, 0x0a, 0x1a, 0x06, 0x1c, 0x0e, 0x45, 0x46, - 0x08, 0x47, 0x13, 0x14, 0x17, 0x3d, 0x3d, 0x3d, - // Entry 40 - 7F - 0x3d, 0x3d, 0x3d, 0x42, 0x42, 0x41, 0x42, 0x42, -} - -type parentRel struct { - lang uint16 - script uint8 - maxScript uint8 - toRegion uint16 - fromRegion []uint16 -} - -// Size: 414 bytes, 5 elements -var parents = [5]parentRel{ - 0: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1, fromRegion: []uint16{0x1a, 0x24, 0x25, 0x2e, 0x33, 0x35, 0x3c, 0x41, 0x45, 0x47, 0x48, 0x49, 0x4f, 0x51, 0x5b, 0x5c, 0x60, 0x63, 0x6c, 0x72, 0x73, 0x74, 0x7a, 0x7b, 0x7e, 0x7f, 0x80, 0x82, 0x8b, 0x8c, 0x95, 0x96, 0x97, 0x98, 0x99, 0x9e, 0x9f, 0xa3, 0xa6, 0xa8, 0xac, 0xb0, 0xb3, 0xb4, 0xbe, 0xc5, 0xc9, 0xca, 0xcb, 0xcd, 0xcf, 0xd1, 0xd4, 0xd5, 0xdc, 0xde, 0xdf, 0xe5, 0xe6, 0xe7, 0xea, 0xef, 0x106, 0x108, 0x109, 0x10a, 0x10c, 0x10d, 0x111, 0x116, 0x11a, 0x11c, 0x11e, 0x124, 0x128, 0x12b, 0x12c, 0x12e, 0x130, 0x138, 0x13b, 0x13e, 0x141, 0x160, 0x161, 0x163}}, - 1: {lang: 0x138, script: 0x0, maxScript: 0x52, toRegion: 0x1a, fromRegion: []uint16{0x2d, 0x4d, 0x5f, 0x62, 0x71, 0xd8, 0x10b, 0x10e}}, - 2: {lang: 0x13d, script: 0x0, maxScript: 0x52, toRegion: 0x1e, fromRegion: []uint16{0x2b, 0x3e, 0x40, 0x47, 0x50, 0x53, 0x55, 0x58, 0x64, 0x68, 0x88, 0x8e, 0xce, 0xd7, 0xe1, 0xe3, 0xeb, 0xf0, 0x119, 0x134, 0x135, 0x13a}}, - 3: {lang: 0x3be, script: 0x0, maxScript: 0x52, toRegion: 0xed, fromRegion: []uint16{0x29, 0x4d, 0x59, 0x85, 0x8a, 0xb6, 0xc5, 0xd0, 0x117, 0x125}}, - 4: {lang: 0x527, script: 0x35, maxScript: 0x35, toRegion: 0x8c, fromRegion: []uint16{0xc5}}, -} - -// Total table size 26496 bytes (25KiB); checksum: 6E24B15A diff --git a/vendor/golang.org/x/text/language/tags.go b/vendor/golang.org/x/text/language/tags.go deleted file mode 100644 index de30155a..00000000 --- a/vendor/golang.org/x/text/language/tags.go +++ /dev/null @@ -1,143 +0,0 @@ -// Copyright 2013 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package language - -// TODO: Various sets of commonly use tags and regions. - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func MustParse(s string) Tag { - t, err := Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParse is like Parse, but panics if the given BCP 47 tag cannot be parsed. -// It simplifies safe initialization of Tag values. -func (c CanonType) MustParse(s string) Tag { - t, err := c.Parse(s) - if err != nil { - panic(err) - } - return t -} - -// MustParseBase is like ParseBase, but panics if the given base cannot be parsed. -// It simplifies safe initialization of Base values. -func MustParseBase(s string) Base { - b, err := ParseBase(s) - if err != nil { - panic(err) - } - return b -} - -// MustParseScript is like ParseScript, but panics if the given script cannot be -// parsed. It simplifies safe initialization of Script values. -func MustParseScript(s string) Script { - scr, err := ParseScript(s) - if err != nil { - panic(err) - } - return scr -} - -// MustParseRegion is like ParseRegion, but panics if the given region cannot be -// parsed. It simplifies safe initialization of Region values. -func MustParseRegion(s string) Region { - r, err := ParseRegion(s) - if err != nil { - panic(err) - } - return r -} - -var ( - und = Tag{} - - Und Tag = Tag{} - - Afrikaans Tag = Tag{lang: _af} // af - Amharic Tag = Tag{lang: _am} // am - Arabic Tag = Tag{lang: _ar} // ar - ModernStandardArabic Tag = Tag{lang: _ar, region: _001} // ar-001 - Azerbaijani Tag = Tag{lang: _az} // az - Bulgarian Tag = Tag{lang: _bg} // bg - Bengali Tag = Tag{lang: _bn} // bn - Catalan Tag = Tag{lang: _ca} // ca - Czech Tag = Tag{lang: _cs} // cs - Danish Tag = Tag{lang: _da} // da - German Tag = Tag{lang: _de} // de - Greek Tag = Tag{lang: _el} // el - English Tag = Tag{lang: _en} // en - AmericanEnglish Tag = Tag{lang: _en, region: _US} // en-US - BritishEnglish Tag = Tag{lang: _en, region: _GB} // en-GB - Spanish Tag = Tag{lang: _es} // es - EuropeanSpanish Tag = Tag{lang: _es, region: _ES} // es-ES - LatinAmericanSpanish Tag = Tag{lang: _es, region: _419} // es-419 - Estonian Tag = Tag{lang: _et} // et - Persian Tag = Tag{lang: _fa} // fa - Finnish Tag = Tag{lang: _fi} // fi - Filipino Tag = Tag{lang: _fil} // fil - French Tag = Tag{lang: _fr} // fr - CanadianFrench Tag = Tag{lang: _fr, region: _CA} // fr-CA - Gujarati Tag = Tag{lang: _gu} // gu - Hebrew Tag = Tag{lang: _he} // he - Hindi Tag = Tag{lang: _hi} // hi - Croatian Tag = Tag{lang: _hr} // hr - Hungarian Tag = Tag{lang: _hu} // hu - Armenian Tag = Tag{lang: _hy} // hy - Indonesian Tag = Tag{lang: _id} // id - Icelandic Tag = Tag{lang: _is} // is - Italian Tag = Tag{lang: _it} // it - Japanese Tag = Tag{lang: _ja} // ja - Georgian Tag = Tag{lang: _ka} // ka - Kazakh Tag = Tag{lang: _kk} // kk - Khmer Tag = Tag{lang: _km} // km - Kannada Tag = Tag{lang: _kn} // kn - Korean Tag = Tag{lang: _ko} // ko - Kirghiz Tag = Tag{lang: _ky} // ky - Lao Tag = Tag{lang: _lo} // lo - Lithuanian Tag = Tag{lang: _lt} // lt - Latvian Tag = Tag{lang: _lv} // lv - Macedonian Tag = Tag{lang: _mk} // mk - Malayalam Tag = Tag{lang: _ml} // ml - Mongolian Tag = Tag{lang: _mn} // mn - Marathi Tag = Tag{lang: _mr} // mr - Malay Tag = Tag{lang: _ms} // ms - Burmese Tag = Tag{lang: _my} // my - Nepali Tag = Tag{lang: _ne} // ne - Dutch Tag = Tag{lang: _nl} // nl - Norwegian Tag = Tag{lang: _no} // no - Punjabi Tag = Tag{lang: _pa} // pa - Polish Tag = Tag{lang: _pl} // pl - Portuguese Tag = Tag{lang: _pt} // pt - BrazilianPortuguese Tag = Tag{lang: _pt, region: _BR} // pt-BR - EuropeanPortuguese Tag = Tag{lang: _pt, region: _PT} // pt-PT - Romanian Tag = Tag{lang: _ro} // ro - Russian Tag = Tag{lang: _ru} // ru - Sinhala Tag = Tag{lang: _si} // si - Slovak Tag = Tag{lang: _sk} // sk - Slovenian Tag = Tag{lang: _sl} // sl - Albanian Tag = Tag{lang: _sq} // sq - Serbian Tag = Tag{lang: _sr} // sr - SerbianLatin Tag = Tag{lang: _sr, script: _Latn} // sr-Latn - Swedish Tag = Tag{lang: _sv} // sv - Swahili Tag = Tag{lang: _sw} // sw - Tamil Tag = Tag{lang: _ta} // ta - Telugu Tag = Tag{lang: _te} // te - Thai Tag = Tag{lang: _th} // th - Turkish Tag = Tag{lang: _tr} // tr - Ukrainian Tag = Tag{lang: _uk} // uk - Urdu Tag = Tag{lang: _ur} // ur - Uzbek Tag = Tag{lang: _uz} // uz - Vietnamese Tag = Tag{lang: _vi} // vi - Chinese Tag = Tag{lang: _zh} // zh - SimplifiedChinese Tag = Tag{lang: _zh, script: _Hans} // zh-Hans - TraditionalChinese Tag = Tag{lang: _zh, script: _Hant} // zh-Hant - Zulu Tag = Tag{lang: _zu} // zu -) diff --git a/vendor/golang.org/x/text/runes/cond.go b/vendor/golang.org/x/text/runes/cond.go deleted file mode 100644 index df7aa02d..00000000 --- a/vendor/golang.org/x/text/runes/cond.go +++ /dev/null @@ -1,187 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package runes - -import ( - "unicode/utf8" - - "golang.org/x/text/transform" -) - -// Note: below we pass invalid UTF-8 to the tIn and tNotIn transformers as is. -// This is done for various reasons: -// - To retain the semantics of the Nop transformer: if input is passed to a Nop -// one would expect it to be unchanged. -// - It would be very expensive to pass a converted RuneError to a transformer: -// a transformer might need more source bytes after RuneError, meaning that -// the only way to pass it safely is to create a new buffer and manage the -// intermingling of RuneErrors and normal input. -// - Many transformers leave ill-formed UTF-8 as is, so this is not -// inconsistent. Generally ill-formed UTF-8 is only replaced if it is a -// logical consequence of the operation (as for Map) or if it otherwise would -// pose security concerns (as for Remove). -// - An alternative would be to return an error on ill-formed UTF-8, but this -// would be inconsistent with other operations. - -// If returns a transformer that applies tIn to consecutive runes for which -// s.Contains(r) and tNotIn to consecutive runes for which !s.Contains(r). Reset -// is called on tIn and tNotIn at the start of each run. A Nop transformer will -// substitute a nil value passed to tIn or tNotIn. Invalid UTF-8 is translated -// to RuneError to determine which transformer to apply, but is passed as is to -// the respective transformer. -func If(s Set, tIn, tNotIn transform.Transformer) Transformer { - if tIn == nil && tNotIn == nil { - return Transformer{transform.Nop} - } - if tIn == nil { - tIn = transform.Nop - } - if tNotIn == nil { - tNotIn = transform.Nop - } - sIn, ok := tIn.(transform.SpanningTransformer) - if !ok { - sIn = dummySpan{tIn} - } - sNotIn, ok := tNotIn.(transform.SpanningTransformer) - if !ok { - sNotIn = dummySpan{tNotIn} - } - - a := &cond{ - tIn: sIn, - tNotIn: sNotIn, - f: s.Contains, - } - a.Reset() - return Transformer{a} -} - -type dummySpan struct{ transform.Transformer } - -func (d dummySpan) Span(src []byte, atEOF bool) (n int, err error) { - return 0, transform.ErrEndOfSpan -} - -type cond struct { - tIn, tNotIn transform.SpanningTransformer - f func(rune) bool - check func(rune) bool // current check to perform - t transform.SpanningTransformer // current transformer to use -} - -// Reset implements transform.Transformer. -func (t *cond) Reset() { - t.check = t.is - t.t = t.tIn - t.t.Reset() // notIn will be reset on first usage. -} - -func (t *cond) is(r rune) bool { - if t.f(r) { - return true - } - t.check = t.isNot - t.t = t.tNotIn - t.tNotIn.Reset() - return false -} - -func (t *cond) isNot(r rune) bool { - if !t.f(r) { - return true - } - t.check = t.is - t.t = t.tIn - t.tIn.Reset() - return false -} - -// This implementation of Span doesn't help all too much, but it needs to be -// there to satisfy this package's Transformer interface. -// TODO: there are certainly room for improvements, though. For example, if -// t.t == transform.Nop (which will a common occurrence) it will save a bundle -// to special-case that loop. -func (t *cond) Span(src []byte, atEOF bool) (n int, err error) { - p := 0 - for n < len(src) && err == nil { - // Don't process too much at a time as the Spanner that will be - // called on this block may terminate early. - const maxChunk = 4096 - max := len(src) - if v := n + maxChunk; v < max { - max = v - } - atEnd := false - size := 0 - current := t.t - for ; p < max; p += size { - r := rune(src[p]) - if r < utf8.RuneSelf { - size = 1 - } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { - if !atEOF && !utf8.FullRune(src[p:]) { - err = transform.ErrShortSrc - break - } - } - if !t.check(r) { - // The next rune will be the start of a new run. - atEnd = true - break - } - } - n2, err2 := current.Span(src[n:p], atEnd || (atEOF && p == len(src))) - n += n2 - if err2 != nil { - return n, err2 - } - // At this point either err != nil or t.check will pass for the rune at p. - p = n + size - } - return n, err -} - -func (t *cond) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - p := 0 - for nSrc < len(src) && err == nil { - // Don't process too much at a time, as the work might be wasted if the - // destination buffer isn't large enough to hold the result or a - // transform returns an error early. - const maxChunk = 4096 - max := len(src) - if n := nSrc + maxChunk; n < len(src) { - max = n - } - atEnd := false - size := 0 - current := t.t - for ; p < max; p += size { - r := rune(src[p]) - if r < utf8.RuneSelf { - size = 1 - } else if r, size = utf8.DecodeRune(src[p:]); size == 1 { - if !atEOF && !utf8.FullRune(src[p:]) { - err = transform.ErrShortSrc - break - } - } - if !t.check(r) { - // The next rune will be the start of a new run. - atEnd = true - break - } - } - nDst2, nSrc2, err2 := current.Transform(dst[nDst:], src[nSrc:p], atEnd || (atEOF && p == len(src))) - nDst += nDst2 - nSrc += nSrc2 - if err2 != nil { - return nDst, nSrc, err2 - } - // At this point either err != nil or t.check will pass for the rune at p. - p = nSrc + size - } - return nDst, nSrc, err -} diff --git a/vendor/golang.org/x/text/runes/runes.go b/vendor/golang.org/x/text/runes/runes.go deleted file mode 100644 index 6a3195cf..00000000 --- a/vendor/golang.org/x/text/runes/runes.go +++ /dev/null @@ -1,355 +0,0 @@ -// Copyright 2014 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package runes provide transforms for UTF-8 encoded text. -package runes - -import ( - "unicode" - "unicode/utf8" - - "golang.org/x/text/transform" -) - -// A Set is a collection of runes. -type Set interface { - // Contains returns true if r is contained in the set. - Contains(r rune) bool -} - -type setFunc func(rune) bool - -func (s setFunc) Contains(r rune) bool { - return s(r) -} - -// Note: using funcs here instead of wrapping types result in cleaner -// documentation and a smaller API. - -// In creates a Set with a Contains method that returns true for all runes in -// the given RangeTable. -func In(rt *unicode.RangeTable) Set { - return setFunc(func(r rune) bool { return unicode.Is(rt, r) }) -} - -// In creates a Set with a Contains method that returns true for all runes not -// in the given RangeTable. -func NotIn(rt *unicode.RangeTable) Set { - return setFunc(func(r rune) bool { return !unicode.Is(rt, r) }) -} - -// Predicate creates a Set with a Contains method that returns f(r). -func Predicate(f func(rune) bool) Set { - return setFunc(f) -} - -// Transformer implements the transform.Transformer interface. -type Transformer struct { - t transform.SpanningTransformer -} - -func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return t.t.Transform(dst, src, atEOF) -} - -func (t Transformer) Span(b []byte, atEOF bool) (n int, err error) { - return t.t.Span(b, atEOF) -} - -func (t Transformer) Reset() { t.t.Reset() } - -// Bytes returns a new byte slice with the result of converting b using t. It -// calls Reset on t. It returns nil if any error was found. This can only happen -// if an error-producing Transformer is passed to If. -func (t Transformer) Bytes(b []byte) []byte { - b, _, err := transform.Bytes(t, b) - if err != nil { - return nil - } - return b -} - -// String returns a string with the result of converting s using t. It calls -// Reset on t. It returns the empty string if any error was found. This can only -// happen if an error-producing Transformer is passed to If. -func (t Transformer) String(s string) string { - s, _, err := transform.String(t, s) - if err != nil { - return "" - } - return s -} - -// TODO: -// - Copy: copying strings and bytes in whole-rune units. -// - Validation (maybe) -// - Well-formed-ness (maybe) - -const runeErrorString = string(utf8.RuneError) - -// Remove returns a Transformer that removes runes r for which s.Contains(r). -// Illegal input bytes are replaced by RuneError before being passed to f. -func Remove(s Set) Transformer { - if f, ok := s.(setFunc); ok { - // This little trick cuts the running time of BenchmarkRemove for sets - // created by Predicate roughly in half. - // TODO: special-case RangeTables as well. - return Transformer{remove(f)} - } - return Transformer{remove(s.Contains)} -} - -// TODO: remove transform.RemoveFunc. - -type remove func(r rune) bool - -func (remove) Reset() {} - -// Span implements transform.Spanner. -func (t remove) Span(src []byte, atEOF bool) (n int, err error) { - for r, size := rune(0), 0; n < len(src); { - if r = rune(src[n]); r < utf8.RuneSelf { - size = 1 - } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src[n:]) { - err = transform.ErrShortSrc - } else { - err = transform.ErrEndOfSpan - } - break - } - if t(r) { - err = transform.ErrEndOfSpan - break - } - n += size - } - return -} - -// Transform implements transform.Transformer. -func (t remove) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - for r, size := rune(0), 0; nSrc < len(src); { - if r = rune(src[nSrc]); r < utf8.RuneSelf { - size = 1 - } else if r, size = utf8.DecodeRune(src[nSrc:]); size == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src[nSrc:]) { - err = transform.ErrShortSrc - break - } - // We replace illegal bytes with RuneError. Not doing so might - // otherwise turn a sequence of invalid UTF-8 into valid UTF-8. - // The resulting byte sequence may subsequently contain runes - // for which t(r) is true that were passed unnoticed. - if !t(utf8.RuneError) { - if nDst+3 > len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst+0] = runeErrorString[0] - dst[nDst+1] = runeErrorString[1] - dst[nDst+2] = runeErrorString[2] - nDst += 3 - } - nSrc++ - continue - } - if t(r) { - nSrc += size - continue - } - if nDst+size > len(dst) { - err = transform.ErrShortDst - break - } - for i := 0; i < size; i++ { - dst[nDst] = src[nSrc] - nDst++ - nSrc++ - } - } - return -} - -// Map returns a Transformer that maps the runes in the input using the given -// mapping. Illegal bytes in the input are converted to utf8.RuneError before -// being passed to the mapping func. -func Map(mapping func(rune) rune) Transformer { - return Transformer{mapper(mapping)} -} - -type mapper func(rune) rune - -func (mapper) Reset() {} - -// Span implements transform.Spanner. -func (t mapper) Span(src []byte, atEOF bool) (n int, err error) { - for r, size := rune(0), 0; n < len(src); n += size { - if r = rune(src[n]); r < utf8.RuneSelf { - size = 1 - } else if r, size = utf8.DecodeRune(src[n:]); size == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src[n:]) { - err = transform.ErrShortSrc - } else { - err = transform.ErrEndOfSpan - } - break - } - if t(r) != r { - err = transform.ErrEndOfSpan - break - } - } - return n, err -} - -// Transform implements transform.Transformer. -func (t mapper) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - var replacement rune - var b [utf8.UTFMax]byte - - for r, size := rune(0), 0; nSrc < len(src); { - if r = rune(src[nSrc]); r < utf8.RuneSelf { - if replacement = t(r); replacement < utf8.RuneSelf { - if nDst == len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst] = byte(replacement) - nDst++ - nSrc++ - continue - } - size = 1 - } else if r, size = utf8.DecodeRune(src[nSrc:]); size == 1 { - // Invalid rune. - if !atEOF && !utf8.FullRune(src[nSrc:]) { - err = transform.ErrShortSrc - break - } - - if replacement = t(utf8.RuneError); replacement == utf8.RuneError { - if nDst+3 > len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst+0] = runeErrorString[0] - dst[nDst+1] = runeErrorString[1] - dst[nDst+2] = runeErrorString[2] - nDst += 3 - nSrc++ - continue - } - } else if replacement = t(r); replacement == r { - if nDst+size > len(dst) { - err = transform.ErrShortDst - break - } - for i := 0; i < size; i++ { - dst[nDst] = src[nSrc] - nDst++ - nSrc++ - } - continue - } - - n := utf8.EncodeRune(b[:], replacement) - - if nDst+n > len(dst) { - err = transform.ErrShortDst - break - } - for i := 0; i < n; i++ { - dst[nDst] = b[i] - nDst++ - } - nSrc += size - } - return -} - -// ReplaceIllFormed returns a transformer that replaces all input bytes that are -// not part of a well-formed UTF-8 code sequence with utf8.RuneError. -func ReplaceIllFormed() Transformer { - return Transformer{&replaceIllFormed{}} -} - -type replaceIllFormed struct{ transform.NopResetter } - -func (t replaceIllFormed) Span(src []byte, atEOF bool) (n int, err error) { - for n < len(src) { - // ASCII fast path. - if src[n] < utf8.RuneSelf { - n++ - continue - } - - r, size := utf8.DecodeRune(src[n:]) - - // Look for a valid non-ASCII rune. - if r != utf8.RuneError || size != 1 { - n += size - continue - } - - // Look for short source data. - if !atEOF && !utf8.FullRune(src[n:]) { - err = transform.ErrShortSrc - break - } - - // We have an invalid rune. - err = transform.ErrEndOfSpan - break - } - return n, err -} - -func (t replaceIllFormed) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - for nSrc < len(src) { - // ASCII fast path. - if r := src[nSrc]; r < utf8.RuneSelf { - if nDst == len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst] = r - nDst++ - nSrc++ - continue - } - - // Look for a valid non-ASCII rune. - if _, size := utf8.DecodeRune(src[nSrc:]); size != 1 { - if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { - err = transform.ErrShortDst - break - } - nDst += size - nSrc += size - continue - } - - // Look for short source data. - if !atEOF && !utf8.FullRune(src[nSrc:]) { - err = transform.ErrShortSrc - break - } - - // We have an invalid rune. - if nDst+3 > len(dst) { - err = transform.ErrShortDst - break - } - dst[nDst+0] = runeErrorString[0] - dst[nDst+1] = runeErrorString[1] - dst[nDst+2] = runeErrorString[2] - nDst += 3 - nSrc++ - } - return nDst, nSrc, err -} diff --git a/vendor/golang.org/x/text/secure/precis/class.go b/vendor/golang.org/x/text/secure/precis/class.go deleted file mode 100644 index f6b56413..00000000 --- a/vendor/golang.org/x/text/secure/precis/class.go +++ /dev/null @@ -1,36 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import ( - "unicode/utf8" -) - -// TODO: Add contextual character rules from Appendix A of RFC5892. - -// A class is a set of characters that match certain derived properties. The -// PRECIS framework defines two classes: The Freeform class and the Identifier -// class. The freeform class should be used for profiles where expressiveness is -// prioritized over safety such as nicknames or passwords. The identifier class -// should be used for profiles where safety is the first priority such as -// addressable network labels and usernames. -type class struct { - validFrom property -} - -// Contains satisfies the runes.Set interface and returns whether the given rune -// is a member of the class. -func (c class) Contains(r rune) bool { - b := make([]byte, 4) - n := utf8.EncodeRune(b, r) - - trieval, _ := dpTrie.lookup(b[:n]) - return c.validFrom <= property(trieval) -} - -var ( - identifier = &class{validFrom: pValid} - freeform = &class{validFrom: idDisOrFreePVal} -) diff --git a/vendor/golang.org/x/text/secure/precis/context.go b/vendor/golang.org/x/text/secure/precis/context.go deleted file mode 100644 index 2dcaf29d..00000000 --- a/vendor/golang.org/x/text/secure/precis/context.go +++ /dev/null @@ -1,139 +0,0 @@ -// Copyright 2016 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import "errors" - -// This file contains tables and code related to context rules. - -type catBitmap uint16 - -const ( - // These bits, once set depending on the current value, are never unset. - bJapanese catBitmap = 1 << iota - bArabicIndicDigit - bExtendedArabicIndicDigit - - // These bits are set on each iteration depending on the current value. - bJoinStart - bJoinMid - bJoinEnd - bVirama - bLatinSmallL - bGreek - bHebrew - - // These bits indicated which of the permanent bits need to be set at the - // end of the checks. - bMustHaveJapn - - permanent = bJapanese | bArabicIndicDigit | bExtendedArabicIndicDigit | bMustHaveJapn -) - -const finalShift = 10 - -var errContext = errors.New("precis: contextual rule violated") - -func init() { - // Programmatically set these required bits as, manually setting them seems - // too error prone. - for i, ct := range categoryTransitions { - categoryTransitions[i].keep |= permanent - categoryTransitions[i].accept |= ct.term - } -} - -var categoryTransitions = []struct { - keep catBitmap // mask selecting which bits to keep from the previous state - set catBitmap // mask for which bits to set for this transition - - // These bitmaps are used for rules that require lookahead. - // term&accept == term must be true, which is enforced programmatically. - term catBitmap // bits accepted as termination condition - accept catBitmap // bits that pass, but not sufficient as termination - - // The rule function cannot take a *context as an argument, as it would - // cause the context to escape, adding significant overhead. - rule func(beforeBits catBitmap) (doLookahead bool, err error) -}{ - joiningL: {set: bJoinStart}, - joiningD: {set: bJoinStart | bJoinEnd}, - joiningT: {keep: bJoinStart, set: bJoinMid}, - joiningR: {set: bJoinEnd}, - viramaModifier: {set: bVirama}, - viramaJoinT: {set: bVirama | bJoinMid}, - latinSmallL: {set: bLatinSmallL}, - greek: {set: bGreek}, - greekJoinT: {set: bGreek | bJoinMid}, - hebrew: {set: bHebrew}, - hebrewJoinT: {set: bHebrew | bJoinMid}, - japanese: {set: bJapanese}, - katakanaMiddleDot: {set: bMustHaveJapn}, - - zeroWidthNonJoiner: { - term: bJoinEnd, - accept: bJoinMid, - rule: func(before catBitmap) (doLookAhead bool, err error) { - if before&bVirama != 0 { - return false, nil - } - if before&bJoinStart == 0 { - return false, errContext - } - return true, nil - }, - }, - zeroWidthJoiner: { - rule: func(before catBitmap) (doLookAhead bool, err error) { - if before&bVirama == 0 { - err = errContext - } - return false, err - }, - }, - middleDot: { - term: bLatinSmallL, - rule: func(before catBitmap) (doLookAhead bool, err error) { - if before&bLatinSmallL == 0 { - return false, errContext - } - return true, nil - }, - }, - greekLowerNumeralSign: { - set: bGreek, - term: bGreek, - rule: func(before catBitmap) (doLookAhead bool, err error) { - return true, nil - }, - }, - hebrewPreceding: { - set: bHebrew, - rule: func(before catBitmap) (doLookAhead bool, err error) { - if before&bHebrew == 0 { - err = errContext - } - return false, err - }, - }, - arabicIndicDigit: { - set: bArabicIndicDigit, - rule: func(before catBitmap) (doLookAhead bool, err error) { - if before&bExtendedArabicIndicDigit != 0 { - err = errContext - } - return false, err - }, - }, - extendedArabicIndicDigit: { - set: bExtendedArabicIndicDigit, - rule: func(before catBitmap) (doLookAhead bool, err error) { - if before&bArabicIndicDigit != 0 { - err = errContext - } - return false, err - }, - }, -} diff --git a/vendor/golang.org/x/text/secure/precis/doc.go b/vendor/golang.org/x/text/secure/precis/doc.go deleted file mode 100644 index aa76205e..00000000 --- a/vendor/golang.org/x/text/secure/precis/doc.go +++ /dev/null @@ -1,14 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Package precis contains types and functions for the preparation, -// enforcement, and comparison of internationalized strings ("PRECIS") as -// defined in RFC 7564. It also contains several pre-defined profiles for -// passwords, nicknames, and usernames as defined in RFC 7613 and RFC 7700. -// -// BE ADVISED: This package is under construction and the API may change in -// backwards incompatible ways and without notice. -package precis - -//go:generate go run gen.go gen_trieval.go diff --git a/vendor/golang.org/x/text/secure/precis/gen.go b/vendor/golang.org/x/text/secure/precis/gen.go deleted file mode 100644 index dba9004a..00000000 --- a/vendor/golang.org/x/text/secure/precis/gen.go +++ /dev/null @@ -1,310 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// Unicode table generator. -// Data read from the web. - -// +build ignore - -package main - -import ( - "flag" - "log" - "unicode" - "unicode/utf8" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/triegen" - "golang.org/x/text/internal/ucd" - "golang.org/x/text/unicode/norm" - "golang.org/x/text/unicode/rangetable" -) - -var outputFile = flag.String("output", "tables.go", "output file for generated tables; default tables.go") - -var assigned, disallowedRunes *unicode.RangeTable - -var runeCategory = map[rune]category{} - -var overrides = map[category]category{ - viramaModifier: viramaJoinT, - greek: greekJoinT, - hebrew: hebrewJoinT, -} - -func setCategory(r rune, cat category) { - if c, ok := runeCategory[r]; ok { - if override, ok := overrides[c]; cat == joiningT && ok { - cat = override - } else { - log.Fatalf("%U: multiple categories for rune (%v and %v)", r, c, cat) - } - } - runeCategory[r] = cat -} - -func init() { - if numCategories > 1<<propShift { - log.Fatalf("Number of categories is %d; may at most be %d", numCategories, 1<<propShift) - } -} - -func main() { - gen.Init() - - // Load data - runes := []rune{} - // PrecisIgnorableProperties: https://tools.ietf.org/html/rfc7564#section-9.13 - ucd.Parse(gen.OpenUCDFile("DerivedCoreProperties.txt"), func(p *ucd.Parser) { - if p.String(1) == "Default_Ignorable_Code_Point" { - runes = append(runes, p.Rune(0)) - } - }) - ucd.Parse(gen.OpenUCDFile("PropList.txt"), func(p *ucd.Parser) { - switch p.String(1) { - case "Noncharacter_Code_Point": - runes = append(runes, p.Rune(0)) - } - }) - // OldHangulJamo: https://tools.ietf.org/html/rfc5892#section-2.9 - ucd.Parse(gen.OpenUCDFile("HangulSyllableType.txt"), func(p *ucd.Parser) { - switch p.String(1) { - case "L", "V", "T": - runes = append(runes, p.Rune(0)) - } - }) - - disallowedRunes = rangetable.New(runes...) - assigned = rangetable.Assigned(unicode.Version) - - // Load category data. - runeCategory['l'] = latinSmallL - ucd.Parse(gen.OpenUCDFile("UnicodeData.txt"), func(p *ucd.Parser) { - const cccVirama = 9 - if p.Int(ucd.CanonicalCombiningClass) == cccVirama { - setCategory(p.Rune(0), viramaModifier) - } - }) - ucd.Parse(gen.OpenUCDFile("Scripts.txt"), func(p *ucd.Parser) { - switch p.String(1) { - case "Greek": - setCategory(p.Rune(0), greek) - case "Hebrew": - setCategory(p.Rune(0), hebrew) - case "Hiragana", "Katakana", "Han": - setCategory(p.Rune(0), japanese) - } - }) - - // Set the rule categories associated with exceptions. This overrides any - // previously set categories. The original categories are manually - // reintroduced in the categoryTransitions table. - for r, e := range exceptions { - if e.cat != 0 { - runeCategory[r] = e.cat - } - } - cat := map[string]category{ - "L": joiningL, - "D": joiningD, - "T": joiningT, - - "R": joiningR, - } - ucd.Parse(gen.OpenUCDFile("extracted/DerivedJoiningType.txt"), func(p *ucd.Parser) { - switch v := p.String(1); v { - case "L", "D", "T", "R": - setCategory(p.Rune(0), cat[v]) - } - }) - - writeTables() - gen.Repackage("gen_trieval.go", "trieval.go", "precis") -} - -type exception struct { - prop property - cat category -} - -func init() { - // Programmatically add the Arabic and Indic digits to the exceptions map. - // See comment in the exceptions map below why these are marked disallowed. - for i := rune(0); i <= 9; i++ { - exceptions[0x0660+i] = exception{ - prop: disallowed, - cat: arabicIndicDigit, - } - exceptions[0x06F0+i] = exception{ - prop: disallowed, - cat: extendedArabicIndicDigit, - } - } -} - -// The Exceptions class as defined in RFC 5892 -// https://tools.ietf.org/html/rfc5892#section-2.6 -var exceptions = map[rune]exception{ - 0x00DF: {prop: pValid}, - 0x03C2: {prop: pValid}, - 0x06FD: {prop: pValid}, - 0x06FE: {prop: pValid}, - 0x0F0B: {prop: pValid}, - 0x3007: {prop: pValid}, - - // ContextO|J rules are marked as disallowed, taking a "guilty until proven - // innocent" approach. The main reason for this is that the check for - // whether a context rule should be applied can be moved to the logic for - // handing disallowed runes, taken it off the common path. The exception to - // this rule is for katakanaMiddleDot, as the rule logic is handled without - // using a rule function. - - // ContextJ (Join control) - 0x200C: {prop: disallowed, cat: zeroWidthNonJoiner}, - 0x200D: {prop: disallowed, cat: zeroWidthJoiner}, - - // ContextO - 0x00B7: {prop: disallowed, cat: middleDot}, - 0x0375: {prop: disallowed, cat: greekLowerNumeralSign}, - 0x05F3: {prop: disallowed, cat: hebrewPreceding}, // punctuation Geresh - 0x05F4: {prop: disallowed, cat: hebrewPreceding}, // punctuation Gershayim - 0x30FB: {prop: pValid, cat: katakanaMiddleDot}, - - // These are officially ContextO, but the implementation does not require - // special treatment of these, so we simply mark them as valid. - 0x0660: {prop: pValid}, - 0x0661: {prop: pValid}, - 0x0662: {prop: pValid}, - 0x0663: {prop: pValid}, - 0x0664: {prop: pValid}, - 0x0665: {prop: pValid}, - 0x0666: {prop: pValid}, - 0x0667: {prop: pValid}, - 0x0668: {prop: pValid}, - 0x0669: {prop: pValid}, - 0x06F0: {prop: pValid}, - 0x06F1: {prop: pValid}, - 0x06F2: {prop: pValid}, - 0x06F3: {prop: pValid}, - 0x06F4: {prop: pValid}, - 0x06F5: {prop: pValid}, - 0x06F6: {prop: pValid}, - 0x06F7: {prop: pValid}, - 0x06F8: {prop: pValid}, - 0x06F9: {prop: pValid}, - - 0x0640: {prop: disallowed}, - 0x07FA: {prop: disallowed}, - 0x302E: {prop: disallowed}, - 0x302F: {prop: disallowed}, - 0x3031: {prop: disallowed}, - 0x3032: {prop: disallowed}, - 0x3033: {prop: disallowed}, - 0x3034: {prop: disallowed}, - 0x3035: {prop: disallowed}, - 0x303B: {prop: disallowed}, -} - -// LetterDigits: https://tools.ietf.org/html/rfc5892#section-2.1 -// r in {Ll, Lu, Lo, Nd, Lm, Mn, Mc}. -func isLetterDigits(r rune) bool { - return unicode.In(r, - unicode.Ll, unicode.Lu, unicode.Lm, unicode.Lo, // Letters - unicode.Mn, unicode.Mc, // Modifiers - unicode.Nd, // Digits - ) -} - -func isIdDisAndFreePVal(r rune) bool { - return unicode.In(r, - // OtherLetterDigits: https://tools.ietf.org/html/rfc7564#section-9.18 - // r in in {Lt, Nl, No, Me} - unicode.Lt, unicode.Nl, unicode.No, // Other letters / numbers - unicode.Me, // Modifiers - - // Spaces: https://tools.ietf.org/html/rfc7564#section-9.14 - // r in in {Zs} - unicode.Zs, - - // Symbols: https://tools.ietf.org/html/rfc7564#section-9.15 - // r in {Sm, Sc, Sk, So} - unicode.Sm, unicode.Sc, unicode.Sk, unicode.So, - - // Punctuation: https://tools.ietf.org/html/rfc7564#section-9.16 - // r in {Pc, Pd, Ps, Pe, Pi, Pf, Po} - unicode.Pc, unicode.Pd, unicode.Ps, unicode.Pe, - unicode.Pi, unicode.Pf, unicode.Po, - ) -} - -// HasCompat: https://tools.ietf.org/html/rfc7564#section-9.17 -func hasCompat(r rune) bool { - return !norm.NFKC.IsNormalString(string(r)) -} - -// From https://tools.ietf.org/html/rfc5892: -// -// If .cp. .in. Exceptions Then Exceptions(cp); -// Else If .cp. .in. BackwardCompatible Then BackwardCompatible(cp); -// Else If .cp. .in. Unassigned Then UNASSIGNED; -// Else If .cp. .in. ASCII7 Then PVALID; -// Else If .cp. .in. JoinControl Then CONTEXTJ; -// Else If .cp. .in. OldHangulJamo Then DISALLOWED; -// Else If .cp. .in. PrecisIgnorableProperties Then DISALLOWED; -// Else If .cp. .in. Controls Then DISALLOWED; -// Else If .cp. .in. HasCompat Then ID_DIS or FREE_PVAL; -// Else If .cp. .in. LetterDigits Then PVALID; -// Else If .cp. .in. OtherLetterDigits Then ID_DIS or FREE_PVAL; -// Else If .cp. .in. Spaces Then ID_DIS or FREE_PVAL; -// Else If .cp. .in. Symbols Then ID_DIS or FREE_PVAL; -// Else If .cp. .in. Punctuation Then ID_DIS or FREE_PVAL; -// Else DISALLOWED; - -func writeTables() { - propTrie := triegen.NewTrie("derivedProperties") - w := gen.NewCodeWriter() - defer w.WriteGoFile(*outputFile, "precis") - gen.WriteUnicodeVersion(w) - - // Iterate over all the runes... - for i := rune(0); i < unicode.MaxRune; i++ { - r := rune(i) - - if !utf8.ValidRune(r) { - continue - } - - e, ok := exceptions[i] - p := e.prop - switch { - case ok: - case !unicode.In(r, assigned): - p = unassigned - case r >= 0x0021 && r <= 0x007e: // Is ASCII 7 - p = pValid - case unicode.In(r, disallowedRunes, unicode.Cc): - p = disallowed - case hasCompat(r): - p = idDisOrFreePVal - case isLetterDigits(r): - p = pValid - case isIdDisAndFreePVal(r): - p = idDisOrFreePVal - default: - p = disallowed - } - cat := runeCategory[r] - // Don't set category for runes that are disallowed. - if p == disallowed { - cat = exceptions[r].cat - } - propTrie.Insert(r, uint64(p)|uint64(cat)) - } - sz, err := propTrie.Gen(w) - if err != nil { - log.Fatal(err) - } - w.Size += sz -} diff --git a/vendor/golang.org/x/text/secure/precis/gen_trieval.go b/vendor/golang.org/x/text/secure/precis/gen_trieval.go deleted file mode 100644 index 308510c9..00000000 --- a/vendor/golang.org/x/text/secure/precis/gen_trieval.go +++ /dev/null @@ -1,68 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// entry is the entry of a trie table -// 7..6 property (unassigned, disallowed, maybe, valid) -// 5..0 category -type entry uint8 - -const ( - propShift = 6 - propMask = 0xc0 - catMask = 0x3f -) - -func (e entry) property() property { return property(e & propMask) } -func (e entry) category() category { return category(e & catMask) } - -type property uint8 - -// The order of these constants matter. A Profile may consider runes to be -// allowed either from pValid or idDisOrFreePVal. -const ( - unassigned property = iota << propShift - disallowed - idDisOrFreePVal // disallowed for Identifier, pValid for FreeForm - pValid -) - -// compute permutations of all properties and specialCategories. -type category uint8 - -const ( - other category = iota - - // Special rune types - joiningL - joiningD - joiningT - joiningR - viramaModifier - viramaJoinT // Virama + JoiningT - latinSmallL // U+006c - greek - greekJoinT // Greek + JoiningT - hebrew - hebrewJoinT // Hebrew + JoiningT - japanese // hirigana, katakana, han - - // Special rune types associated with contextual rules defined in - // https://tools.ietf.org/html/rfc5892#appendix-A. - // ContextO - zeroWidthNonJoiner // rule 1 - zeroWidthJoiner // rule 2 - // ContextJ - middleDot // rule 3 - greekLowerNumeralSign // rule 4 - hebrewPreceding // rule 5 and 6 - katakanaMiddleDot // rule 7 - arabicIndicDigit // rule 8 - extendedArabicIndicDigit // rule 9 - - numCategories -) diff --git a/vendor/golang.org/x/text/secure/precis/nickname.go b/vendor/golang.org/x/text/secure/precis/nickname.go deleted file mode 100644 index cd54b9e6..00000000 --- a/vendor/golang.org/x/text/secure/precis/nickname.go +++ /dev/null @@ -1,70 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import ( - "unicode" - "unicode/utf8" - - "golang.org/x/text/transform" -) - -type nickAdditionalMapping struct { - // TODO: This transformer needs to be stateless somehow… - notStart bool - prevSpace bool -} - -func (t *nickAdditionalMapping) Reset() { - t.prevSpace = false - t.notStart = false -} - -func (t *nickAdditionalMapping) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - // RFC 7700 §2.1. Rules - // - // 2. Additional Mapping Rule: The additional mapping rule consists of - // the following sub-rules. - // - // 1. Any instances of non-ASCII space MUST be mapped to ASCII - // space (U+0020); a non-ASCII space is any Unicode code point - // having a general category of "Zs", naturally with the - // exception of U+0020. - // - // 2. Any instances of the ASCII space character at the beginning - // or end of a nickname MUST be removed (e.g., "stpeter " is - // mapped to "stpeter"). - // - // 3. Interior sequences of more than one ASCII space character - // MUST be mapped to a single ASCII space character (e.g., - // "St Peter" is mapped to "St Peter"). - - for nSrc < len(src) { - r, size := utf8.DecodeRune(src[nSrc:]) - if size == 0 { // Incomplete UTF-8 encoding - if !atEOF { - return nDst, nSrc, transform.ErrShortSrc - } - size = 1 - } - if unicode.Is(unicode.Zs, r) { - t.prevSpace = true - } else { - if t.prevSpace && t.notStart { - dst[nDst] = ' ' - nDst += 1 - } - if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { - nDst += size - return nDst, nSrc, transform.ErrShortDst - } - nDst += size - t.prevSpace = false - t.notStart = true - } - nSrc += size - } - return nDst, nSrc, nil -} diff --git a/vendor/golang.org/x/text/secure/precis/options.go b/vendor/golang.org/x/text/secure/precis/options.go deleted file mode 100644 index 488f0b1f..00000000 --- a/vendor/golang.org/x/text/secure/precis/options.go +++ /dev/null @@ -1,153 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import ( - "golang.org/x/text/cases" - "golang.org/x/text/language" - "golang.org/x/text/runes" - "golang.org/x/text/transform" - "golang.org/x/text/unicode/norm" -) - -// An Option is used to define the behavior and rules of a Profile. -type Option func(*options) - -type options struct { - // Preparation options - foldWidth bool - - // Enforcement options - asciiLower bool - cases transform.SpanningTransformer - disallow runes.Set - norm transform.SpanningTransformer - additional []func() transform.SpanningTransformer - width transform.SpanningTransformer - disallowEmpty bool - bidiRule bool - - // Comparison options - ignorecase bool -} - -func getOpts(o ...Option) (res options) { - for _, f := range o { - f(&res) - } - // Using a SpanningTransformer, instead of norm.Form prevents an allocation - // down the road. - if res.norm == nil { - res.norm = norm.NFC - } - return -} - -var ( - // The IgnoreCase option causes the profile to perform a case insensitive - // comparison during the PRECIS comparison step. - IgnoreCase Option = ignoreCase - - // The FoldWidth option causes the profile to map non-canonical wide and - // narrow variants to their decomposition mapping. This is useful for - // profiles that are based on the identifier class which would otherwise - // disallow such characters. - FoldWidth Option = foldWidth - - // The DisallowEmpty option causes the enforcement step to return an error if - // the resulting string would be empty. - DisallowEmpty Option = disallowEmpty - - // The BidiRule option causes the Bidi Rule defined in RFC 5893 to be - // applied. - BidiRule Option = bidiRule -) - -var ( - ignoreCase = func(o *options) { - o.ignorecase = true - } - foldWidth = func(o *options) { - o.foldWidth = true - } - disallowEmpty = func(o *options) { - o.disallowEmpty = true - } - bidiRule = func(o *options) { - o.bidiRule = true - } -) - -// TODO: move this logic to package transform - -type spanWrap struct{ transform.Transformer } - -func (s spanWrap) Span(src []byte, atEOF bool) (n int, err error) { - return 0, transform.ErrEndOfSpan -} - -// TODO: allow different types? For instance: -// func() transform.Transformer -// func() transform.SpanningTransformer -// func([]byte) bool // validation only -// -// Also, would be great if we could detect if a transformer is reentrant. - -// The AdditionalMapping option defines the additional mapping rule for the -// Profile by applying Transformer's in sequence. -func AdditionalMapping(t ...func() transform.Transformer) Option { - return func(o *options) { - for _, f := range t { - sf := func() transform.SpanningTransformer { - return f().(transform.SpanningTransformer) - } - if _, ok := f().(transform.SpanningTransformer); !ok { - sf = func() transform.SpanningTransformer { - return spanWrap{f()} - } - } - o.additional = append(o.additional, sf) - } - } -} - -// The Norm option defines a Profile's normalization rule. Defaults to NFC. -func Norm(f norm.Form) Option { - return func(o *options) { - o.norm = f - } -} - -// The FoldCase option defines a Profile's case mapping rule. Options can be -// provided to determine the type of case folding used. -func FoldCase(opts ...cases.Option) Option { - return func(o *options) { - o.asciiLower = true - o.cases = cases.Fold(opts...) - } -} - -// The LowerCase option defines a Profile's case mapping rule. Options can be -// provided to determine the type of case folding used. -func LowerCase(opts ...cases.Option) Option { - return func(o *options) { - o.asciiLower = true - if len(opts) == 0 { - o.cases = cases.Lower(language.Und, cases.HandleFinalSigma(false)) - return - } - - opts = append([]cases.Option{cases.HandleFinalSigma(false)}, opts...) - o.cases = cases.Lower(language.Und, opts...) - } -} - -// The Disallow option further restricts a Profile's allowed characters beyond -// what is disallowed by the underlying string class. -func Disallow(set runes.Set) Option { - return func(o *options) { - o.disallow = set - } -} diff --git a/vendor/golang.org/x/text/secure/precis/profile.go b/vendor/golang.org/x/text/secure/precis/profile.go deleted file mode 100644 index bf102533..00000000 --- a/vendor/golang.org/x/text/secure/precis/profile.go +++ /dev/null @@ -1,378 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import ( - "bytes" - "errors" - "unicode/utf8" - - "golang.org/x/text/cases" - "golang.org/x/text/language" - "golang.org/x/text/runes" - "golang.org/x/text/secure/bidirule" - "golang.org/x/text/transform" - "golang.org/x/text/width" -) - -var ( - errDisallowedRune = errors.New("precis: disallowed rune encountered") -) - -var dpTrie = newDerivedPropertiesTrie(0) - -// A Profile represents a set of rules for normalizing and validating strings in -// the PRECIS framework. -type Profile struct { - options - class *class -} - -// NewIdentifier creates a new PRECIS profile based on the Identifier string -// class. Profiles created from this class are suitable for use where safety is -// prioritized over expressiveness like network identifiers, user accounts, chat -// rooms, and file names. -func NewIdentifier(opts ...Option) *Profile { - return &Profile{ - options: getOpts(opts...), - class: identifier, - } -} - -// NewFreeform creates a new PRECIS profile based on the Freeform string class. -// Profiles created from this class are suitable for use where expressiveness is -// prioritized over safety like passwords, and display-elements such as -// nicknames in a chat room. -func NewFreeform(opts ...Option) *Profile { - return &Profile{ - options: getOpts(opts...), - class: freeform, - } -} - -// NewTransformer creates a new transform.Transformer that performs the PRECIS -// preparation and enforcement steps on the given UTF-8 encoded bytes. -func (p *Profile) NewTransformer() *Transformer { - var ts []transform.Transformer - - // These transforms are applied in the order defined in - // https://tools.ietf.org/html/rfc7564#section-7 - - if p.options.foldWidth { - ts = append(ts, width.Fold) - } - - for _, f := range p.options.additional { - ts = append(ts, f()) - } - - if p.options.cases != nil { - ts = append(ts, p.options.cases) - } - - ts = append(ts, p.options.norm) - - if p.options.bidiRule { - ts = append(ts, bidirule.New()) - } - - ts = append(ts, &checker{p: p, allowed: p.Allowed()}) - - // TODO: Add the disallow empty rule with a dummy transformer? - - return &Transformer{transform.Chain(ts...)} -} - -var errEmptyString = errors.New("precis: transformation resulted in empty string") - -type buffers struct { - src []byte - buf [2][]byte - next int -} - -func (b *buffers) apply(t transform.SpanningTransformer) (err error) { - n, err := t.Span(b.src, true) - if err != transform.ErrEndOfSpan { - return err - } - x := b.next & 1 - if b.buf[x] == nil { - b.buf[x] = make([]byte, 0, 8+len(b.src)+len(b.src)>>2) - } - span := append(b.buf[x][:0], b.src[:n]...) - b.src, _, err = transform.Append(t, span, b.src[n:]) - b.buf[x] = b.src - b.next++ - return err -} - -// Pre-allocate transformers when possible. In some cases this avoids allocation. -var ( - foldWidthT transform.SpanningTransformer = width.Fold - lowerCaseT transform.SpanningTransformer = cases.Lower(language.Und, cases.HandleFinalSigma(false)) -) - -// TODO: make this a method on profile. - -func (b *buffers) enforce(p *Profile, src []byte, comparing bool) (str []byte, err error) { - b.src = src - - ascii := true - for _, c := range src { - if c >= utf8.RuneSelf { - ascii = false - break - } - } - // ASCII fast path. - if ascii { - for _, f := range p.options.additional { - if err = b.apply(f()); err != nil { - return nil, err - } - } - switch { - case p.options.asciiLower || (comparing && p.options.ignorecase): - for i, c := range b.src { - if 'A' <= c && c <= 'Z' { - b.src[i] = c ^ 1<<5 - } - } - case p.options.cases != nil: - b.apply(p.options.cases) - } - c := checker{p: p} - if _, err := c.span(b.src, true); err != nil { - return nil, err - } - if p.disallow != nil { - for _, c := range b.src { - if p.disallow.Contains(rune(c)) { - return nil, errDisallowedRune - } - } - } - if p.options.disallowEmpty && len(b.src) == 0 { - return nil, errEmptyString - } - return b.src, nil - } - - // These transforms are applied in the order defined in - // https://tools.ietf.org/html/rfc7564#section-7 - - // TODO: allow different width transforms options. - if p.options.foldWidth || (p.options.ignorecase && comparing) { - b.apply(foldWidthT) - } - for _, f := range p.options.additional { - if err = b.apply(f()); err != nil { - return nil, err - } - } - if p.options.cases != nil { - b.apply(p.options.cases) - } - if comparing && p.options.ignorecase { - b.apply(lowerCaseT) - } - b.apply(p.norm) - if p.options.bidiRule && !bidirule.Valid(b.src) { - return nil, bidirule.ErrInvalid - } - c := checker{p: p} - if _, err := c.span(b.src, true); err != nil { - return nil, err - } - if p.disallow != nil { - for i := 0; i < len(b.src); { - r, size := utf8.DecodeRune(b.src[i:]) - if p.disallow.Contains(r) { - return nil, errDisallowedRune - } - i += size - } - } - if p.options.disallowEmpty && len(b.src) == 0 { - return nil, errEmptyString - } - return b.src, nil -} - -// Append appends the result of applying p to src writing the result to dst. -// It returns an error if the input string is invalid. -func (p *Profile) Append(dst, src []byte) ([]byte, error) { - var buf buffers - b, err := buf.enforce(p, src, false) - if err != nil { - return nil, err - } - return append(dst, b...), nil -} - -func processBytes(p *Profile, b []byte, key bool) ([]byte, error) { - var buf buffers - b, err := buf.enforce(p, b, key) - if err != nil { - return nil, err - } - if buf.next == 0 { - c := make([]byte, len(b)) - copy(c, b) - return c, nil - } - return b, nil -} - -// Bytes returns a new byte slice with the result of applying the profile to b. -func (p *Profile) Bytes(b []byte) ([]byte, error) { - return processBytes(p, b, false) -} - -// AppendCompareKey appends the result of applying p to src (including any -// optional rules to make strings comparable or useful in a map key such as -// applying lowercasing) writing the result to dst. It returns an error if the -// input string is invalid. -func (p *Profile) AppendCompareKey(dst, src []byte) ([]byte, error) { - var buf buffers - b, err := buf.enforce(p, src, true) - if err != nil { - return nil, err - } - return append(dst, b...), nil -} - -func processString(p *Profile, s string, key bool) (string, error) { - var buf buffers - b, err := buf.enforce(p, []byte(s), key) - if err != nil { - return "", err - } - return string(b), nil -} - -// String returns a string with the result of applying the profile to s. -func (p *Profile) String(s string) (string, error) { - return processString(p, s, false) -} - -// CompareKey returns a string that can be used for comparison, hashing, or -// collation. -func (p *Profile) CompareKey(s string) (string, error) { - return processString(p, s, true) -} - -// Compare enforces both strings, and then compares them for bit-string identity -// (byte-for-byte equality). If either string cannot be enforced, the comparison -// is false. -func (p *Profile) Compare(a, b string) bool { - var buf buffers - - akey, err := buf.enforce(p, []byte(a), true) - if err != nil { - return false - } - - buf = buffers{} - bkey, err := buf.enforce(p, []byte(b), true) - if err != nil { - return false - } - - return bytes.Compare(akey, bkey) == 0 -} - -// Allowed returns a runes.Set containing every rune that is a member of the -// underlying profile's string class and not disallowed by any profile specific -// rules. -func (p *Profile) Allowed() runes.Set { - if p.options.disallow != nil { - return runes.Predicate(func(r rune) bool { - return p.class.Contains(r) && !p.options.disallow.Contains(r) - }) - } - return p.class -} - -type checker struct { - p *Profile - allowed runes.Set - - beforeBits catBitmap - termBits catBitmap - acceptBits catBitmap -} - -func (c *checker) Reset() { - c.beforeBits = 0 - c.termBits = 0 - c.acceptBits = 0 -} - -func (c *checker) span(src []byte, atEOF bool) (n int, err error) { - for n < len(src) { - e, sz := dpTrie.lookup(src[n:]) - d := categoryTransitions[category(e&catMask)] - if sz == 0 { - if !atEOF { - return n, transform.ErrShortSrc - } - return n, errDisallowedRune - } - doLookAhead := false - if property(e) < c.p.class.validFrom { - if d.rule == nil { - return n, errDisallowedRune - } - doLookAhead, err = d.rule(c.beforeBits) - if err != nil { - return n, err - } - } - c.beforeBits &= d.keep - c.beforeBits |= d.set - if c.termBits != 0 { - // We are currently in an unterminated lookahead. - if c.beforeBits&c.termBits != 0 { - c.termBits = 0 - c.acceptBits = 0 - } else if c.beforeBits&c.acceptBits == 0 { - // Invalid continuation of the unterminated lookahead sequence. - return n, errContext - } - } - if doLookAhead { - if c.termBits != 0 { - // A previous lookahead run has not been terminated yet. - return n, errContext - } - c.termBits = d.term - c.acceptBits = d.accept - } - n += sz - } - if m := c.beforeBits >> finalShift; c.beforeBits&m != m || c.termBits != 0 { - err = errContext - } - return n, err -} - -// TODO: we may get rid of this transform if transform.Chain understands -// something like a Spanner interface. -func (c checker) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - short := false - if len(dst) < len(src) { - src = src[:len(dst)] - atEOF = false - short = true - } - nSrc, err = c.span(src, atEOF) - nDst = copy(dst, src[:nSrc]) - if short && (err == transform.ErrShortSrc || err == nil) { - err = transform.ErrShortDst - } - return nDst, nSrc, err -} diff --git a/vendor/golang.org/x/text/secure/precis/profiles.go b/vendor/golang.org/x/text/secure/precis/profiles.go deleted file mode 100644 index 86010025..00000000 --- a/vendor/golang.org/x/text/secure/precis/profiles.go +++ /dev/null @@ -1,78 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import ( - "unicode" - - "golang.org/x/text/runes" - "golang.org/x/text/transform" - "golang.org/x/text/unicode/norm" -) - -var ( - // Implements the Nickname profile specified in RFC 7700. - // The nickname profile is not idempotent and may need to be applied multiple - // times before being used for comparisons. - Nickname *Profile = nickname - - // Implements the UsernameCaseMapped profile specified in RFC 7613. - UsernameCaseMapped *Profile = usernameCaseMap - - // Implements the UsernameCasePreserved profile specified in RFC 7613. - UsernameCasePreserved *Profile = usernameNoCaseMap - - // Implements the OpaqueString profile defined in RFC 7613 for passwords and other secure labels. - OpaqueString *Profile = opaquestring -) - -var ( - nickname = &Profile{ - options: getOpts( - AdditionalMapping(func() transform.Transformer { - return &nickAdditionalMapping{} - }), - IgnoreCase, - Norm(norm.NFKC), - DisallowEmpty, - ), - class: freeform, - } - usernameCaseMap = &Profile{ - options: getOpts( - FoldWidth, - LowerCase(), - Norm(norm.NFC), - BidiRule, - ), - class: identifier, - } - usernameNoCaseMap = &Profile{ - options: getOpts( - FoldWidth, - Norm(norm.NFC), - BidiRule, - ), - class: identifier, - } - opaquestring = &Profile{ - options: getOpts( - AdditionalMapping(func() transform.Transformer { - return mapSpaces - }), - Norm(norm.NFC), - DisallowEmpty, - ), - class: freeform, - } -) - -// mapSpaces is a shared value of a runes.Map transformer. -var mapSpaces transform.Transformer = runes.Map(func(r rune) rune { - if unicode.Is(unicode.Zs, r) { - return ' ' - } - return r -}) diff --git a/vendor/golang.org/x/text/secure/precis/tables.go b/vendor/golang.org/x/text/secure/precis/tables.go deleted file mode 100644 index 2f550c1e..00000000 --- a/vendor/golang.org/x/text/secure/precis/tables.go +++ /dev/null @@ -1,3788 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package precis - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "9.0.0" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *derivedPropertiesTrie) lookup(s []byte) (v uint8, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return derivedPropertiesValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := derivedPropertiesIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := derivedPropertiesIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = derivedPropertiesIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := derivedPropertiesIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = derivedPropertiesIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = derivedPropertiesIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *derivedPropertiesTrie) lookupUnsafe(s []byte) uint8 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return derivedPropertiesValues[c0] - } - i := derivedPropertiesIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *derivedPropertiesTrie) lookupString(s string) (v uint8, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return derivedPropertiesValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := derivedPropertiesIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := derivedPropertiesIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = derivedPropertiesIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := derivedPropertiesIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = derivedPropertiesIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = derivedPropertiesIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *derivedPropertiesTrie) lookupStringUnsafe(s string) uint8 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return derivedPropertiesValues[c0] - } - i := derivedPropertiesIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = derivedPropertiesIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// derivedPropertiesTrie. Total size: 25344 bytes (24.75 KiB). Checksum: c5b977d76d42d8a. -type derivedPropertiesTrie struct{} - -func newDerivedPropertiesTrie(i int) *derivedPropertiesTrie { - return &derivedPropertiesTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *derivedPropertiesTrie) lookupValue(n uint32, b byte) uint8 { - switch { - default: - return uint8(derivedPropertiesValues[n<<6+uint32(b)]) - } -} - -// derivedPropertiesValues: 324 blocks, 20736 entries, 20736 bytes -// The third block is the zero block. -var derivedPropertiesValues = [20736]uint8{ - // Block 0x0, offset 0x0 - 0x00: 0x0040, 0x01: 0x0040, 0x02: 0x0040, 0x03: 0x0040, 0x04: 0x0040, 0x05: 0x0040, - 0x06: 0x0040, 0x07: 0x0040, 0x08: 0x0040, 0x09: 0x0040, 0x0a: 0x0040, 0x0b: 0x0040, - 0x0c: 0x0040, 0x0d: 0x0040, 0x0e: 0x0040, 0x0f: 0x0040, 0x10: 0x0040, 0x11: 0x0040, - 0x12: 0x0040, 0x13: 0x0040, 0x14: 0x0040, 0x15: 0x0040, 0x16: 0x0040, 0x17: 0x0040, - 0x18: 0x0040, 0x19: 0x0040, 0x1a: 0x0040, 0x1b: 0x0040, 0x1c: 0x0040, 0x1d: 0x0040, - 0x1e: 0x0040, 0x1f: 0x0040, 0x20: 0x0080, 0x21: 0x00c0, 0x22: 0x00c0, 0x23: 0x00c0, - 0x24: 0x00c0, 0x25: 0x00c0, 0x26: 0x00c0, 0x27: 0x00c0, 0x28: 0x00c0, 0x29: 0x00c0, - 0x2a: 0x00c0, 0x2b: 0x00c0, 0x2c: 0x00c0, 0x2d: 0x00c0, 0x2e: 0x00c0, 0x2f: 0x00c0, - 0x30: 0x00c0, 0x31: 0x00c0, 0x32: 0x00c0, 0x33: 0x00c0, 0x34: 0x00c0, 0x35: 0x00c0, - 0x36: 0x00c0, 0x37: 0x00c0, 0x38: 0x00c0, 0x39: 0x00c0, 0x3a: 0x00c0, 0x3b: 0x00c0, - 0x3c: 0x00c0, 0x3d: 0x00c0, 0x3e: 0x00c0, 0x3f: 0x00c0, - // Block 0x1, offset 0x40 - 0x40: 0x00c0, 0x41: 0x00c0, 0x42: 0x00c0, 0x43: 0x00c0, 0x44: 0x00c0, 0x45: 0x00c0, - 0x46: 0x00c0, 0x47: 0x00c0, 0x48: 0x00c0, 0x49: 0x00c0, 0x4a: 0x00c0, 0x4b: 0x00c0, - 0x4c: 0x00c0, 0x4d: 0x00c0, 0x4e: 0x00c0, 0x4f: 0x00c0, 0x50: 0x00c0, 0x51: 0x00c0, - 0x52: 0x00c0, 0x53: 0x00c0, 0x54: 0x00c0, 0x55: 0x00c0, 0x56: 0x00c0, 0x57: 0x00c0, - 0x58: 0x00c0, 0x59: 0x00c0, 0x5a: 0x00c0, 0x5b: 0x00c0, 0x5c: 0x00c0, 0x5d: 0x00c0, - 0x5e: 0x00c0, 0x5f: 0x00c0, 0x60: 0x00c0, 0x61: 0x00c0, 0x62: 0x00c0, 0x63: 0x00c0, - 0x64: 0x00c0, 0x65: 0x00c0, 0x66: 0x00c0, 0x67: 0x00c0, 0x68: 0x00c0, 0x69: 0x00c0, - 0x6a: 0x00c0, 0x6b: 0x00c0, 0x6c: 0x00c7, 0x6d: 0x00c0, 0x6e: 0x00c0, 0x6f: 0x00c0, - 0x70: 0x00c0, 0x71: 0x00c0, 0x72: 0x00c0, 0x73: 0x00c0, 0x74: 0x00c0, 0x75: 0x00c0, - 0x76: 0x00c0, 0x77: 0x00c0, 0x78: 0x00c0, 0x79: 0x00c0, 0x7a: 0x00c0, 0x7b: 0x00c0, - 0x7c: 0x00c0, 0x7d: 0x00c0, 0x7e: 0x00c0, 0x7f: 0x0040, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc0: 0x0040, 0xc1: 0x0040, 0xc2: 0x0040, 0xc3: 0x0040, 0xc4: 0x0040, 0xc5: 0x0040, - 0xc6: 0x0040, 0xc7: 0x0040, 0xc8: 0x0040, 0xc9: 0x0040, 0xca: 0x0040, 0xcb: 0x0040, - 0xcc: 0x0040, 0xcd: 0x0040, 0xce: 0x0040, 0xcf: 0x0040, 0xd0: 0x0040, 0xd1: 0x0040, - 0xd2: 0x0040, 0xd3: 0x0040, 0xd4: 0x0040, 0xd5: 0x0040, 0xd6: 0x0040, 0xd7: 0x0040, - 0xd8: 0x0040, 0xd9: 0x0040, 0xda: 0x0040, 0xdb: 0x0040, 0xdc: 0x0040, 0xdd: 0x0040, - 0xde: 0x0040, 0xdf: 0x0040, 0xe0: 0x0080, 0xe1: 0x0080, 0xe2: 0x0080, 0xe3: 0x0080, - 0xe4: 0x0080, 0xe5: 0x0080, 0xe6: 0x0080, 0xe7: 0x0080, 0xe8: 0x0080, 0xe9: 0x0080, - 0xea: 0x0080, 0xeb: 0x0080, 0xec: 0x0080, 0xed: 0x0040, 0xee: 0x0080, 0xef: 0x0080, - 0xf0: 0x0080, 0xf1: 0x0080, 0xf2: 0x0080, 0xf3: 0x0080, 0xf4: 0x0080, 0xf5: 0x0080, - 0xf6: 0x0080, 0xf7: 0x004f, 0xf8: 0x0080, 0xf9: 0x0080, 0xfa: 0x0080, 0xfb: 0x0080, - 0xfc: 0x0080, 0xfd: 0x0080, 0xfe: 0x0080, 0xff: 0x0080, - // Block 0x4, offset 0x100 - 0x100: 0x00c0, 0x101: 0x00c0, 0x102: 0x00c0, 0x103: 0x00c0, 0x104: 0x00c0, 0x105: 0x00c0, - 0x106: 0x00c0, 0x107: 0x00c0, 0x108: 0x00c0, 0x109: 0x00c0, 0x10a: 0x00c0, 0x10b: 0x00c0, - 0x10c: 0x00c0, 0x10d: 0x00c0, 0x10e: 0x00c0, 0x10f: 0x00c0, 0x110: 0x00c0, 0x111: 0x00c0, - 0x112: 0x00c0, 0x113: 0x00c0, 0x114: 0x00c0, 0x115: 0x00c0, 0x116: 0x00c0, 0x117: 0x0080, - 0x118: 0x00c0, 0x119: 0x00c0, 0x11a: 0x00c0, 0x11b: 0x00c0, 0x11c: 0x00c0, 0x11d: 0x00c0, - 0x11e: 0x00c0, 0x11f: 0x00c0, 0x120: 0x00c0, 0x121: 0x00c0, 0x122: 0x00c0, 0x123: 0x00c0, - 0x124: 0x00c0, 0x125: 0x00c0, 0x126: 0x00c0, 0x127: 0x00c0, 0x128: 0x00c0, 0x129: 0x00c0, - 0x12a: 0x00c0, 0x12b: 0x00c0, 0x12c: 0x00c0, 0x12d: 0x00c0, 0x12e: 0x00c0, 0x12f: 0x00c0, - 0x130: 0x00c0, 0x131: 0x00c0, 0x132: 0x00c0, 0x133: 0x00c0, 0x134: 0x00c0, 0x135: 0x00c0, - 0x136: 0x00c0, 0x137: 0x0080, 0x138: 0x00c0, 0x139: 0x00c0, 0x13a: 0x00c0, 0x13b: 0x00c0, - 0x13c: 0x00c0, 0x13d: 0x00c0, 0x13e: 0x00c0, 0x13f: 0x00c0, - // Block 0x5, offset 0x140 - 0x140: 0x00c0, 0x141: 0x00c0, 0x142: 0x00c0, 0x143: 0x00c0, 0x144: 0x00c0, 0x145: 0x00c0, - 0x146: 0x00c0, 0x147: 0x00c0, 0x148: 0x00c0, 0x149: 0x00c0, 0x14a: 0x00c0, 0x14b: 0x00c0, - 0x14c: 0x00c0, 0x14d: 0x00c0, 0x14e: 0x00c0, 0x14f: 0x00c0, 0x150: 0x00c0, 0x151: 0x00c0, - 0x152: 0x00c0, 0x153: 0x00c0, 0x154: 0x00c0, 0x155: 0x00c0, 0x156: 0x00c0, 0x157: 0x00c0, - 0x158: 0x00c0, 0x159: 0x00c0, 0x15a: 0x00c0, 0x15b: 0x00c0, 0x15c: 0x00c0, 0x15d: 0x00c0, - 0x15e: 0x00c0, 0x15f: 0x00c0, 0x160: 0x00c0, 0x161: 0x00c0, 0x162: 0x00c0, 0x163: 0x00c0, - 0x164: 0x00c0, 0x165: 0x00c0, 0x166: 0x00c0, 0x167: 0x00c0, 0x168: 0x00c0, 0x169: 0x00c0, - 0x16a: 0x00c0, 0x16b: 0x00c0, 0x16c: 0x00c0, 0x16d: 0x00c0, 0x16e: 0x00c0, 0x16f: 0x00c0, - 0x170: 0x00c0, 0x171: 0x00c0, 0x172: 0x0080, 0x173: 0x0080, 0x174: 0x00c0, 0x175: 0x00c0, - 0x176: 0x00c0, 0x177: 0x00c0, 0x178: 0x00c0, 0x179: 0x00c0, 0x17a: 0x00c0, 0x17b: 0x00c0, - 0x17c: 0x00c0, 0x17d: 0x00c0, 0x17e: 0x00c0, 0x17f: 0x0080, - // Block 0x6, offset 0x180 - 0x180: 0x0080, 0x181: 0x00c0, 0x182: 0x00c0, 0x183: 0x00c0, 0x184: 0x00c0, 0x185: 0x00c0, - 0x186: 0x00c0, 0x187: 0x00c0, 0x188: 0x00c0, 0x189: 0x0080, 0x18a: 0x00c0, 0x18b: 0x00c0, - 0x18c: 0x00c0, 0x18d: 0x00c0, 0x18e: 0x00c0, 0x18f: 0x00c0, 0x190: 0x00c0, 0x191: 0x00c0, - 0x192: 0x00c0, 0x193: 0x00c0, 0x194: 0x00c0, 0x195: 0x00c0, 0x196: 0x00c0, 0x197: 0x00c0, - 0x198: 0x00c0, 0x199: 0x00c0, 0x19a: 0x00c0, 0x19b: 0x00c0, 0x19c: 0x00c0, 0x19d: 0x00c0, - 0x19e: 0x00c0, 0x19f: 0x00c0, 0x1a0: 0x00c0, 0x1a1: 0x00c0, 0x1a2: 0x00c0, 0x1a3: 0x00c0, - 0x1a4: 0x00c0, 0x1a5: 0x00c0, 0x1a6: 0x00c0, 0x1a7: 0x00c0, 0x1a8: 0x00c0, 0x1a9: 0x00c0, - 0x1aa: 0x00c0, 0x1ab: 0x00c0, 0x1ac: 0x00c0, 0x1ad: 0x00c0, 0x1ae: 0x00c0, 0x1af: 0x00c0, - 0x1b0: 0x00c0, 0x1b1: 0x00c0, 0x1b2: 0x00c0, 0x1b3: 0x00c0, 0x1b4: 0x00c0, 0x1b5: 0x00c0, - 0x1b6: 0x00c0, 0x1b7: 0x00c0, 0x1b8: 0x00c0, 0x1b9: 0x00c0, 0x1ba: 0x00c0, 0x1bb: 0x00c0, - 0x1bc: 0x00c0, 0x1bd: 0x00c0, 0x1be: 0x00c0, 0x1bf: 0x0080, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x00c0, 0x1c1: 0x00c0, 0x1c2: 0x00c0, 0x1c3: 0x00c0, 0x1c4: 0x00c0, 0x1c5: 0x00c0, - 0x1c6: 0x00c0, 0x1c7: 0x00c0, 0x1c8: 0x00c0, 0x1c9: 0x00c0, 0x1ca: 0x00c0, 0x1cb: 0x00c0, - 0x1cc: 0x00c0, 0x1cd: 0x00c0, 0x1ce: 0x00c0, 0x1cf: 0x00c0, 0x1d0: 0x00c0, 0x1d1: 0x00c0, - 0x1d2: 0x00c0, 0x1d3: 0x00c0, 0x1d4: 0x00c0, 0x1d5: 0x00c0, 0x1d6: 0x00c0, 0x1d7: 0x00c0, - 0x1d8: 0x00c0, 0x1d9: 0x00c0, 0x1da: 0x00c0, 0x1db: 0x00c0, 0x1dc: 0x00c0, 0x1dd: 0x00c0, - 0x1de: 0x00c0, 0x1df: 0x00c0, 0x1e0: 0x00c0, 0x1e1: 0x00c0, 0x1e2: 0x00c0, 0x1e3: 0x00c0, - 0x1e4: 0x00c0, 0x1e5: 0x00c0, 0x1e6: 0x00c0, 0x1e7: 0x00c0, 0x1e8: 0x00c0, 0x1e9: 0x00c0, - 0x1ea: 0x00c0, 0x1eb: 0x00c0, 0x1ec: 0x00c0, 0x1ed: 0x00c0, 0x1ee: 0x00c0, 0x1ef: 0x00c0, - 0x1f0: 0x00c0, 0x1f1: 0x00c0, 0x1f2: 0x00c0, 0x1f3: 0x00c0, 0x1f4: 0x00c0, 0x1f5: 0x00c0, - 0x1f6: 0x00c0, 0x1f7: 0x00c0, 0x1f8: 0x00c0, 0x1f9: 0x00c0, 0x1fa: 0x00c0, 0x1fb: 0x00c0, - 0x1fc: 0x00c0, 0x1fd: 0x00c0, 0x1fe: 0x00c0, 0x1ff: 0x00c0, - // Block 0x8, offset 0x200 - 0x200: 0x00c0, 0x201: 0x00c0, 0x202: 0x00c0, 0x203: 0x00c0, 0x204: 0x0080, 0x205: 0x0080, - 0x206: 0x0080, 0x207: 0x0080, 0x208: 0x0080, 0x209: 0x0080, 0x20a: 0x0080, 0x20b: 0x0080, - 0x20c: 0x0080, 0x20d: 0x00c0, 0x20e: 0x00c0, 0x20f: 0x00c0, 0x210: 0x00c0, 0x211: 0x00c0, - 0x212: 0x00c0, 0x213: 0x00c0, 0x214: 0x00c0, 0x215: 0x00c0, 0x216: 0x00c0, 0x217: 0x00c0, - 0x218: 0x00c0, 0x219: 0x00c0, 0x21a: 0x00c0, 0x21b: 0x00c0, 0x21c: 0x00c0, 0x21d: 0x00c0, - 0x21e: 0x00c0, 0x21f: 0x00c0, 0x220: 0x00c0, 0x221: 0x00c0, 0x222: 0x00c0, 0x223: 0x00c0, - 0x224: 0x00c0, 0x225: 0x00c0, 0x226: 0x00c0, 0x227: 0x00c0, 0x228: 0x00c0, 0x229: 0x00c0, - 0x22a: 0x00c0, 0x22b: 0x00c0, 0x22c: 0x00c0, 0x22d: 0x00c0, 0x22e: 0x00c0, 0x22f: 0x00c0, - 0x230: 0x00c0, 0x231: 0x0080, 0x232: 0x0080, 0x233: 0x0080, 0x234: 0x00c0, 0x235: 0x00c0, - 0x236: 0x00c0, 0x237: 0x00c0, 0x238: 0x00c0, 0x239: 0x00c0, 0x23a: 0x00c0, 0x23b: 0x00c0, - 0x23c: 0x00c0, 0x23d: 0x00c0, 0x23e: 0x00c0, 0x23f: 0x00c0, - // Block 0x9, offset 0x240 - 0x240: 0x00c0, 0x241: 0x00c0, 0x242: 0x00c0, 0x243: 0x00c0, 0x244: 0x00c0, 0x245: 0x00c0, - 0x246: 0x00c0, 0x247: 0x00c0, 0x248: 0x00c0, 0x249: 0x00c0, 0x24a: 0x00c0, 0x24b: 0x00c0, - 0x24c: 0x00c0, 0x24d: 0x00c0, 0x24e: 0x00c0, 0x24f: 0x00c0, 0x250: 0x00c0, 0x251: 0x00c0, - 0x252: 0x00c0, 0x253: 0x00c0, 0x254: 0x00c0, 0x255: 0x00c0, 0x256: 0x00c0, 0x257: 0x00c0, - 0x258: 0x00c0, 0x259: 0x00c0, 0x25a: 0x00c0, 0x25b: 0x00c0, 0x25c: 0x00c0, 0x25d: 0x00c0, - 0x25e: 0x00c0, 0x25f: 0x00c0, 0x260: 0x00c0, 0x261: 0x00c0, 0x262: 0x00c0, 0x263: 0x00c0, - 0x264: 0x00c0, 0x265: 0x00c0, 0x266: 0x00c0, 0x267: 0x00c0, 0x268: 0x00c0, 0x269: 0x00c0, - 0x26a: 0x00c0, 0x26b: 0x00c0, 0x26c: 0x00c0, 0x26d: 0x00c0, 0x26e: 0x00c0, 0x26f: 0x00c0, - 0x270: 0x0080, 0x271: 0x0080, 0x272: 0x0080, 0x273: 0x0080, 0x274: 0x0080, 0x275: 0x0080, - 0x276: 0x0080, 0x277: 0x0080, 0x278: 0x0080, 0x279: 0x00c0, 0x27a: 0x00c0, 0x27b: 0x00c0, - 0x27c: 0x00c0, 0x27d: 0x00c0, 0x27e: 0x00c0, 0x27f: 0x00c0, - // Block 0xa, offset 0x280 - 0x280: 0x00c0, 0x281: 0x00c0, 0x282: 0x0080, 0x283: 0x0080, 0x284: 0x0080, 0x285: 0x0080, - 0x286: 0x00c0, 0x287: 0x00c0, 0x288: 0x00c0, 0x289: 0x00c0, 0x28a: 0x00c0, 0x28b: 0x00c0, - 0x28c: 0x00c0, 0x28d: 0x00c0, 0x28e: 0x00c0, 0x28f: 0x00c0, 0x290: 0x00c0, 0x291: 0x00c0, - 0x292: 0x0080, 0x293: 0x0080, 0x294: 0x0080, 0x295: 0x0080, 0x296: 0x0080, 0x297: 0x0080, - 0x298: 0x0080, 0x299: 0x0080, 0x29a: 0x0080, 0x29b: 0x0080, 0x29c: 0x0080, 0x29d: 0x0080, - 0x29e: 0x0080, 0x29f: 0x0080, 0x2a0: 0x0080, 0x2a1: 0x0080, 0x2a2: 0x0080, 0x2a3: 0x0080, - 0x2a4: 0x0080, 0x2a5: 0x0080, 0x2a6: 0x0080, 0x2a7: 0x0080, 0x2a8: 0x0080, 0x2a9: 0x0080, - 0x2aa: 0x0080, 0x2ab: 0x0080, 0x2ac: 0x00c0, 0x2ad: 0x0080, 0x2ae: 0x00c0, 0x2af: 0x0080, - 0x2b0: 0x0080, 0x2b1: 0x0080, 0x2b2: 0x0080, 0x2b3: 0x0080, 0x2b4: 0x0080, 0x2b5: 0x0080, - 0x2b6: 0x0080, 0x2b7: 0x0080, 0x2b8: 0x0080, 0x2b9: 0x0080, 0x2ba: 0x0080, 0x2bb: 0x0080, - 0x2bc: 0x0080, 0x2bd: 0x0080, 0x2be: 0x0080, 0x2bf: 0x0080, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x00c3, 0x2c1: 0x00c3, 0x2c2: 0x00c3, 0x2c3: 0x00c3, 0x2c4: 0x00c3, 0x2c5: 0x00c3, - 0x2c6: 0x00c3, 0x2c7: 0x00c3, 0x2c8: 0x00c3, 0x2c9: 0x00c3, 0x2ca: 0x00c3, 0x2cb: 0x00c3, - 0x2cc: 0x00c3, 0x2cd: 0x00c3, 0x2ce: 0x00c3, 0x2cf: 0x00c3, 0x2d0: 0x00c3, 0x2d1: 0x00c3, - 0x2d2: 0x00c3, 0x2d3: 0x00c3, 0x2d4: 0x00c3, 0x2d5: 0x00c3, 0x2d6: 0x00c3, 0x2d7: 0x00c3, - 0x2d8: 0x00c3, 0x2d9: 0x00c3, 0x2da: 0x00c3, 0x2db: 0x00c3, 0x2dc: 0x00c3, 0x2dd: 0x00c3, - 0x2de: 0x00c3, 0x2df: 0x00c3, 0x2e0: 0x00c3, 0x2e1: 0x00c3, 0x2e2: 0x00c3, 0x2e3: 0x00c3, - 0x2e4: 0x00c3, 0x2e5: 0x00c3, 0x2e6: 0x00c3, 0x2e7: 0x00c3, 0x2e8: 0x00c3, 0x2e9: 0x00c3, - 0x2ea: 0x00c3, 0x2eb: 0x00c3, 0x2ec: 0x00c3, 0x2ed: 0x00c3, 0x2ee: 0x00c3, 0x2ef: 0x00c3, - 0x2f0: 0x00c3, 0x2f1: 0x00c3, 0x2f2: 0x00c3, 0x2f3: 0x00c3, 0x2f4: 0x00c3, 0x2f5: 0x00c3, - 0x2f6: 0x00c3, 0x2f7: 0x00c3, 0x2f8: 0x00c3, 0x2f9: 0x00c3, 0x2fa: 0x00c3, 0x2fb: 0x00c3, - 0x2fc: 0x00c3, 0x2fd: 0x00c3, 0x2fe: 0x00c3, 0x2ff: 0x00c3, - // Block 0xc, offset 0x300 - 0x300: 0x0083, 0x301: 0x0083, 0x302: 0x00c3, 0x303: 0x0083, 0x304: 0x0083, 0x305: 0x00c3, - 0x306: 0x00c3, 0x307: 0x00c3, 0x308: 0x00c3, 0x309: 0x00c3, 0x30a: 0x00c3, 0x30b: 0x00c3, - 0x30c: 0x00c3, 0x30d: 0x00c3, 0x30e: 0x00c3, 0x30f: 0x0040, 0x310: 0x00c3, 0x311: 0x00c3, - 0x312: 0x00c3, 0x313: 0x00c3, 0x314: 0x00c3, 0x315: 0x00c3, 0x316: 0x00c3, 0x317: 0x00c3, - 0x318: 0x00c3, 0x319: 0x00c3, 0x31a: 0x00c3, 0x31b: 0x00c3, 0x31c: 0x00c3, 0x31d: 0x00c3, - 0x31e: 0x00c3, 0x31f: 0x00c3, 0x320: 0x00c3, 0x321: 0x00c3, 0x322: 0x00c3, 0x323: 0x00c3, - 0x324: 0x00c3, 0x325: 0x00c3, 0x326: 0x00c3, 0x327: 0x00c3, 0x328: 0x00c3, 0x329: 0x00c3, - 0x32a: 0x00c3, 0x32b: 0x00c3, 0x32c: 0x00c3, 0x32d: 0x00c3, 0x32e: 0x00c3, 0x32f: 0x00c3, - 0x330: 0x00c8, 0x331: 0x00c8, 0x332: 0x00c8, 0x333: 0x00c8, 0x334: 0x0080, 0x335: 0x0050, - 0x336: 0x00c8, 0x337: 0x00c8, 0x33a: 0x0088, 0x33b: 0x00c8, - 0x33c: 0x00c8, 0x33d: 0x00c8, 0x33e: 0x0080, 0x33f: 0x00c8, - // Block 0xd, offset 0x340 - 0x344: 0x0088, 0x345: 0x0080, - 0x346: 0x00c8, 0x347: 0x0080, 0x348: 0x00c8, 0x349: 0x00c8, 0x34a: 0x00c8, - 0x34c: 0x00c8, 0x34e: 0x00c8, 0x34f: 0x00c8, 0x350: 0x00c8, 0x351: 0x00c8, - 0x352: 0x00c8, 0x353: 0x00c8, 0x354: 0x00c8, 0x355: 0x00c8, 0x356: 0x00c8, 0x357: 0x00c8, - 0x358: 0x00c8, 0x359: 0x00c8, 0x35a: 0x00c8, 0x35b: 0x00c8, 0x35c: 0x00c8, 0x35d: 0x00c8, - 0x35e: 0x00c8, 0x35f: 0x00c8, 0x360: 0x00c8, 0x361: 0x00c8, 0x363: 0x00c8, - 0x364: 0x00c8, 0x365: 0x00c8, 0x366: 0x00c8, 0x367: 0x00c8, 0x368: 0x00c8, 0x369: 0x00c8, - 0x36a: 0x00c8, 0x36b: 0x00c8, 0x36c: 0x00c8, 0x36d: 0x00c8, 0x36e: 0x00c8, 0x36f: 0x00c8, - 0x370: 0x00c8, 0x371: 0x00c8, 0x372: 0x00c8, 0x373: 0x00c8, 0x374: 0x00c8, 0x375: 0x00c8, - 0x376: 0x00c8, 0x377: 0x00c8, 0x378: 0x00c8, 0x379: 0x00c8, 0x37a: 0x00c8, 0x37b: 0x00c8, - 0x37c: 0x00c8, 0x37d: 0x00c8, 0x37e: 0x00c8, 0x37f: 0x00c8, - // Block 0xe, offset 0x380 - 0x380: 0x00c8, 0x381: 0x00c8, 0x382: 0x00c8, 0x383: 0x00c8, 0x384: 0x00c8, 0x385: 0x00c8, - 0x386: 0x00c8, 0x387: 0x00c8, 0x388: 0x00c8, 0x389: 0x00c8, 0x38a: 0x00c8, 0x38b: 0x00c8, - 0x38c: 0x00c8, 0x38d: 0x00c8, 0x38e: 0x00c8, 0x38f: 0x00c8, 0x390: 0x0088, 0x391: 0x0088, - 0x392: 0x0088, 0x393: 0x0088, 0x394: 0x0088, 0x395: 0x0088, 0x396: 0x0088, 0x397: 0x00c8, - 0x398: 0x00c8, 0x399: 0x00c8, 0x39a: 0x00c8, 0x39b: 0x00c8, 0x39c: 0x00c8, 0x39d: 0x00c8, - 0x39e: 0x00c8, 0x39f: 0x00c8, 0x3a0: 0x00c8, 0x3a1: 0x00c8, 0x3a2: 0x00c0, 0x3a3: 0x00c0, - 0x3a4: 0x00c0, 0x3a5: 0x00c0, 0x3a6: 0x00c0, 0x3a7: 0x00c0, 0x3a8: 0x00c0, 0x3a9: 0x00c0, - 0x3aa: 0x00c0, 0x3ab: 0x00c0, 0x3ac: 0x00c0, 0x3ad: 0x00c0, 0x3ae: 0x00c0, 0x3af: 0x00c0, - 0x3b0: 0x0088, 0x3b1: 0x0088, 0x3b2: 0x0088, 0x3b3: 0x00c8, 0x3b4: 0x0088, 0x3b5: 0x0088, - 0x3b6: 0x0088, 0x3b7: 0x00c8, 0x3b8: 0x00c8, 0x3b9: 0x0088, 0x3ba: 0x00c8, 0x3bb: 0x00c8, - 0x3bc: 0x00c8, 0x3bd: 0x00c8, 0x3be: 0x00c8, 0x3bf: 0x00c8, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x00c0, 0x3c1: 0x00c0, 0x3c2: 0x0080, 0x3c3: 0x00c3, 0x3c4: 0x00c3, 0x3c5: 0x00c3, - 0x3c6: 0x00c3, 0x3c7: 0x00c3, 0x3c8: 0x0083, 0x3c9: 0x0083, 0x3ca: 0x00c0, 0x3cb: 0x00c0, - 0x3cc: 0x00c0, 0x3cd: 0x00c0, 0x3ce: 0x00c0, 0x3cf: 0x00c0, 0x3d0: 0x00c0, 0x3d1: 0x00c0, - 0x3d2: 0x00c0, 0x3d3: 0x00c0, 0x3d4: 0x00c0, 0x3d5: 0x00c0, 0x3d6: 0x00c0, 0x3d7: 0x00c0, - 0x3d8: 0x00c0, 0x3d9: 0x00c0, 0x3da: 0x00c0, 0x3db: 0x00c0, 0x3dc: 0x00c0, 0x3dd: 0x00c0, - 0x3de: 0x00c0, 0x3df: 0x00c0, 0x3e0: 0x00c0, 0x3e1: 0x00c0, 0x3e2: 0x00c0, 0x3e3: 0x00c0, - 0x3e4: 0x00c0, 0x3e5: 0x00c0, 0x3e6: 0x00c0, 0x3e7: 0x00c0, 0x3e8: 0x00c0, 0x3e9: 0x00c0, - 0x3ea: 0x00c0, 0x3eb: 0x00c0, 0x3ec: 0x00c0, 0x3ed: 0x00c0, 0x3ee: 0x00c0, 0x3ef: 0x00c0, - 0x3f0: 0x00c0, 0x3f1: 0x00c0, 0x3f2: 0x00c0, 0x3f3: 0x00c0, 0x3f4: 0x00c0, 0x3f5: 0x00c0, - 0x3f6: 0x00c0, 0x3f7: 0x00c0, 0x3f8: 0x00c0, 0x3f9: 0x00c0, 0x3fa: 0x00c0, 0x3fb: 0x00c0, - 0x3fc: 0x00c0, 0x3fd: 0x00c0, 0x3fe: 0x00c0, 0x3ff: 0x00c0, - // Block 0x10, offset 0x400 - 0x400: 0x00c0, 0x401: 0x00c0, 0x402: 0x00c0, 0x403: 0x00c0, 0x404: 0x00c0, 0x405: 0x00c0, - 0x406: 0x00c0, 0x407: 0x00c0, 0x408: 0x00c0, 0x409: 0x00c0, 0x40a: 0x00c0, 0x40b: 0x00c0, - 0x40c: 0x00c0, 0x40d: 0x00c0, 0x40e: 0x00c0, 0x40f: 0x00c0, 0x410: 0x00c0, 0x411: 0x00c0, - 0x412: 0x00c0, 0x413: 0x00c0, 0x414: 0x00c0, 0x415: 0x00c0, 0x416: 0x00c0, 0x417: 0x00c0, - 0x418: 0x00c0, 0x419: 0x00c0, 0x41a: 0x00c0, 0x41b: 0x00c0, 0x41c: 0x00c0, 0x41d: 0x00c0, - 0x41e: 0x00c0, 0x41f: 0x00c0, 0x420: 0x00c0, 0x421: 0x00c0, 0x422: 0x00c0, 0x423: 0x00c0, - 0x424: 0x00c0, 0x425: 0x00c0, 0x426: 0x00c0, 0x427: 0x00c0, 0x428: 0x00c0, 0x429: 0x00c0, - 0x42a: 0x00c0, 0x42b: 0x00c0, 0x42c: 0x00c0, 0x42d: 0x00c0, 0x42e: 0x00c0, 0x42f: 0x00c0, - 0x431: 0x00c0, 0x432: 0x00c0, 0x433: 0x00c0, 0x434: 0x00c0, 0x435: 0x00c0, - 0x436: 0x00c0, 0x437: 0x00c0, 0x438: 0x00c0, 0x439: 0x00c0, 0x43a: 0x00c0, 0x43b: 0x00c0, - 0x43c: 0x00c0, 0x43d: 0x00c0, 0x43e: 0x00c0, 0x43f: 0x00c0, - // Block 0x11, offset 0x440 - 0x440: 0x00c0, 0x441: 0x00c0, 0x442: 0x00c0, 0x443: 0x00c0, 0x444: 0x00c0, 0x445: 0x00c0, - 0x446: 0x00c0, 0x447: 0x00c0, 0x448: 0x00c0, 0x449: 0x00c0, 0x44a: 0x00c0, 0x44b: 0x00c0, - 0x44c: 0x00c0, 0x44d: 0x00c0, 0x44e: 0x00c0, 0x44f: 0x00c0, 0x450: 0x00c0, 0x451: 0x00c0, - 0x452: 0x00c0, 0x453: 0x00c0, 0x454: 0x00c0, 0x455: 0x00c0, 0x456: 0x00c0, - 0x459: 0x00c0, 0x45a: 0x0080, 0x45b: 0x0080, 0x45c: 0x0080, 0x45d: 0x0080, - 0x45e: 0x0080, 0x45f: 0x0080, 0x461: 0x00c0, 0x462: 0x00c0, 0x463: 0x00c0, - 0x464: 0x00c0, 0x465: 0x00c0, 0x466: 0x00c0, 0x467: 0x00c0, 0x468: 0x00c0, 0x469: 0x00c0, - 0x46a: 0x00c0, 0x46b: 0x00c0, 0x46c: 0x00c0, 0x46d: 0x00c0, 0x46e: 0x00c0, 0x46f: 0x00c0, - 0x470: 0x00c0, 0x471: 0x00c0, 0x472: 0x00c0, 0x473: 0x00c0, 0x474: 0x00c0, 0x475: 0x00c0, - 0x476: 0x00c0, 0x477: 0x00c0, 0x478: 0x00c0, 0x479: 0x00c0, 0x47a: 0x00c0, 0x47b: 0x00c0, - 0x47c: 0x00c0, 0x47d: 0x00c0, 0x47e: 0x00c0, 0x47f: 0x00c0, - // Block 0x12, offset 0x480 - 0x480: 0x00c0, 0x481: 0x00c0, 0x482: 0x00c0, 0x483: 0x00c0, 0x484: 0x00c0, 0x485: 0x00c0, - 0x486: 0x00c0, 0x487: 0x0080, 0x489: 0x0080, 0x48a: 0x0080, - 0x48d: 0x0080, 0x48e: 0x0080, 0x48f: 0x0080, 0x491: 0x00cb, - 0x492: 0x00cb, 0x493: 0x00cb, 0x494: 0x00cb, 0x495: 0x00cb, 0x496: 0x00cb, 0x497: 0x00cb, - 0x498: 0x00cb, 0x499: 0x00cb, 0x49a: 0x00cb, 0x49b: 0x00cb, 0x49c: 0x00cb, 0x49d: 0x00cb, - 0x49e: 0x00cb, 0x49f: 0x00cb, 0x4a0: 0x00cb, 0x4a1: 0x00cb, 0x4a2: 0x00cb, 0x4a3: 0x00cb, - 0x4a4: 0x00cb, 0x4a5: 0x00cb, 0x4a6: 0x00cb, 0x4a7: 0x00cb, 0x4a8: 0x00cb, 0x4a9: 0x00cb, - 0x4aa: 0x00cb, 0x4ab: 0x00cb, 0x4ac: 0x00cb, 0x4ad: 0x00cb, 0x4ae: 0x00cb, 0x4af: 0x00cb, - 0x4b0: 0x00cb, 0x4b1: 0x00cb, 0x4b2: 0x00cb, 0x4b3: 0x00cb, 0x4b4: 0x00cb, 0x4b5: 0x00cb, - 0x4b6: 0x00cb, 0x4b7: 0x00cb, 0x4b8: 0x00cb, 0x4b9: 0x00cb, 0x4ba: 0x00cb, 0x4bb: 0x00cb, - 0x4bc: 0x00cb, 0x4bd: 0x00cb, 0x4be: 0x008a, 0x4bf: 0x00cb, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x008a, 0x4c1: 0x00cb, 0x4c2: 0x00cb, 0x4c3: 0x008a, 0x4c4: 0x00cb, 0x4c5: 0x00cb, - 0x4c6: 0x008a, 0x4c7: 0x00cb, - 0x4d0: 0x00ca, 0x4d1: 0x00ca, - 0x4d2: 0x00ca, 0x4d3: 0x00ca, 0x4d4: 0x00ca, 0x4d5: 0x00ca, 0x4d6: 0x00ca, 0x4d7: 0x00ca, - 0x4d8: 0x00ca, 0x4d9: 0x00ca, 0x4da: 0x00ca, 0x4db: 0x00ca, 0x4dc: 0x00ca, 0x4dd: 0x00ca, - 0x4de: 0x00ca, 0x4df: 0x00ca, 0x4e0: 0x00ca, 0x4e1: 0x00ca, 0x4e2: 0x00ca, 0x4e3: 0x00ca, - 0x4e4: 0x00ca, 0x4e5: 0x00ca, 0x4e6: 0x00ca, 0x4e7: 0x00ca, 0x4e8: 0x00ca, 0x4e9: 0x00ca, - 0x4ea: 0x00ca, - 0x4f0: 0x00ca, 0x4f1: 0x00ca, 0x4f2: 0x00ca, 0x4f3: 0x0051, 0x4f4: 0x0051, - // Block 0x14, offset 0x500 - 0x500: 0x0040, 0x501: 0x0040, 0x502: 0x0040, 0x503: 0x0040, 0x504: 0x0040, 0x505: 0x0040, - 0x506: 0x0080, 0x507: 0x0080, 0x508: 0x0080, 0x509: 0x0080, 0x50a: 0x0080, 0x50b: 0x0080, - 0x50c: 0x0080, 0x50d: 0x0080, 0x50e: 0x0080, 0x50f: 0x0080, 0x510: 0x00c3, 0x511: 0x00c3, - 0x512: 0x00c3, 0x513: 0x00c3, 0x514: 0x00c3, 0x515: 0x00c3, 0x516: 0x00c3, 0x517: 0x00c3, - 0x518: 0x00c3, 0x519: 0x00c3, 0x51a: 0x00c3, 0x51b: 0x0080, 0x51c: 0x0040, - 0x51e: 0x0080, 0x51f: 0x0080, 0x520: 0x00c2, 0x521: 0x00c0, 0x522: 0x00c4, 0x523: 0x00c4, - 0x524: 0x00c4, 0x525: 0x00c4, 0x526: 0x00c2, 0x527: 0x00c4, 0x528: 0x00c2, 0x529: 0x00c4, - 0x52a: 0x00c2, 0x52b: 0x00c2, 0x52c: 0x00c2, 0x52d: 0x00c2, 0x52e: 0x00c2, 0x52f: 0x00c4, - 0x530: 0x00c4, 0x531: 0x00c4, 0x532: 0x00c4, 0x533: 0x00c2, 0x534: 0x00c2, 0x535: 0x00c2, - 0x536: 0x00c2, 0x537: 0x00c2, 0x538: 0x00c2, 0x539: 0x00c2, 0x53a: 0x00c2, 0x53b: 0x00c2, - 0x53c: 0x00c2, 0x53d: 0x00c2, 0x53e: 0x00c2, 0x53f: 0x00c2, - // Block 0x15, offset 0x540 - 0x540: 0x0040, 0x541: 0x00c2, 0x542: 0x00c2, 0x543: 0x00c2, 0x544: 0x00c2, 0x545: 0x00c2, - 0x546: 0x00c2, 0x547: 0x00c2, 0x548: 0x00c4, 0x549: 0x00c2, 0x54a: 0x00c2, 0x54b: 0x00c3, - 0x54c: 0x00c3, 0x54d: 0x00c3, 0x54e: 0x00c3, 0x54f: 0x00c3, 0x550: 0x00c3, 0x551: 0x00c3, - 0x552: 0x00c3, 0x553: 0x00c3, 0x554: 0x00c3, 0x555: 0x00c3, 0x556: 0x00c3, 0x557: 0x00c3, - 0x558: 0x00c3, 0x559: 0x00c3, 0x55a: 0x00c3, 0x55b: 0x00c3, 0x55c: 0x00c3, 0x55d: 0x00c3, - 0x55e: 0x00c3, 0x55f: 0x00c3, 0x560: 0x0053, 0x561: 0x0053, 0x562: 0x0053, 0x563: 0x0053, - 0x564: 0x0053, 0x565: 0x0053, 0x566: 0x0053, 0x567: 0x0053, 0x568: 0x0053, 0x569: 0x0053, - 0x56a: 0x0080, 0x56b: 0x0080, 0x56c: 0x0080, 0x56d: 0x0080, 0x56e: 0x00c2, 0x56f: 0x00c2, - 0x570: 0x00c3, 0x571: 0x00c4, 0x572: 0x00c4, 0x573: 0x00c4, 0x574: 0x00c0, 0x575: 0x0084, - 0x576: 0x0084, 0x577: 0x0084, 0x578: 0x0082, 0x579: 0x00c2, 0x57a: 0x00c2, 0x57b: 0x00c2, - 0x57c: 0x00c2, 0x57d: 0x00c2, 0x57e: 0x00c2, 0x57f: 0x00c2, - // Block 0x16, offset 0x580 - 0x580: 0x00c2, 0x581: 0x00c2, 0x582: 0x00c2, 0x583: 0x00c2, 0x584: 0x00c2, 0x585: 0x00c2, - 0x586: 0x00c2, 0x587: 0x00c2, 0x588: 0x00c4, 0x589: 0x00c4, 0x58a: 0x00c4, 0x58b: 0x00c4, - 0x58c: 0x00c4, 0x58d: 0x00c4, 0x58e: 0x00c4, 0x58f: 0x00c4, 0x590: 0x00c4, 0x591: 0x00c4, - 0x592: 0x00c4, 0x593: 0x00c4, 0x594: 0x00c4, 0x595: 0x00c4, 0x596: 0x00c4, 0x597: 0x00c4, - 0x598: 0x00c4, 0x599: 0x00c4, 0x59a: 0x00c2, 0x59b: 0x00c2, 0x59c: 0x00c2, 0x59d: 0x00c2, - 0x59e: 0x00c2, 0x59f: 0x00c2, 0x5a0: 0x00c2, 0x5a1: 0x00c2, 0x5a2: 0x00c2, 0x5a3: 0x00c2, - 0x5a4: 0x00c2, 0x5a5: 0x00c2, 0x5a6: 0x00c2, 0x5a7: 0x00c2, 0x5a8: 0x00c2, 0x5a9: 0x00c2, - 0x5aa: 0x00c2, 0x5ab: 0x00c2, 0x5ac: 0x00c2, 0x5ad: 0x00c2, 0x5ae: 0x00c2, 0x5af: 0x00c2, - 0x5b0: 0x00c2, 0x5b1: 0x00c2, 0x5b2: 0x00c2, 0x5b3: 0x00c2, 0x5b4: 0x00c2, 0x5b5: 0x00c2, - 0x5b6: 0x00c2, 0x5b7: 0x00c2, 0x5b8: 0x00c2, 0x5b9: 0x00c2, 0x5ba: 0x00c2, 0x5bb: 0x00c2, - 0x5bc: 0x00c2, 0x5bd: 0x00c2, 0x5be: 0x00c2, 0x5bf: 0x00c2, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x00c4, 0x5c1: 0x00c2, 0x5c2: 0x00c2, 0x5c3: 0x00c4, 0x5c4: 0x00c4, 0x5c5: 0x00c4, - 0x5c6: 0x00c4, 0x5c7: 0x00c4, 0x5c8: 0x00c4, 0x5c9: 0x00c4, 0x5ca: 0x00c4, 0x5cb: 0x00c4, - 0x5cc: 0x00c2, 0x5cd: 0x00c4, 0x5ce: 0x00c2, 0x5cf: 0x00c4, 0x5d0: 0x00c2, 0x5d1: 0x00c2, - 0x5d2: 0x00c4, 0x5d3: 0x00c4, 0x5d4: 0x0080, 0x5d5: 0x00c4, 0x5d6: 0x00c3, 0x5d7: 0x00c3, - 0x5d8: 0x00c3, 0x5d9: 0x00c3, 0x5da: 0x00c3, 0x5db: 0x00c3, 0x5dc: 0x00c3, 0x5dd: 0x0040, - 0x5de: 0x0080, 0x5df: 0x00c3, 0x5e0: 0x00c3, 0x5e1: 0x00c3, 0x5e2: 0x00c3, 0x5e3: 0x00c3, - 0x5e4: 0x00c3, 0x5e5: 0x00c0, 0x5e6: 0x00c0, 0x5e7: 0x00c3, 0x5e8: 0x00c3, 0x5e9: 0x0080, - 0x5ea: 0x00c3, 0x5eb: 0x00c3, 0x5ec: 0x00c3, 0x5ed: 0x00c3, 0x5ee: 0x00c4, 0x5ef: 0x00c4, - 0x5f0: 0x0054, 0x5f1: 0x0054, 0x5f2: 0x0054, 0x5f3: 0x0054, 0x5f4: 0x0054, 0x5f5: 0x0054, - 0x5f6: 0x0054, 0x5f7: 0x0054, 0x5f8: 0x0054, 0x5f9: 0x0054, 0x5fa: 0x00c2, 0x5fb: 0x00c2, - 0x5fc: 0x00c2, 0x5fd: 0x00c0, 0x5fe: 0x00c0, 0x5ff: 0x00c2, - // Block 0x18, offset 0x600 - 0x600: 0x0080, 0x601: 0x0080, 0x602: 0x0080, 0x603: 0x0080, 0x604: 0x0080, 0x605: 0x0080, - 0x606: 0x0080, 0x607: 0x0080, 0x608: 0x0080, 0x609: 0x0080, 0x60a: 0x0080, 0x60b: 0x0080, - 0x60c: 0x0080, 0x60d: 0x0080, 0x60f: 0x0040, 0x610: 0x00c4, 0x611: 0x00c3, - 0x612: 0x00c2, 0x613: 0x00c2, 0x614: 0x00c2, 0x615: 0x00c4, 0x616: 0x00c4, 0x617: 0x00c4, - 0x618: 0x00c4, 0x619: 0x00c4, 0x61a: 0x00c2, 0x61b: 0x00c2, 0x61c: 0x00c2, 0x61d: 0x00c2, - 0x61e: 0x00c4, 0x61f: 0x00c2, 0x620: 0x00c2, 0x621: 0x00c2, 0x622: 0x00c2, 0x623: 0x00c2, - 0x624: 0x00c2, 0x625: 0x00c2, 0x626: 0x00c2, 0x627: 0x00c2, 0x628: 0x00c4, 0x629: 0x00c2, - 0x62a: 0x00c4, 0x62b: 0x00c2, 0x62c: 0x00c4, 0x62d: 0x00c2, 0x62e: 0x00c2, 0x62f: 0x00c4, - 0x630: 0x00c3, 0x631: 0x00c3, 0x632: 0x00c3, 0x633: 0x00c3, 0x634: 0x00c3, 0x635: 0x00c3, - 0x636: 0x00c3, 0x637: 0x00c3, 0x638: 0x00c3, 0x639: 0x00c3, 0x63a: 0x00c3, 0x63b: 0x00c3, - 0x63c: 0x00c3, 0x63d: 0x00c3, 0x63e: 0x00c3, 0x63f: 0x00c3, - // Block 0x19, offset 0x640 - 0x640: 0x00c3, 0x641: 0x00c3, 0x642: 0x00c3, 0x643: 0x00c3, 0x644: 0x00c3, 0x645: 0x00c3, - 0x646: 0x00c3, 0x647: 0x00c3, 0x648: 0x00c3, 0x649: 0x00c3, 0x64a: 0x00c3, - 0x64d: 0x00c4, 0x64e: 0x00c2, 0x64f: 0x00c2, 0x650: 0x00c2, 0x651: 0x00c2, - 0x652: 0x00c2, 0x653: 0x00c2, 0x654: 0x00c2, 0x655: 0x00c2, 0x656: 0x00c2, 0x657: 0x00c2, - 0x658: 0x00c2, 0x659: 0x00c4, 0x65a: 0x00c4, 0x65b: 0x00c4, 0x65c: 0x00c2, 0x65d: 0x00c2, - 0x65e: 0x00c2, 0x65f: 0x00c2, 0x660: 0x00c2, 0x661: 0x00c2, 0x662: 0x00c2, 0x663: 0x00c2, - 0x664: 0x00c2, 0x665: 0x00c2, 0x666: 0x00c2, 0x667: 0x00c2, 0x668: 0x00c2, 0x669: 0x00c2, - 0x66a: 0x00c2, 0x66b: 0x00c4, 0x66c: 0x00c4, 0x66d: 0x00c2, 0x66e: 0x00c2, 0x66f: 0x00c2, - 0x670: 0x00c2, 0x671: 0x00c4, 0x672: 0x00c2, 0x673: 0x00c4, 0x674: 0x00c4, 0x675: 0x00c2, - 0x676: 0x00c2, 0x677: 0x00c2, 0x678: 0x00c4, 0x679: 0x00c4, 0x67a: 0x00c2, 0x67b: 0x00c2, - 0x67c: 0x00c2, 0x67d: 0x00c2, 0x67e: 0x00c2, 0x67f: 0x00c2, - // Block 0x1a, offset 0x680 - 0x680: 0x00c0, 0x681: 0x00c0, 0x682: 0x00c0, 0x683: 0x00c0, 0x684: 0x00c0, 0x685: 0x00c0, - 0x686: 0x00c0, 0x687: 0x00c0, 0x688: 0x00c0, 0x689: 0x00c0, 0x68a: 0x00c0, 0x68b: 0x00c0, - 0x68c: 0x00c0, 0x68d: 0x00c0, 0x68e: 0x00c0, 0x68f: 0x00c0, 0x690: 0x00c0, 0x691: 0x00c0, - 0x692: 0x00c0, 0x693: 0x00c0, 0x694: 0x00c0, 0x695: 0x00c0, 0x696: 0x00c0, 0x697: 0x00c0, - 0x698: 0x00c0, 0x699: 0x00c0, 0x69a: 0x00c0, 0x69b: 0x00c0, 0x69c: 0x00c0, 0x69d: 0x00c0, - 0x69e: 0x00c0, 0x69f: 0x00c0, 0x6a0: 0x00c0, 0x6a1: 0x00c0, 0x6a2: 0x00c0, 0x6a3: 0x00c0, - 0x6a4: 0x00c0, 0x6a5: 0x00c0, 0x6a6: 0x00c3, 0x6a7: 0x00c3, 0x6a8: 0x00c3, 0x6a9: 0x00c3, - 0x6aa: 0x00c3, 0x6ab: 0x00c3, 0x6ac: 0x00c3, 0x6ad: 0x00c3, 0x6ae: 0x00c3, 0x6af: 0x00c3, - 0x6b0: 0x00c3, 0x6b1: 0x00c0, - // Block 0x1b, offset 0x6c0 - 0x6c0: 0x00c0, 0x6c1: 0x00c0, 0x6c2: 0x00c0, 0x6c3: 0x00c0, 0x6c4: 0x00c0, 0x6c5: 0x00c0, - 0x6c6: 0x00c0, 0x6c7: 0x00c0, 0x6c8: 0x00c0, 0x6c9: 0x00c0, 0x6ca: 0x00c2, 0x6cb: 0x00c2, - 0x6cc: 0x00c2, 0x6cd: 0x00c2, 0x6ce: 0x00c2, 0x6cf: 0x00c2, 0x6d0: 0x00c2, 0x6d1: 0x00c2, - 0x6d2: 0x00c2, 0x6d3: 0x00c2, 0x6d4: 0x00c2, 0x6d5: 0x00c2, 0x6d6: 0x00c2, 0x6d7: 0x00c2, - 0x6d8: 0x00c2, 0x6d9: 0x00c2, 0x6da: 0x00c2, 0x6db: 0x00c2, 0x6dc: 0x00c2, 0x6dd: 0x00c2, - 0x6de: 0x00c2, 0x6df: 0x00c2, 0x6e0: 0x00c2, 0x6e1: 0x00c2, 0x6e2: 0x00c2, 0x6e3: 0x00c2, - 0x6e4: 0x00c2, 0x6e5: 0x00c2, 0x6e6: 0x00c2, 0x6e7: 0x00c2, 0x6e8: 0x00c2, 0x6e9: 0x00c2, - 0x6ea: 0x00c2, 0x6eb: 0x00c3, 0x6ec: 0x00c3, 0x6ed: 0x00c3, 0x6ee: 0x00c3, 0x6ef: 0x00c3, - 0x6f0: 0x00c3, 0x6f1: 0x00c3, 0x6f2: 0x00c3, 0x6f3: 0x00c3, 0x6f4: 0x00c0, 0x6f5: 0x00c0, - 0x6f6: 0x0080, 0x6f7: 0x0080, 0x6f8: 0x0080, 0x6f9: 0x0080, 0x6fa: 0x0040, - // Block 0x1c, offset 0x700 - 0x700: 0x00c0, 0x701: 0x00c0, 0x702: 0x00c0, 0x703: 0x00c0, 0x704: 0x00c0, 0x705: 0x00c0, - 0x706: 0x00c0, 0x707: 0x00c0, 0x708: 0x00c0, 0x709: 0x00c0, 0x70a: 0x00c0, 0x70b: 0x00c0, - 0x70c: 0x00c0, 0x70d: 0x00c0, 0x70e: 0x00c0, 0x70f: 0x00c0, 0x710: 0x00c0, 0x711: 0x00c0, - 0x712: 0x00c0, 0x713: 0x00c0, 0x714: 0x00c0, 0x715: 0x00c0, 0x716: 0x00c3, 0x717: 0x00c3, - 0x718: 0x00c3, 0x719: 0x00c3, 0x71a: 0x00c0, 0x71b: 0x00c3, 0x71c: 0x00c3, 0x71d: 0x00c3, - 0x71e: 0x00c3, 0x71f: 0x00c3, 0x720: 0x00c3, 0x721: 0x00c3, 0x722: 0x00c3, 0x723: 0x00c3, - 0x724: 0x00c0, 0x725: 0x00c3, 0x726: 0x00c3, 0x727: 0x00c3, 0x728: 0x00c0, 0x729: 0x00c3, - 0x72a: 0x00c3, 0x72b: 0x00c3, 0x72c: 0x00c3, 0x72d: 0x00c3, - 0x730: 0x0080, 0x731: 0x0080, 0x732: 0x0080, 0x733: 0x0080, 0x734: 0x0080, 0x735: 0x0080, - 0x736: 0x0080, 0x737: 0x0080, 0x738: 0x0080, 0x739: 0x0080, 0x73a: 0x0080, 0x73b: 0x0080, - 0x73c: 0x0080, 0x73d: 0x0080, 0x73e: 0x0080, - // Block 0x1d, offset 0x740 - 0x740: 0x00c4, 0x741: 0x00c2, 0x742: 0x00c2, 0x743: 0x00c2, 0x744: 0x00c2, 0x745: 0x00c2, - 0x746: 0x00c4, 0x747: 0x00c4, 0x748: 0x00c2, 0x749: 0x00c4, 0x74a: 0x00c2, 0x74b: 0x00c2, - 0x74c: 0x00c2, 0x74d: 0x00c2, 0x74e: 0x00c2, 0x74f: 0x00c2, 0x750: 0x00c2, 0x751: 0x00c2, - 0x752: 0x00c2, 0x753: 0x00c2, 0x754: 0x00c4, 0x755: 0x00c2, 0x756: 0x00c0, 0x757: 0x00c0, - 0x758: 0x00c0, 0x759: 0x00c3, 0x75a: 0x00c3, 0x75b: 0x00c3, - 0x75e: 0x0080, - // Block 0x1e, offset 0x780 - 0x7a0: 0x00c2, 0x7a1: 0x00c2, 0x7a2: 0x00c2, 0x7a3: 0x00c2, - 0x7a4: 0x00c2, 0x7a5: 0x00c2, 0x7a6: 0x00c2, 0x7a7: 0x00c2, 0x7a8: 0x00c2, 0x7a9: 0x00c2, - 0x7aa: 0x00c4, 0x7ab: 0x00c4, 0x7ac: 0x00c4, 0x7ad: 0x00c0, 0x7ae: 0x00c4, 0x7af: 0x00c2, - 0x7b0: 0x00c2, 0x7b1: 0x00c4, 0x7b2: 0x00c4, 0x7b3: 0x00c2, 0x7b4: 0x00c2, - 0x7b6: 0x00c2, 0x7b7: 0x00c2, 0x7b8: 0x00c2, 0x7b9: 0x00c4, 0x7ba: 0x00c2, 0x7bb: 0x00c2, - 0x7bc: 0x00c2, 0x7bd: 0x00c2, - // Block 0x1f, offset 0x7c0 - 0x7d4: 0x00c3, 0x7d5: 0x00c3, 0x7d6: 0x00c3, 0x7d7: 0x00c3, - 0x7d8: 0x00c3, 0x7d9: 0x00c3, 0x7da: 0x00c3, 0x7db: 0x00c3, 0x7dc: 0x00c3, 0x7dd: 0x00c3, - 0x7de: 0x00c3, 0x7df: 0x00c3, 0x7e0: 0x00c3, 0x7e1: 0x00c3, 0x7e2: 0x0040, 0x7e3: 0x00c3, - 0x7e4: 0x00c3, 0x7e5: 0x00c3, 0x7e6: 0x00c3, 0x7e7: 0x00c3, 0x7e8: 0x00c3, 0x7e9: 0x00c3, - 0x7ea: 0x00c3, 0x7eb: 0x00c3, 0x7ec: 0x00c3, 0x7ed: 0x00c3, 0x7ee: 0x00c3, 0x7ef: 0x00c3, - 0x7f0: 0x00c3, 0x7f1: 0x00c3, 0x7f2: 0x00c3, 0x7f3: 0x00c3, 0x7f4: 0x00c3, 0x7f5: 0x00c3, - 0x7f6: 0x00c3, 0x7f7: 0x00c3, 0x7f8: 0x00c3, 0x7f9: 0x00c3, 0x7fa: 0x00c3, 0x7fb: 0x00c3, - 0x7fc: 0x00c3, 0x7fd: 0x00c3, 0x7fe: 0x00c3, 0x7ff: 0x00c3, - // Block 0x20, offset 0x800 - 0x800: 0x00c3, 0x801: 0x00c3, 0x802: 0x00c3, 0x803: 0x00c0, 0x804: 0x00c0, 0x805: 0x00c0, - 0x806: 0x00c0, 0x807: 0x00c0, 0x808: 0x00c0, 0x809: 0x00c0, 0x80a: 0x00c0, 0x80b: 0x00c0, - 0x80c: 0x00c0, 0x80d: 0x00c0, 0x80e: 0x00c0, 0x80f: 0x00c0, 0x810: 0x00c0, 0x811: 0x00c0, - 0x812: 0x00c0, 0x813: 0x00c0, 0x814: 0x00c0, 0x815: 0x00c0, 0x816: 0x00c0, 0x817: 0x00c0, - 0x818: 0x00c0, 0x819: 0x00c0, 0x81a: 0x00c0, 0x81b: 0x00c0, 0x81c: 0x00c0, 0x81d: 0x00c0, - 0x81e: 0x00c0, 0x81f: 0x00c0, 0x820: 0x00c0, 0x821: 0x00c0, 0x822: 0x00c0, 0x823: 0x00c0, - 0x824: 0x00c0, 0x825: 0x00c0, 0x826: 0x00c0, 0x827: 0x00c0, 0x828: 0x00c0, 0x829: 0x00c0, - 0x82a: 0x00c0, 0x82b: 0x00c0, 0x82c: 0x00c0, 0x82d: 0x00c0, 0x82e: 0x00c0, 0x82f: 0x00c0, - 0x830: 0x00c0, 0x831: 0x00c0, 0x832: 0x00c0, 0x833: 0x00c0, 0x834: 0x00c0, 0x835: 0x00c0, - 0x836: 0x00c0, 0x837: 0x00c0, 0x838: 0x00c0, 0x839: 0x00c0, 0x83a: 0x00c3, 0x83b: 0x00c0, - 0x83c: 0x00c3, 0x83d: 0x00c0, 0x83e: 0x00c0, 0x83f: 0x00c0, - // Block 0x21, offset 0x840 - 0x840: 0x00c0, 0x841: 0x00c3, 0x842: 0x00c3, 0x843: 0x00c3, 0x844: 0x00c3, 0x845: 0x00c3, - 0x846: 0x00c3, 0x847: 0x00c3, 0x848: 0x00c3, 0x849: 0x00c0, 0x84a: 0x00c0, 0x84b: 0x00c0, - 0x84c: 0x00c0, 0x84d: 0x00c6, 0x84e: 0x00c0, 0x84f: 0x00c0, 0x850: 0x00c0, 0x851: 0x00c3, - 0x852: 0x00c3, 0x853: 0x00c3, 0x854: 0x00c3, 0x855: 0x00c3, 0x856: 0x00c3, 0x857: 0x00c3, - 0x858: 0x0080, 0x859: 0x0080, 0x85a: 0x0080, 0x85b: 0x0080, 0x85c: 0x0080, 0x85d: 0x0080, - 0x85e: 0x0080, 0x85f: 0x0080, 0x860: 0x00c0, 0x861: 0x00c0, 0x862: 0x00c3, 0x863: 0x00c3, - 0x864: 0x0080, 0x865: 0x0080, 0x866: 0x00c0, 0x867: 0x00c0, 0x868: 0x00c0, 0x869: 0x00c0, - 0x86a: 0x00c0, 0x86b: 0x00c0, 0x86c: 0x00c0, 0x86d: 0x00c0, 0x86e: 0x00c0, 0x86f: 0x00c0, - 0x870: 0x0080, 0x871: 0x00c0, 0x872: 0x00c0, 0x873: 0x00c0, 0x874: 0x00c0, 0x875: 0x00c0, - 0x876: 0x00c0, 0x877: 0x00c0, 0x878: 0x00c0, 0x879: 0x00c0, 0x87a: 0x00c0, 0x87b: 0x00c0, - 0x87c: 0x00c0, 0x87d: 0x00c0, 0x87e: 0x00c0, 0x87f: 0x00c0, - // Block 0x22, offset 0x880 - 0x880: 0x00c0, 0x881: 0x00c3, 0x882: 0x00c0, 0x883: 0x00c0, 0x885: 0x00c0, - 0x886: 0x00c0, 0x887: 0x00c0, 0x888: 0x00c0, 0x889: 0x00c0, 0x88a: 0x00c0, 0x88b: 0x00c0, - 0x88c: 0x00c0, 0x88f: 0x00c0, 0x890: 0x00c0, - 0x893: 0x00c0, 0x894: 0x00c0, 0x895: 0x00c0, 0x896: 0x00c0, 0x897: 0x00c0, - 0x898: 0x00c0, 0x899: 0x00c0, 0x89a: 0x00c0, 0x89b: 0x00c0, 0x89c: 0x00c0, 0x89d: 0x00c0, - 0x89e: 0x00c0, 0x89f: 0x00c0, 0x8a0: 0x00c0, 0x8a1: 0x00c0, 0x8a2: 0x00c0, 0x8a3: 0x00c0, - 0x8a4: 0x00c0, 0x8a5: 0x00c0, 0x8a6: 0x00c0, 0x8a7: 0x00c0, 0x8a8: 0x00c0, - 0x8aa: 0x00c0, 0x8ab: 0x00c0, 0x8ac: 0x00c0, 0x8ad: 0x00c0, 0x8ae: 0x00c0, 0x8af: 0x00c0, - 0x8b0: 0x00c0, 0x8b2: 0x00c0, - 0x8b6: 0x00c0, 0x8b7: 0x00c0, 0x8b8: 0x00c0, 0x8b9: 0x00c0, - 0x8bc: 0x00c3, 0x8bd: 0x00c0, 0x8be: 0x00c0, 0x8bf: 0x00c0, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x00c0, 0x8c1: 0x00c3, 0x8c2: 0x00c3, 0x8c3: 0x00c3, 0x8c4: 0x00c3, - 0x8c7: 0x00c0, 0x8c8: 0x00c0, 0x8cb: 0x00c0, - 0x8cc: 0x00c0, 0x8cd: 0x00c6, 0x8ce: 0x00c0, - 0x8d7: 0x00c0, - 0x8dc: 0x0080, 0x8dd: 0x0080, - 0x8df: 0x0080, 0x8e0: 0x00c0, 0x8e1: 0x00c0, 0x8e2: 0x00c3, 0x8e3: 0x00c3, - 0x8e6: 0x00c0, 0x8e7: 0x00c0, 0x8e8: 0x00c0, 0x8e9: 0x00c0, - 0x8ea: 0x00c0, 0x8eb: 0x00c0, 0x8ec: 0x00c0, 0x8ed: 0x00c0, 0x8ee: 0x00c0, 0x8ef: 0x00c0, - 0x8f0: 0x00c0, 0x8f1: 0x00c0, 0x8f2: 0x0080, 0x8f3: 0x0080, 0x8f4: 0x0080, 0x8f5: 0x0080, - 0x8f6: 0x0080, 0x8f7: 0x0080, 0x8f8: 0x0080, 0x8f9: 0x0080, 0x8fa: 0x0080, 0x8fb: 0x0080, - // Block 0x24, offset 0x900 - 0x901: 0x00c3, 0x902: 0x00c3, 0x903: 0x00c0, 0x905: 0x00c0, - 0x906: 0x00c0, 0x907: 0x00c0, 0x908: 0x00c0, 0x909: 0x00c0, 0x90a: 0x00c0, - 0x90f: 0x00c0, 0x910: 0x00c0, - 0x913: 0x00c0, 0x914: 0x00c0, 0x915: 0x00c0, 0x916: 0x00c0, 0x917: 0x00c0, - 0x918: 0x00c0, 0x919: 0x00c0, 0x91a: 0x00c0, 0x91b: 0x00c0, 0x91c: 0x00c0, 0x91d: 0x00c0, - 0x91e: 0x00c0, 0x91f: 0x00c0, 0x920: 0x00c0, 0x921: 0x00c0, 0x922: 0x00c0, 0x923: 0x00c0, - 0x924: 0x00c0, 0x925: 0x00c0, 0x926: 0x00c0, 0x927: 0x00c0, 0x928: 0x00c0, - 0x92a: 0x00c0, 0x92b: 0x00c0, 0x92c: 0x00c0, 0x92d: 0x00c0, 0x92e: 0x00c0, 0x92f: 0x00c0, - 0x930: 0x00c0, 0x932: 0x00c0, 0x933: 0x0080, 0x935: 0x00c0, - 0x936: 0x0080, 0x938: 0x00c0, 0x939: 0x00c0, - 0x93c: 0x00c3, 0x93e: 0x00c0, 0x93f: 0x00c0, - // Block 0x25, offset 0x940 - 0x940: 0x00c0, 0x941: 0x00c3, 0x942: 0x00c3, - 0x947: 0x00c3, 0x948: 0x00c3, 0x94b: 0x00c3, - 0x94c: 0x00c3, 0x94d: 0x00c6, 0x951: 0x00c3, - 0x959: 0x0080, 0x95a: 0x0080, 0x95b: 0x0080, 0x95c: 0x00c0, - 0x95e: 0x0080, - 0x966: 0x00c0, 0x967: 0x00c0, 0x968: 0x00c0, 0x969: 0x00c0, - 0x96a: 0x00c0, 0x96b: 0x00c0, 0x96c: 0x00c0, 0x96d: 0x00c0, 0x96e: 0x00c0, 0x96f: 0x00c0, - 0x970: 0x00c3, 0x971: 0x00c3, 0x972: 0x00c0, 0x973: 0x00c0, 0x974: 0x00c0, 0x975: 0x00c3, - // Block 0x26, offset 0x980 - 0x981: 0x00c3, 0x982: 0x00c3, 0x983: 0x00c0, 0x985: 0x00c0, - 0x986: 0x00c0, 0x987: 0x00c0, 0x988: 0x00c0, 0x989: 0x00c0, 0x98a: 0x00c0, 0x98b: 0x00c0, - 0x98c: 0x00c0, 0x98d: 0x00c0, 0x98f: 0x00c0, 0x990: 0x00c0, 0x991: 0x00c0, - 0x993: 0x00c0, 0x994: 0x00c0, 0x995: 0x00c0, 0x996: 0x00c0, 0x997: 0x00c0, - 0x998: 0x00c0, 0x999: 0x00c0, 0x99a: 0x00c0, 0x99b: 0x00c0, 0x99c: 0x00c0, 0x99d: 0x00c0, - 0x99e: 0x00c0, 0x99f: 0x00c0, 0x9a0: 0x00c0, 0x9a1: 0x00c0, 0x9a2: 0x00c0, 0x9a3: 0x00c0, - 0x9a4: 0x00c0, 0x9a5: 0x00c0, 0x9a6: 0x00c0, 0x9a7: 0x00c0, 0x9a8: 0x00c0, - 0x9aa: 0x00c0, 0x9ab: 0x00c0, 0x9ac: 0x00c0, 0x9ad: 0x00c0, 0x9ae: 0x00c0, 0x9af: 0x00c0, - 0x9b0: 0x00c0, 0x9b2: 0x00c0, 0x9b3: 0x00c0, 0x9b5: 0x00c0, - 0x9b6: 0x00c0, 0x9b7: 0x00c0, 0x9b8: 0x00c0, 0x9b9: 0x00c0, - 0x9bc: 0x00c3, 0x9bd: 0x00c0, 0x9be: 0x00c0, 0x9bf: 0x00c0, - // Block 0x27, offset 0x9c0 - 0x9c0: 0x00c0, 0x9c1: 0x00c3, 0x9c2: 0x00c3, 0x9c3: 0x00c3, 0x9c4: 0x00c3, 0x9c5: 0x00c3, - 0x9c7: 0x00c3, 0x9c8: 0x00c3, 0x9c9: 0x00c0, 0x9cb: 0x00c0, - 0x9cc: 0x00c0, 0x9cd: 0x00c6, 0x9d0: 0x00c0, - 0x9e0: 0x00c0, 0x9e1: 0x00c0, 0x9e2: 0x00c3, 0x9e3: 0x00c3, - 0x9e6: 0x00c0, 0x9e7: 0x00c0, 0x9e8: 0x00c0, 0x9e9: 0x00c0, - 0x9ea: 0x00c0, 0x9eb: 0x00c0, 0x9ec: 0x00c0, 0x9ed: 0x00c0, 0x9ee: 0x00c0, 0x9ef: 0x00c0, - 0x9f0: 0x0080, 0x9f1: 0x0080, - 0x9f9: 0x00c0, - // Block 0x28, offset 0xa00 - 0xa01: 0x00c3, 0xa02: 0x00c0, 0xa03: 0x00c0, 0xa05: 0x00c0, - 0xa06: 0x00c0, 0xa07: 0x00c0, 0xa08: 0x00c0, 0xa09: 0x00c0, 0xa0a: 0x00c0, 0xa0b: 0x00c0, - 0xa0c: 0x00c0, 0xa0f: 0x00c0, 0xa10: 0x00c0, - 0xa13: 0x00c0, 0xa14: 0x00c0, 0xa15: 0x00c0, 0xa16: 0x00c0, 0xa17: 0x00c0, - 0xa18: 0x00c0, 0xa19: 0x00c0, 0xa1a: 0x00c0, 0xa1b: 0x00c0, 0xa1c: 0x00c0, 0xa1d: 0x00c0, - 0xa1e: 0x00c0, 0xa1f: 0x00c0, 0xa20: 0x00c0, 0xa21: 0x00c0, 0xa22: 0x00c0, 0xa23: 0x00c0, - 0xa24: 0x00c0, 0xa25: 0x00c0, 0xa26: 0x00c0, 0xa27: 0x00c0, 0xa28: 0x00c0, - 0xa2a: 0x00c0, 0xa2b: 0x00c0, 0xa2c: 0x00c0, 0xa2d: 0x00c0, 0xa2e: 0x00c0, 0xa2f: 0x00c0, - 0xa30: 0x00c0, 0xa32: 0x00c0, 0xa33: 0x00c0, 0xa35: 0x00c0, - 0xa36: 0x00c0, 0xa37: 0x00c0, 0xa38: 0x00c0, 0xa39: 0x00c0, - 0xa3c: 0x00c3, 0xa3d: 0x00c0, 0xa3e: 0x00c0, 0xa3f: 0x00c3, - // Block 0x29, offset 0xa40 - 0xa40: 0x00c0, 0xa41: 0x00c3, 0xa42: 0x00c3, 0xa43: 0x00c3, 0xa44: 0x00c3, - 0xa47: 0x00c0, 0xa48: 0x00c0, 0xa4b: 0x00c0, - 0xa4c: 0x00c0, 0xa4d: 0x00c6, - 0xa56: 0x00c3, 0xa57: 0x00c0, - 0xa5c: 0x0080, 0xa5d: 0x0080, - 0xa5f: 0x00c0, 0xa60: 0x00c0, 0xa61: 0x00c0, 0xa62: 0x00c3, 0xa63: 0x00c3, - 0xa66: 0x00c0, 0xa67: 0x00c0, 0xa68: 0x00c0, 0xa69: 0x00c0, - 0xa6a: 0x00c0, 0xa6b: 0x00c0, 0xa6c: 0x00c0, 0xa6d: 0x00c0, 0xa6e: 0x00c0, 0xa6f: 0x00c0, - 0xa70: 0x0080, 0xa71: 0x00c0, 0xa72: 0x0080, 0xa73: 0x0080, 0xa74: 0x0080, 0xa75: 0x0080, - 0xa76: 0x0080, 0xa77: 0x0080, - // Block 0x2a, offset 0xa80 - 0xa82: 0x00c3, 0xa83: 0x00c0, 0xa85: 0x00c0, - 0xa86: 0x00c0, 0xa87: 0x00c0, 0xa88: 0x00c0, 0xa89: 0x00c0, 0xa8a: 0x00c0, - 0xa8e: 0x00c0, 0xa8f: 0x00c0, 0xa90: 0x00c0, - 0xa92: 0x00c0, 0xa93: 0x00c0, 0xa94: 0x00c0, 0xa95: 0x00c0, - 0xa99: 0x00c0, 0xa9a: 0x00c0, 0xa9c: 0x00c0, - 0xa9e: 0x00c0, 0xa9f: 0x00c0, 0xaa3: 0x00c0, - 0xaa4: 0x00c0, 0xaa8: 0x00c0, 0xaa9: 0x00c0, - 0xaaa: 0x00c0, 0xaae: 0x00c0, 0xaaf: 0x00c0, - 0xab0: 0x00c0, 0xab1: 0x00c0, 0xab2: 0x00c0, 0xab3: 0x00c0, 0xab4: 0x00c0, 0xab5: 0x00c0, - 0xab6: 0x00c0, 0xab7: 0x00c0, 0xab8: 0x00c0, 0xab9: 0x00c0, - 0xabe: 0x00c0, 0xabf: 0x00c0, - // Block 0x2b, offset 0xac0 - 0xac0: 0x00c3, 0xac1: 0x00c0, 0xac2: 0x00c0, - 0xac6: 0x00c0, 0xac7: 0x00c0, 0xac8: 0x00c0, 0xaca: 0x00c0, 0xacb: 0x00c0, - 0xacc: 0x00c0, 0xacd: 0x00c6, 0xad0: 0x00c0, - 0xad7: 0x00c0, - 0xae6: 0x00c0, 0xae7: 0x00c0, 0xae8: 0x00c0, 0xae9: 0x00c0, - 0xaea: 0x00c0, 0xaeb: 0x00c0, 0xaec: 0x00c0, 0xaed: 0x00c0, 0xaee: 0x00c0, 0xaef: 0x00c0, - 0xaf0: 0x0080, 0xaf1: 0x0080, 0xaf2: 0x0080, 0xaf3: 0x0080, 0xaf4: 0x0080, 0xaf5: 0x0080, - 0xaf6: 0x0080, 0xaf7: 0x0080, 0xaf8: 0x0080, 0xaf9: 0x0080, 0xafa: 0x0080, - // Block 0x2c, offset 0xb00 - 0xb00: 0x00c3, 0xb01: 0x00c0, 0xb02: 0x00c0, 0xb03: 0x00c0, 0xb05: 0x00c0, - 0xb06: 0x00c0, 0xb07: 0x00c0, 0xb08: 0x00c0, 0xb09: 0x00c0, 0xb0a: 0x00c0, 0xb0b: 0x00c0, - 0xb0c: 0x00c0, 0xb0e: 0x00c0, 0xb0f: 0x00c0, 0xb10: 0x00c0, - 0xb12: 0x00c0, 0xb13: 0x00c0, 0xb14: 0x00c0, 0xb15: 0x00c0, 0xb16: 0x00c0, 0xb17: 0x00c0, - 0xb18: 0x00c0, 0xb19: 0x00c0, 0xb1a: 0x00c0, 0xb1b: 0x00c0, 0xb1c: 0x00c0, 0xb1d: 0x00c0, - 0xb1e: 0x00c0, 0xb1f: 0x00c0, 0xb20: 0x00c0, 0xb21: 0x00c0, 0xb22: 0x00c0, 0xb23: 0x00c0, - 0xb24: 0x00c0, 0xb25: 0x00c0, 0xb26: 0x00c0, 0xb27: 0x00c0, 0xb28: 0x00c0, - 0xb2a: 0x00c0, 0xb2b: 0x00c0, 0xb2c: 0x00c0, 0xb2d: 0x00c0, 0xb2e: 0x00c0, 0xb2f: 0x00c0, - 0xb30: 0x00c0, 0xb31: 0x00c0, 0xb32: 0x00c0, 0xb33: 0x00c0, 0xb34: 0x00c0, 0xb35: 0x00c0, - 0xb36: 0x00c0, 0xb37: 0x00c0, 0xb38: 0x00c0, 0xb39: 0x00c0, - 0xb3d: 0x00c0, 0xb3e: 0x00c3, 0xb3f: 0x00c3, - // Block 0x2d, offset 0xb40 - 0xb40: 0x00c3, 0xb41: 0x00c0, 0xb42: 0x00c0, 0xb43: 0x00c0, 0xb44: 0x00c0, - 0xb46: 0x00c3, 0xb47: 0x00c3, 0xb48: 0x00c3, 0xb4a: 0x00c3, 0xb4b: 0x00c3, - 0xb4c: 0x00c3, 0xb4d: 0x00c6, - 0xb55: 0x00c3, 0xb56: 0x00c3, - 0xb58: 0x00c0, 0xb59: 0x00c0, 0xb5a: 0x00c0, - 0xb60: 0x00c0, 0xb61: 0x00c0, 0xb62: 0x00c3, 0xb63: 0x00c3, - 0xb66: 0x00c0, 0xb67: 0x00c0, 0xb68: 0x00c0, 0xb69: 0x00c0, - 0xb6a: 0x00c0, 0xb6b: 0x00c0, 0xb6c: 0x00c0, 0xb6d: 0x00c0, 0xb6e: 0x00c0, 0xb6f: 0x00c0, - 0xb78: 0x0080, 0xb79: 0x0080, 0xb7a: 0x0080, 0xb7b: 0x0080, - 0xb7c: 0x0080, 0xb7d: 0x0080, 0xb7e: 0x0080, 0xb7f: 0x0080, - // Block 0x2e, offset 0xb80 - 0xb80: 0x00c0, 0xb81: 0x00c3, 0xb82: 0x00c0, 0xb83: 0x00c0, 0xb85: 0x00c0, - 0xb86: 0x00c0, 0xb87: 0x00c0, 0xb88: 0x00c0, 0xb89: 0x00c0, 0xb8a: 0x00c0, 0xb8b: 0x00c0, - 0xb8c: 0x00c0, 0xb8e: 0x00c0, 0xb8f: 0x00c0, 0xb90: 0x00c0, - 0xb92: 0x00c0, 0xb93: 0x00c0, 0xb94: 0x00c0, 0xb95: 0x00c0, 0xb96: 0x00c0, 0xb97: 0x00c0, - 0xb98: 0x00c0, 0xb99: 0x00c0, 0xb9a: 0x00c0, 0xb9b: 0x00c0, 0xb9c: 0x00c0, 0xb9d: 0x00c0, - 0xb9e: 0x00c0, 0xb9f: 0x00c0, 0xba0: 0x00c0, 0xba1: 0x00c0, 0xba2: 0x00c0, 0xba3: 0x00c0, - 0xba4: 0x00c0, 0xba5: 0x00c0, 0xba6: 0x00c0, 0xba7: 0x00c0, 0xba8: 0x00c0, - 0xbaa: 0x00c0, 0xbab: 0x00c0, 0xbac: 0x00c0, 0xbad: 0x00c0, 0xbae: 0x00c0, 0xbaf: 0x00c0, - 0xbb0: 0x00c0, 0xbb1: 0x00c0, 0xbb2: 0x00c0, 0xbb3: 0x00c0, 0xbb5: 0x00c0, - 0xbb6: 0x00c0, 0xbb7: 0x00c0, 0xbb8: 0x00c0, 0xbb9: 0x00c0, - 0xbbc: 0x00c3, 0xbbd: 0x00c0, 0xbbe: 0x00c0, 0xbbf: 0x00c3, - // Block 0x2f, offset 0xbc0 - 0xbc0: 0x00c0, 0xbc1: 0x00c0, 0xbc2: 0x00c0, 0xbc3: 0x00c0, 0xbc4: 0x00c0, - 0xbc6: 0x00c3, 0xbc7: 0x00c0, 0xbc8: 0x00c0, 0xbca: 0x00c0, 0xbcb: 0x00c0, - 0xbcc: 0x00c3, 0xbcd: 0x00c6, - 0xbd5: 0x00c0, 0xbd6: 0x00c0, - 0xbde: 0x00c0, 0xbe0: 0x00c0, 0xbe1: 0x00c0, 0xbe2: 0x00c3, 0xbe3: 0x00c3, - 0xbe6: 0x00c0, 0xbe7: 0x00c0, 0xbe8: 0x00c0, 0xbe9: 0x00c0, - 0xbea: 0x00c0, 0xbeb: 0x00c0, 0xbec: 0x00c0, 0xbed: 0x00c0, 0xbee: 0x00c0, 0xbef: 0x00c0, - 0xbf1: 0x00c0, 0xbf2: 0x00c0, - // Block 0x30, offset 0xc00 - 0xc01: 0x00c3, 0xc02: 0x00c0, 0xc03: 0x00c0, 0xc05: 0x00c0, - 0xc06: 0x00c0, 0xc07: 0x00c0, 0xc08: 0x00c0, 0xc09: 0x00c0, 0xc0a: 0x00c0, 0xc0b: 0x00c0, - 0xc0c: 0x00c0, 0xc0e: 0x00c0, 0xc0f: 0x00c0, 0xc10: 0x00c0, - 0xc12: 0x00c0, 0xc13: 0x00c0, 0xc14: 0x00c0, 0xc15: 0x00c0, 0xc16: 0x00c0, 0xc17: 0x00c0, - 0xc18: 0x00c0, 0xc19: 0x00c0, 0xc1a: 0x00c0, 0xc1b: 0x00c0, 0xc1c: 0x00c0, 0xc1d: 0x00c0, - 0xc1e: 0x00c0, 0xc1f: 0x00c0, 0xc20: 0x00c0, 0xc21: 0x00c0, 0xc22: 0x00c0, 0xc23: 0x00c0, - 0xc24: 0x00c0, 0xc25: 0x00c0, 0xc26: 0x00c0, 0xc27: 0x00c0, 0xc28: 0x00c0, 0xc29: 0x00c0, - 0xc2a: 0x00c0, 0xc2b: 0x00c0, 0xc2c: 0x00c0, 0xc2d: 0x00c0, 0xc2e: 0x00c0, 0xc2f: 0x00c0, - 0xc30: 0x00c0, 0xc31: 0x00c0, 0xc32: 0x00c0, 0xc33: 0x00c0, 0xc34: 0x00c0, 0xc35: 0x00c0, - 0xc36: 0x00c0, 0xc37: 0x00c0, 0xc38: 0x00c0, 0xc39: 0x00c0, 0xc3a: 0x00c0, - 0xc3d: 0x00c0, 0xc3e: 0x00c0, 0xc3f: 0x00c0, - // Block 0x31, offset 0xc40 - 0xc40: 0x00c0, 0xc41: 0x00c3, 0xc42: 0x00c3, 0xc43: 0x00c3, 0xc44: 0x00c3, - 0xc46: 0x00c0, 0xc47: 0x00c0, 0xc48: 0x00c0, 0xc4a: 0x00c0, 0xc4b: 0x00c0, - 0xc4c: 0x00c0, 0xc4d: 0x00c6, 0xc4e: 0x00c0, 0xc4f: 0x0080, - 0xc54: 0x00c0, 0xc55: 0x00c0, 0xc56: 0x00c0, 0xc57: 0x00c0, - 0xc58: 0x0080, 0xc59: 0x0080, 0xc5a: 0x0080, 0xc5b: 0x0080, 0xc5c: 0x0080, 0xc5d: 0x0080, - 0xc5e: 0x0080, 0xc5f: 0x00c0, 0xc60: 0x00c0, 0xc61: 0x00c0, 0xc62: 0x00c3, 0xc63: 0x00c3, - 0xc66: 0x00c0, 0xc67: 0x00c0, 0xc68: 0x00c0, 0xc69: 0x00c0, - 0xc6a: 0x00c0, 0xc6b: 0x00c0, 0xc6c: 0x00c0, 0xc6d: 0x00c0, 0xc6e: 0x00c0, 0xc6f: 0x00c0, - 0xc70: 0x0080, 0xc71: 0x0080, 0xc72: 0x0080, 0xc73: 0x0080, 0xc74: 0x0080, 0xc75: 0x0080, - 0xc76: 0x0080, 0xc77: 0x0080, 0xc78: 0x0080, 0xc79: 0x0080, 0xc7a: 0x00c0, 0xc7b: 0x00c0, - 0xc7c: 0x00c0, 0xc7d: 0x00c0, 0xc7e: 0x00c0, 0xc7f: 0x00c0, - // Block 0x32, offset 0xc80 - 0xc82: 0x00c0, 0xc83: 0x00c0, 0xc85: 0x00c0, - 0xc86: 0x00c0, 0xc87: 0x00c0, 0xc88: 0x00c0, 0xc89: 0x00c0, 0xc8a: 0x00c0, 0xc8b: 0x00c0, - 0xc8c: 0x00c0, 0xc8d: 0x00c0, 0xc8e: 0x00c0, 0xc8f: 0x00c0, 0xc90: 0x00c0, 0xc91: 0x00c0, - 0xc92: 0x00c0, 0xc93: 0x00c0, 0xc94: 0x00c0, 0xc95: 0x00c0, 0xc96: 0x00c0, - 0xc9a: 0x00c0, 0xc9b: 0x00c0, 0xc9c: 0x00c0, 0xc9d: 0x00c0, - 0xc9e: 0x00c0, 0xc9f: 0x00c0, 0xca0: 0x00c0, 0xca1: 0x00c0, 0xca2: 0x00c0, 0xca3: 0x00c0, - 0xca4: 0x00c0, 0xca5: 0x00c0, 0xca6: 0x00c0, 0xca7: 0x00c0, 0xca8: 0x00c0, 0xca9: 0x00c0, - 0xcaa: 0x00c0, 0xcab: 0x00c0, 0xcac: 0x00c0, 0xcad: 0x00c0, 0xcae: 0x00c0, 0xcaf: 0x00c0, - 0xcb0: 0x00c0, 0xcb1: 0x00c0, 0xcb3: 0x00c0, 0xcb4: 0x00c0, 0xcb5: 0x00c0, - 0xcb6: 0x00c0, 0xcb7: 0x00c0, 0xcb8: 0x00c0, 0xcb9: 0x00c0, 0xcba: 0x00c0, 0xcbb: 0x00c0, - 0xcbd: 0x00c0, - // Block 0x33, offset 0xcc0 - 0xcc0: 0x00c0, 0xcc1: 0x00c0, 0xcc2: 0x00c0, 0xcc3: 0x00c0, 0xcc4: 0x00c0, 0xcc5: 0x00c0, - 0xcc6: 0x00c0, 0xcca: 0x00c6, - 0xccf: 0x00c0, 0xcd0: 0x00c0, 0xcd1: 0x00c0, - 0xcd2: 0x00c3, 0xcd3: 0x00c3, 0xcd4: 0x00c3, 0xcd6: 0x00c3, - 0xcd8: 0x00c0, 0xcd9: 0x00c0, 0xcda: 0x00c0, 0xcdb: 0x00c0, 0xcdc: 0x00c0, 0xcdd: 0x00c0, - 0xcde: 0x00c0, 0xcdf: 0x00c0, - 0xce6: 0x00c0, 0xce7: 0x00c0, 0xce8: 0x00c0, 0xce9: 0x00c0, - 0xcea: 0x00c0, 0xceb: 0x00c0, 0xcec: 0x00c0, 0xced: 0x00c0, 0xcee: 0x00c0, 0xcef: 0x00c0, - 0xcf2: 0x00c0, 0xcf3: 0x00c0, 0xcf4: 0x0080, - // Block 0x34, offset 0xd00 - 0xd01: 0x00c0, 0xd02: 0x00c0, 0xd03: 0x00c0, 0xd04: 0x00c0, 0xd05: 0x00c0, - 0xd06: 0x00c0, 0xd07: 0x00c0, 0xd08: 0x00c0, 0xd09: 0x00c0, 0xd0a: 0x00c0, 0xd0b: 0x00c0, - 0xd0c: 0x00c0, 0xd0d: 0x00c0, 0xd0e: 0x00c0, 0xd0f: 0x00c0, 0xd10: 0x00c0, 0xd11: 0x00c0, - 0xd12: 0x00c0, 0xd13: 0x00c0, 0xd14: 0x00c0, 0xd15: 0x00c0, 0xd16: 0x00c0, 0xd17: 0x00c0, - 0xd18: 0x00c0, 0xd19: 0x00c0, 0xd1a: 0x00c0, 0xd1b: 0x00c0, 0xd1c: 0x00c0, 0xd1d: 0x00c0, - 0xd1e: 0x00c0, 0xd1f: 0x00c0, 0xd20: 0x00c0, 0xd21: 0x00c0, 0xd22: 0x00c0, 0xd23: 0x00c0, - 0xd24: 0x00c0, 0xd25: 0x00c0, 0xd26: 0x00c0, 0xd27: 0x00c0, 0xd28: 0x00c0, 0xd29: 0x00c0, - 0xd2a: 0x00c0, 0xd2b: 0x00c0, 0xd2c: 0x00c0, 0xd2d: 0x00c0, 0xd2e: 0x00c0, 0xd2f: 0x00c0, - 0xd30: 0x00c0, 0xd31: 0x00c3, 0xd32: 0x00c0, 0xd33: 0x0080, 0xd34: 0x00c3, 0xd35: 0x00c3, - 0xd36: 0x00c3, 0xd37: 0x00c3, 0xd38: 0x00c3, 0xd39: 0x00c3, 0xd3a: 0x00c6, - 0xd3f: 0x0080, - // Block 0x35, offset 0xd40 - 0xd40: 0x00c0, 0xd41: 0x00c0, 0xd42: 0x00c0, 0xd43: 0x00c0, 0xd44: 0x00c0, 0xd45: 0x00c0, - 0xd46: 0x00c0, 0xd47: 0x00c3, 0xd48: 0x00c3, 0xd49: 0x00c3, 0xd4a: 0x00c3, 0xd4b: 0x00c3, - 0xd4c: 0x00c3, 0xd4d: 0x00c3, 0xd4e: 0x00c3, 0xd4f: 0x0080, 0xd50: 0x00c0, 0xd51: 0x00c0, - 0xd52: 0x00c0, 0xd53: 0x00c0, 0xd54: 0x00c0, 0xd55: 0x00c0, 0xd56: 0x00c0, 0xd57: 0x00c0, - 0xd58: 0x00c0, 0xd59: 0x00c0, 0xd5a: 0x0080, 0xd5b: 0x0080, - // Block 0x36, offset 0xd80 - 0xd81: 0x00c0, 0xd82: 0x00c0, 0xd84: 0x00c0, - 0xd87: 0x00c0, 0xd88: 0x00c0, 0xd8a: 0x00c0, - 0xd8d: 0x00c0, - 0xd94: 0x00c0, 0xd95: 0x00c0, 0xd96: 0x00c0, 0xd97: 0x00c0, - 0xd99: 0x00c0, 0xd9a: 0x00c0, 0xd9b: 0x00c0, 0xd9c: 0x00c0, 0xd9d: 0x00c0, - 0xd9e: 0x00c0, 0xd9f: 0x00c0, 0xda1: 0x00c0, 0xda2: 0x00c0, 0xda3: 0x00c0, - 0xda5: 0x00c0, 0xda7: 0x00c0, - 0xdaa: 0x00c0, 0xdab: 0x00c0, 0xdad: 0x00c0, 0xdae: 0x00c0, 0xdaf: 0x00c0, - 0xdb0: 0x00c0, 0xdb1: 0x00c3, 0xdb2: 0x00c0, 0xdb3: 0x0080, 0xdb4: 0x00c3, 0xdb5: 0x00c3, - 0xdb6: 0x00c3, 0xdb7: 0x00c3, 0xdb8: 0x00c3, 0xdb9: 0x00c3, 0xdbb: 0x00c3, - 0xdbc: 0x00c3, 0xdbd: 0x00c0, - // Block 0x37, offset 0xdc0 - 0xdc0: 0x00c0, 0xdc1: 0x00c0, 0xdc2: 0x00c0, 0xdc3: 0x00c0, 0xdc4: 0x00c0, - 0xdc6: 0x00c0, 0xdc8: 0x00c3, 0xdc9: 0x00c3, 0xdca: 0x00c3, 0xdcb: 0x00c3, - 0xdcc: 0x00c3, 0xdcd: 0x00c3, 0xdd0: 0x00c0, 0xdd1: 0x00c0, - 0xdd2: 0x00c0, 0xdd3: 0x00c0, 0xdd4: 0x00c0, 0xdd5: 0x00c0, 0xdd6: 0x00c0, 0xdd7: 0x00c0, - 0xdd8: 0x00c0, 0xdd9: 0x00c0, 0xddc: 0x0080, 0xddd: 0x0080, - 0xdde: 0x00c0, 0xddf: 0x00c0, - // Block 0x38, offset 0xe00 - 0xe00: 0x00c0, 0xe01: 0x0080, 0xe02: 0x0080, 0xe03: 0x0080, 0xe04: 0x0080, 0xe05: 0x0080, - 0xe06: 0x0080, 0xe07: 0x0080, 0xe08: 0x0080, 0xe09: 0x0080, 0xe0a: 0x0080, 0xe0b: 0x00c0, - 0xe0c: 0x0080, 0xe0d: 0x0080, 0xe0e: 0x0080, 0xe0f: 0x0080, 0xe10: 0x0080, 0xe11: 0x0080, - 0xe12: 0x0080, 0xe13: 0x0080, 0xe14: 0x0080, 0xe15: 0x0080, 0xe16: 0x0080, 0xe17: 0x0080, - 0xe18: 0x00c3, 0xe19: 0x00c3, 0xe1a: 0x0080, 0xe1b: 0x0080, 0xe1c: 0x0080, 0xe1d: 0x0080, - 0xe1e: 0x0080, 0xe1f: 0x0080, 0xe20: 0x00c0, 0xe21: 0x00c0, 0xe22: 0x00c0, 0xe23: 0x00c0, - 0xe24: 0x00c0, 0xe25: 0x00c0, 0xe26: 0x00c0, 0xe27: 0x00c0, 0xe28: 0x00c0, 0xe29: 0x00c0, - 0xe2a: 0x0080, 0xe2b: 0x0080, 0xe2c: 0x0080, 0xe2d: 0x0080, 0xe2e: 0x0080, 0xe2f: 0x0080, - 0xe30: 0x0080, 0xe31: 0x0080, 0xe32: 0x0080, 0xe33: 0x0080, 0xe34: 0x0080, 0xe35: 0x00c3, - 0xe36: 0x0080, 0xe37: 0x00c3, 0xe38: 0x0080, 0xe39: 0x00c3, 0xe3a: 0x0080, 0xe3b: 0x0080, - 0xe3c: 0x0080, 0xe3d: 0x0080, 0xe3e: 0x00c0, 0xe3f: 0x00c0, - // Block 0x39, offset 0xe40 - 0xe40: 0x00c0, 0xe41: 0x00c0, 0xe42: 0x00c0, 0xe43: 0x0080, 0xe44: 0x00c0, 0xe45: 0x00c0, - 0xe46: 0x00c0, 0xe47: 0x00c0, 0xe49: 0x00c0, 0xe4a: 0x00c0, 0xe4b: 0x00c0, - 0xe4c: 0x00c0, 0xe4d: 0x0080, 0xe4e: 0x00c0, 0xe4f: 0x00c0, 0xe50: 0x00c0, 0xe51: 0x00c0, - 0xe52: 0x0080, 0xe53: 0x00c0, 0xe54: 0x00c0, 0xe55: 0x00c0, 0xe56: 0x00c0, 0xe57: 0x0080, - 0xe58: 0x00c0, 0xe59: 0x00c0, 0xe5a: 0x00c0, 0xe5b: 0x00c0, 0xe5c: 0x0080, 0xe5d: 0x00c0, - 0xe5e: 0x00c0, 0xe5f: 0x00c0, 0xe60: 0x00c0, 0xe61: 0x00c0, 0xe62: 0x00c0, 0xe63: 0x00c0, - 0xe64: 0x00c0, 0xe65: 0x00c0, 0xe66: 0x00c0, 0xe67: 0x00c0, 0xe68: 0x00c0, 0xe69: 0x0080, - 0xe6a: 0x00c0, 0xe6b: 0x00c0, 0xe6c: 0x00c0, - 0xe71: 0x00c3, 0xe72: 0x00c3, 0xe73: 0x0083, 0xe74: 0x00c3, 0xe75: 0x0083, - 0xe76: 0x0083, 0xe77: 0x0083, 0xe78: 0x0083, 0xe79: 0x0083, 0xe7a: 0x00c3, 0xe7b: 0x00c3, - 0xe7c: 0x00c3, 0xe7d: 0x00c3, 0xe7e: 0x00c3, 0xe7f: 0x00c0, - // Block 0x3a, offset 0xe80 - 0xe80: 0x00c3, 0xe81: 0x0083, 0xe82: 0x00c3, 0xe83: 0x00c3, 0xe84: 0x00c6, 0xe85: 0x0080, - 0xe86: 0x00c3, 0xe87: 0x00c3, 0xe88: 0x00c0, 0xe89: 0x00c0, 0xe8a: 0x00c0, 0xe8b: 0x00c0, - 0xe8c: 0x00c0, 0xe8d: 0x00c3, 0xe8e: 0x00c3, 0xe8f: 0x00c3, 0xe90: 0x00c3, 0xe91: 0x00c3, - 0xe92: 0x00c3, 0xe93: 0x0083, 0xe94: 0x00c3, 0xe95: 0x00c3, 0xe96: 0x00c3, 0xe97: 0x00c3, - 0xe99: 0x00c3, 0xe9a: 0x00c3, 0xe9b: 0x00c3, 0xe9c: 0x00c3, 0xe9d: 0x0083, - 0xe9e: 0x00c3, 0xe9f: 0x00c3, 0xea0: 0x00c3, 0xea1: 0x00c3, 0xea2: 0x0083, 0xea3: 0x00c3, - 0xea4: 0x00c3, 0xea5: 0x00c3, 0xea6: 0x00c3, 0xea7: 0x0083, 0xea8: 0x00c3, 0xea9: 0x00c3, - 0xeaa: 0x00c3, 0xeab: 0x00c3, 0xeac: 0x0083, 0xead: 0x00c3, 0xeae: 0x00c3, 0xeaf: 0x00c3, - 0xeb0: 0x00c3, 0xeb1: 0x00c3, 0xeb2: 0x00c3, 0xeb3: 0x00c3, 0xeb4: 0x00c3, 0xeb5: 0x00c3, - 0xeb6: 0x00c3, 0xeb7: 0x00c3, 0xeb8: 0x00c3, 0xeb9: 0x0083, 0xeba: 0x00c3, 0xebb: 0x00c3, - 0xebc: 0x00c3, 0xebe: 0x0080, 0xebf: 0x0080, - // Block 0x3b, offset 0xec0 - 0xec0: 0x0080, 0xec1: 0x0080, 0xec2: 0x0080, 0xec3: 0x0080, 0xec4: 0x0080, 0xec5: 0x0080, - 0xec6: 0x00c3, 0xec7: 0x0080, 0xec8: 0x0080, 0xec9: 0x0080, 0xeca: 0x0080, 0xecb: 0x0080, - 0xecc: 0x0080, 0xece: 0x0080, 0xecf: 0x0080, 0xed0: 0x0080, 0xed1: 0x0080, - 0xed2: 0x0080, 0xed3: 0x0080, 0xed4: 0x0080, 0xed5: 0x0080, 0xed6: 0x0080, 0xed7: 0x0080, - 0xed8: 0x0080, 0xed9: 0x0080, 0xeda: 0x0080, - // Block 0x3c, offset 0xf00 - 0xf00: 0x00c0, 0xf01: 0x00c0, 0xf02: 0x00c0, 0xf03: 0x00c0, 0xf04: 0x00c0, 0xf05: 0x00c0, - 0xf06: 0x00c0, 0xf07: 0x00c0, 0xf08: 0x00c0, 0xf09: 0x00c0, 0xf0a: 0x00c0, 0xf0b: 0x00c0, - 0xf0c: 0x00c0, 0xf0d: 0x00c0, 0xf0e: 0x00c0, 0xf0f: 0x00c0, 0xf10: 0x00c0, 0xf11: 0x00c0, - 0xf12: 0x00c0, 0xf13: 0x00c0, 0xf14: 0x00c0, 0xf15: 0x00c0, 0xf16: 0x00c0, 0xf17: 0x00c0, - 0xf18: 0x00c0, 0xf19: 0x00c0, 0xf1a: 0x00c0, 0xf1b: 0x00c0, 0xf1c: 0x00c0, 0xf1d: 0x00c0, - 0xf1e: 0x00c0, 0xf1f: 0x00c0, 0xf20: 0x00c0, 0xf21: 0x00c0, 0xf22: 0x00c0, 0xf23: 0x00c0, - 0xf24: 0x00c0, 0xf25: 0x00c0, 0xf26: 0x00c0, 0xf27: 0x00c0, 0xf28: 0x00c0, 0xf29: 0x00c0, - 0xf2a: 0x00c0, 0xf2b: 0x00c0, 0xf2c: 0x00c0, 0xf2d: 0x00c3, 0xf2e: 0x00c3, 0xf2f: 0x00c3, - 0xf30: 0x00c3, 0xf31: 0x00c0, 0xf32: 0x00c3, 0xf33: 0x00c3, 0xf34: 0x00c3, 0xf35: 0x00c3, - 0xf36: 0x00c3, 0xf37: 0x00c3, 0xf38: 0x00c0, 0xf39: 0x00c6, 0xf3a: 0x00c6, 0xf3b: 0x00c0, - 0xf3c: 0x00c0, 0xf3d: 0x00c3, 0xf3e: 0x00c3, 0xf3f: 0x00c0, - // Block 0x3d, offset 0xf40 - 0xf40: 0x00c0, 0xf41: 0x00c0, 0xf42: 0x00c0, 0xf43: 0x00c0, 0xf44: 0x00c0, 0xf45: 0x00c0, - 0xf46: 0x00c0, 0xf47: 0x00c0, 0xf48: 0x00c0, 0xf49: 0x00c0, 0xf4a: 0x0080, 0xf4b: 0x0080, - 0xf4c: 0x0080, 0xf4d: 0x0080, 0xf4e: 0x0080, 0xf4f: 0x0080, 0xf50: 0x00c0, 0xf51: 0x00c0, - 0xf52: 0x00c0, 0xf53: 0x00c0, 0xf54: 0x00c0, 0xf55: 0x00c0, 0xf56: 0x00c0, 0xf57: 0x00c0, - 0xf58: 0x00c3, 0xf59: 0x00c3, 0xf5a: 0x00c0, 0xf5b: 0x00c0, 0xf5c: 0x00c0, 0xf5d: 0x00c0, - 0xf5e: 0x00c3, 0xf5f: 0x00c3, 0xf60: 0x00c3, 0xf61: 0x00c0, 0xf62: 0x00c0, 0xf63: 0x00c0, - 0xf64: 0x00c0, 0xf65: 0x00c0, 0xf66: 0x00c0, 0xf67: 0x00c0, 0xf68: 0x00c0, 0xf69: 0x00c0, - 0xf6a: 0x00c0, 0xf6b: 0x00c0, 0xf6c: 0x00c0, 0xf6d: 0x00c0, 0xf6e: 0x00c0, 0xf6f: 0x00c0, - 0xf70: 0x00c0, 0xf71: 0x00c3, 0xf72: 0x00c3, 0xf73: 0x00c3, 0xf74: 0x00c3, 0xf75: 0x00c0, - 0xf76: 0x00c0, 0xf77: 0x00c0, 0xf78: 0x00c0, 0xf79: 0x00c0, 0xf7a: 0x00c0, 0xf7b: 0x00c0, - 0xf7c: 0x00c0, 0xf7d: 0x00c0, 0xf7e: 0x00c0, 0xf7f: 0x00c0, - // Block 0x3e, offset 0xf80 - 0xf80: 0x00c0, 0xf81: 0x00c0, 0xf82: 0x00c3, 0xf83: 0x00c0, 0xf84: 0x00c0, 0xf85: 0x00c3, - 0xf86: 0x00c3, 0xf87: 0x00c0, 0xf88: 0x00c0, 0xf89: 0x00c0, 0xf8a: 0x00c0, 0xf8b: 0x00c0, - 0xf8c: 0x00c0, 0xf8d: 0x00c3, 0xf8e: 0x00c0, 0xf8f: 0x00c0, 0xf90: 0x00c0, 0xf91: 0x00c0, - 0xf92: 0x00c0, 0xf93: 0x00c0, 0xf94: 0x00c0, 0xf95: 0x00c0, 0xf96: 0x00c0, 0xf97: 0x00c0, - 0xf98: 0x00c0, 0xf99: 0x00c0, 0xf9a: 0x00c0, 0xf9b: 0x00c0, 0xf9c: 0x00c0, 0xf9d: 0x00c3, - 0xf9e: 0x0080, 0xf9f: 0x0080, 0xfa0: 0x00c0, 0xfa1: 0x00c0, 0xfa2: 0x00c0, 0xfa3: 0x00c0, - 0xfa4: 0x00c0, 0xfa5: 0x00c0, 0xfa6: 0x00c0, 0xfa7: 0x00c0, 0xfa8: 0x00c0, 0xfa9: 0x00c0, - 0xfaa: 0x00c0, 0xfab: 0x00c0, 0xfac: 0x00c0, 0xfad: 0x00c0, 0xfae: 0x00c0, 0xfaf: 0x00c0, - 0xfb0: 0x00c0, 0xfb1: 0x00c0, 0xfb2: 0x00c0, 0xfb3: 0x00c0, 0xfb4: 0x00c0, 0xfb5: 0x00c0, - 0xfb6: 0x00c0, 0xfb7: 0x00c0, 0xfb8: 0x00c0, 0xfb9: 0x00c0, 0xfba: 0x00c0, 0xfbb: 0x00c0, - 0xfbc: 0x00c0, 0xfbd: 0x00c0, 0xfbe: 0x00c0, 0xfbf: 0x00c0, - // Block 0x3f, offset 0xfc0 - 0xfc0: 0x00c0, 0xfc1: 0x00c0, 0xfc2: 0x00c0, 0xfc3: 0x00c0, 0xfc4: 0x00c0, 0xfc5: 0x00c0, - 0xfc7: 0x00c0, - 0xfcd: 0x00c0, 0xfd0: 0x00c0, 0xfd1: 0x00c0, - 0xfd2: 0x00c0, 0xfd3: 0x00c0, 0xfd4: 0x00c0, 0xfd5: 0x00c0, 0xfd6: 0x00c0, 0xfd7: 0x00c0, - 0xfd8: 0x00c0, 0xfd9: 0x00c0, 0xfda: 0x00c0, 0xfdb: 0x00c0, 0xfdc: 0x00c0, 0xfdd: 0x00c0, - 0xfde: 0x00c0, 0xfdf: 0x00c0, 0xfe0: 0x00c0, 0xfe1: 0x00c0, 0xfe2: 0x00c0, 0xfe3: 0x00c0, - 0xfe4: 0x00c0, 0xfe5: 0x00c0, 0xfe6: 0x00c0, 0xfe7: 0x00c0, 0xfe8: 0x00c0, 0xfe9: 0x00c0, - 0xfea: 0x00c0, 0xfeb: 0x00c0, 0xfec: 0x00c0, 0xfed: 0x00c0, 0xfee: 0x00c0, 0xfef: 0x00c0, - 0xff0: 0x00c0, 0xff1: 0x00c0, 0xff2: 0x00c0, 0xff3: 0x00c0, 0xff4: 0x00c0, 0xff5: 0x00c0, - 0xff6: 0x00c0, 0xff7: 0x00c0, 0xff8: 0x00c0, 0xff9: 0x00c0, 0xffa: 0x00c0, 0xffb: 0x0080, - 0xffc: 0x0080, 0xffd: 0x00c0, 0xffe: 0x00c0, 0xfff: 0x00c0, - // Block 0x40, offset 0x1000 - 0x1000: 0x0040, 0x1001: 0x0040, 0x1002: 0x0040, 0x1003: 0x0040, 0x1004: 0x0040, 0x1005: 0x0040, - 0x1006: 0x0040, 0x1007: 0x0040, 0x1008: 0x0040, 0x1009: 0x0040, 0x100a: 0x0040, 0x100b: 0x0040, - 0x100c: 0x0040, 0x100d: 0x0040, 0x100e: 0x0040, 0x100f: 0x0040, 0x1010: 0x0040, 0x1011: 0x0040, - 0x1012: 0x0040, 0x1013: 0x0040, 0x1014: 0x0040, 0x1015: 0x0040, 0x1016: 0x0040, 0x1017: 0x0040, - 0x1018: 0x0040, 0x1019: 0x0040, 0x101a: 0x0040, 0x101b: 0x0040, 0x101c: 0x0040, 0x101d: 0x0040, - 0x101e: 0x0040, 0x101f: 0x0040, 0x1020: 0x0040, 0x1021: 0x0040, 0x1022: 0x0040, 0x1023: 0x0040, - 0x1024: 0x0040, 0x1025: 0x0040, 0x1026: 0x0040, 0x1027: 0x0040, 0x1028: 0x0040, 0x1029: 0x0040, - 0x102a: 0x0040, 0x102b: 0x0040, 0x102c: 0x0040, 0x102d: 0x0040, 0x102e: 0x0040, 0x102f: 0x0040, - 0x1030: 0x0040, 0x1031: 0x0040, 0x1032: 0x0040, 0x1033: 0x0040, 0x1034: 0x0040, 0x1035: 0x0040, - 0x1036: 0x0040, 0x1037: 0x0040, 0x1038: 0x0040, 0x1039: 0x0040, 0x103a: 0x0040, 0x103b: 0x0040, - 0x103c: 0x0040, 0x103d: 0x0040, 0x103e: 0x0040, 0x103f: 0x0040, - // Block 0x41, offset 0x1040 - 0x1040: 0x00c0, 0x1041: 0x00c0, 0x1042: 0x00c0, 0x1043: 0x00c0, 0x1044: 0x00c0, 0x1045: 0x00c0, - 0x1046: 0x00c0, 0x1047: 0x00c0, 0x1048: 0x00c0, 0x104a: 0x00c0, 0x104b: 0x00c0, - 0x104c: 0x00c0, 0x104d: 0x00c0, 0x1050: 0x00c0, 0x1051: 0x00c0, - 0x1052: 0x00c0, 0x1053: 0x00c0, 0x1054: 0x00c0, 0x1055: 0x00c0, 0x1056: 0x00c0, - 0x1058: 0x00c0, 0x105a: 0x00c0, 0x105b: 0x00c0, 0x105c: 0x00c0, 0x105d: 0x00c0, - 0x1060: 0x00c0, 0x1061: 0x00c0, 0x1062: 0x00c0, 0x1063: 0x00c0, - 0x1064: 0x00c0, 0x1065: 0x00c0, 0x1066: 0x00c0, 0x1067: 0x00c0, 0x1068: 0x00c0, 0x1069: 0x00c0, - 0x106a: 0x00c0, 0x106b: 0x00c0, 0x106c: 0x00c0, 0x106d: 0x00c0, 0x106e: 0x00c0, 0x106f: 0x00c0, - 0x1070: 0x00c0, 0x1071: 0x00c0, 0x1072: 0x00c0, 0x1073: 0x00c0, 0x1074: 0x00c0, 0x1075: 0x00c0, - 0x1076: 0x00c0, 0x1077: 0x00c0, 0x1078: 0x00c0, 0x1079: 0x00c0, 0x107a: 0x00c0, 0x107b: 0x00c0, - 0x107c: 0x00c0, 0x107d: 0x00c0, 0x107e: 0x00c0, 0x107f: 0x00c0, - // Block 0x42, offset 0x1080 - 0x1080: 0x00c0, 0x1081: 0x00c0, 0x1082: 0x00c0, 0x1083: 0x00c0, 0x1084: 0x00c0, 0x1085: 0x00c0, - 0x1086: 0x00c0, 0x1087: 0x00c0, 0x1088: 0x00c0, 0x108a: 0x00c0, 0x108b: 0x00c0, - 0x108c: 0x00c0, 0x108d: 0x00c0, 0x1090: 0x00c0, 0x1091: 0x00c0, - 0x1092: 0x00c0, 0x1093: 0x00c0, 0x1094: 0x00c0, 0x1095: 0x00c0, 0x1096: 0x00c0, 0x1097: 0x00c0, - 0x1098: 0x00c0, 0x1099: 0x00c0, 0x109a: 0x00c0, 0x109b: 0x00c0, 0x109c: 0x00c0, 0x109d: 0x00c0, - 0x109e: 0x00c0, 0x109f: 0x00c0, 0x10a0: 0x00c0, 0x10a1: 0x00c0, 0x10a2: 0x00c0, 0x10a3: 0x00c0, - 0x10a4: 0x00c0, 0x10a5: 0x00c0, 0x10a6: 0x00c0, 0x10a7: 0x00c0, 0x10a8: 0x00c0, 0x10a9: 0x00c0, - 0x10aa: 0x00c0, 0x10ab: 0x00c0, 0x10ac: 0x00c0, 0x10ad: 0x00c0, 0x10ae: 0x00c0, 0x10af: 0x00c0, - 0x10b0: 0x00c0, 0x10b2: 0x00c0, 0x10b3: 0x00c0, 0x10b4: 0x00c0, 0x10b5: 0x00c0, - 0x10b8: 0x00c0, 0x10b9: 0x00c0, 0x10ba: 0x00c0, 0x10bb: 0x00c0, - 0x10bc: 0x00c0, 0x10bd: 0x00c0, 0x10be: 0x00c0, - // Block 0x43, offset 0x10c0 - 0x10c0: 0x00c0, 0x10c2: 0x00c0, 0x10c3: 0x00c0, 0x10c4: 0x00c0, 0x10c5: 0x00c0, - 0x10c8: 0x00c0, 0x10c9: 0x00c0, 0x10ca: 0x00c0, 0x10cb: 0x00c0, - 0x10cc: 0x00c0, 0x10cd: 0x00c0, 0x10ce: 0x00c0, 0x10cf: 0x00c0, 0x10d0: 0x00c0, 0x10d1: 0x00c0, - 0x10d2: 0x00c0, 0x10d3: 0x00c0, 0x10d4: 0x00c0, 0x10d5: 0x00c0, 0x10d6: 0x00c0, - 0x10d8: 0x00c0, 0x10d9: 0x00c0, 0x10da: 0x00c0, 0x10db: 0x00c0, 0x10dc: 0x00c0, 0x10dd: 0x00c0, - 0x10de: 0x00c0, 0x10df: 0x00c0, 0x10e0: 0x00c0, 0x10e1: 0x00c0, 0x10e2: 0x00c0, 0x10e3: 0x00c0, - 0x10e4: 0x00c0, 0x10e5: 0x00c0, 0x10e6: 0x00c0, 0x10e7: 0x00c0, 0x10e8: 0x00c0, 0x10e9: 0x00c0, - 0x10ea: 0x00c0, 0x10eb: 0x00c0, 0x10ec: 0x00c0, 0x10ed: 0x00c0, 0x10ee: 0x00c0, 0x10ef: 0x00c0, - 0x10f0: 0x00c0, 0x10f1: 0x00c0, 0x10f2: 0x00c0, 0x10f3: 0x00c0, 0x10f4: 0x00c0, 0x10f5: 0x00c0, - 0x10f6: 0x00c0, 0x10f7: 0x00c0, 0x10f8: 0x00c0, 0x10f9: 0x00c0, 0x10fa: 0x00c0, 0x10fb: 0x00c0, - 0x10fc: 0x00c0, 0x10fd: 0x00c0, 0x10fe: 0x00c0, 0x10ff: 0x00c0, - // Block 0x44, offset 0x1100 - 0x1100: 0x00c0, 0x1101: 0x00c0, 0x1102: 0x00c0, 0x1103: 0x00c0, 0x1104: 0x00c0, 0x1105: 0x00c0, - 0x1106: 0x00c0, 0x1107: 0x00c0, 0x1108: 0x00c0, 0x1109: 0x00c0, 0x110a: 0x00c0, 0x110b: 0x00c0, - 0x110c: 0x00c0, 0x110d: 0x00c0, 0x110e: 0x00c0, 0x110f: 0x00c0, 0x1110: 0x00c0, - 0x1112: 0x00c0, 0x1113: 0x00c0, 0x1114: 0x00c0, 0x1115: 0x00c0, - 0x1118: 0x00c0, 0x1119: 0x00c0, 0x111a: 0x00c0, 0x111b: 0x00c0, 0x111c: 0x00c0, 0x111d: 0x00c0, - 0x111e: 0x00c0, 0x111f: 0x00c0, 0x1120: 0x00c0, 0x1121: 0x00c0, 0x1122: 0x00c0, 0x1123: 0x00c0, - 0x1124: 0x00c0, 0x1125: 0x00c0, 0x1126: 0x00c0, 0x1127: 0x00c0, 0x1128: 0x00c0, 0x1129: 0x00c0, - 0x112a: 0x00c0, 0x112b: 0x00c0, 0x112c: 0x00c0, 0x112d: 0x00c0, 0x112e: 0x00c0, 0x112f: 0x00c0, - 0x1130: 0x00c0, 0x1131: 0x00c0, 0x1132: 0x00c0, 0x1133: 0x00c0, 0x1134: 0x00c0, 0x1135: 0x00c0, - 0x1136: 0x00c0, 0x1137: 0x00c0, 0x1138: 0x00c0, 0x1139: 0x00c0, 0x113a: 0x00c0, 0x113b: 0x00c0, - 0x113c: 0x00c0, 0x113d: 0x00c0, 0x113e: 0x00c0, 0x113f: 0x00c0, - // Block 0x45, offset 0x1140 - 0x1140: 0x00c0, 0x1141: 0x00c0, 0x1142: 0x00c0, 0x1143: 0x00c0, 0x1144: 0x00c0, 0x1145: 0x00c0, - 0x1146: 0x00c0, 0x1147: 0x00c0, 0x1148: 0x00c0, 0x1149: 0x00c0, 0x114a: 0x00c0, 0x114b: 0x00c0, - 0x114c: 0x00c0, 0x114d: 0x00c0, 0x114e: 0x00c0, 0x114f: 0x00c0, 0x1150: 0x00c0, 0x1151: 0x00c0, - 0x1152: 0x00c0, 0x1153: 0x00c0, 0x1154: 0x00c0, 0x1155: 0x00c0, 0x1156: 0x00c0, 0x1157: 0x00c0, - 0x1158: 0x00c0, 0x1159: 0x00c0, 0x115a: 0x00c0, 0x115d: 0x00c3, - 0x115e: 0x00c3, 0x115f: 0x00c3, 0x1160: 0x0080, 0x1161: 0x0080, 0x1162: 0x0080, 0x1163: 0x0080, - 0x1164: 0x0080, 0x1165: 0x0080, 0x1166: 0x0080, 0x1167: 0x0080, 0x1168: 0x0080, 0x1169: 0x0080, - 0x116a: 0x0080, 0x116b: 0x0080, 0x116c: 0x0080, 0x116d: 0x0080, 0x116e: 0x0080, 0x116f: 0x0080, - 0x1170: 0x0080, 0x1171: 0x0080, 0x1172: 0x0080, 0x1173: 0x0080, 0x1174: 0x0080, 0x1175: 0x0080, - 0x1176: 0x0080, 0x1177: 0x0080, 0x1178: 0x0080, 0x1179: 0x0080, 0x117a: 0x0080, 0x117b: 0x0080, - 0x117c: 0x0080, - // Block 0x46, offset 0x1180 - 0x1180: 0x00c0, 0x1181: 0x00c0, 0x1182: 0x00c0, 0x1183: 0x00c0, 0x1184: 0x00c0, 0x1185: 0x00c0, - 0x1186: 0x00c0, 0x1187: 0x00c0, 0x1188: 0x00c0, 0x1189: 0x00c0, 0x118a: 0x00c0, 0x118b: 0x00c0, - 0x118c: 0x00c0, 0x118d: 0x00c0, 0x118e: 0x00c0, 0x118f: 0x00c0, 0x1190: 0x0080, 0x1191: 0x0080, - 0x1192: 0x0080, 0x1193: 0x0080, 0x1194: 0x0080, 0x1195: 0x0080, 0x1196: 0x0080, 0x1197: 0x0080, - 0x1198: 0x0080, 0x1199: 0x0080, - 0x11a0: 0x00c0, 0x11a1: 0x00c0, 0x11a2: 0x00c0, 0x11a3: 0x00c0, - 0x11a4: 0x00c0, 0x11a5: 0x00c0, 0x11a6: 0x00c0, 0x11a7: 0x00c0, 0x11a8: 0x00c0, 0x11a9: 0x00c0, - 0x11aa: 0x00c0, 0x11ab: 0x00c0, 0x11ac: 0x00c0, 0x11ad: 0x00c0, 0x11ae: 0x00c0, 0x11af: 0x00c0, - 0x11b0: 0x00c0, 0x11b1: 0x00c0, 0x11b2: 0x00c0, 0x11b3: 0x00c0, 0x11b4: 0x00c0, 0x11b5: 0x00c0, - 0x11b6: 0x00c0, 0x11b7: 0x00c0, 0x11b8: 0x00c0, 0x11b9: 0x00c0, 0x11ba: 0x00c0, 0x11bb: 0x00c0, - 0x11bc: 0x00c0, 0x11bd: 0x00c0, 0x11be: 0x00c0, 0x11bf: 0x00c0, - // Block 0x47, offset 0x11c0 - 0x11c0: 0x00c0, 0x11c1: 0x00c0, 0x11c2: 0x00c0, 0x11c3: 0x00c0, 0x11c4: 0x00c0, 0x11c5: 0x00c0, - 0x11c6: 0x00c0, 0x11c7: 0x00c0, 0x11c8: 0x00c0, 0x11c9: 0x00c0, 0x11ca: 0x00c0, 0x11cb: 0x00c0, - 0x11cc: 0x00c0, 0x11cd: 0x00c0, 0x11ce: 0x00c0, 0x11cf: 0x00c0, 0x11d0: 0x00c0, 0x11d1: 0x00c0, - 0x11d2: 0x00c0, 0x11d3: 0x00c0, 0x11d4: 0x00c0, 0x11d5: 0x00c0, 0x11d6: 0x00c0, 0x11d7: 0x00c0, - 0x11d8: 0x00c0, 0x11d9: 0x00c0, 0x11da: 0x00c0, 0x11db: 0x00c0, 0x11dc: 0x00c0, 0x11dd: 0x00c0, - 0x11de: 0x00c0, 0x11df: 0x00c0, 0x11e0: 0x00c0, 0x11e1: 0x00c0, 0x11e2: 0x00c0, 0x11e3: 0x00c0, - 0x11e4: 0x00c0, 0x11e5: 0x00c0, 0x11e6: 0x00c0, 0x11e7: 0x00c0, 0x11e8: 0x00c0, 0x11e9: 0x00c0, - 0x11ea: 0x00c0, 0x11eb: 0x00c0, 0x11ec: 0x00c0, 0x11ed: 0x00c0, 0x11ee: 0x00c0, 0x11ef: 0x00c0, - 0x11f0: 0x00c0, 0x11f1: 0x00c0, 0x11f2: 0x00c0, 0x11f3: 0x00c0, 0x11f4: 0x00c0, 0x11f5: 0x00c0, - 0x11f8: 0x00c0, 0x11f9: 0x00c0, 0x11fa: 0x00c0, 0x11fb: 0x00c0, - 0x11fc: 0x00c0, 0x11fd: 0x00c0, - // Block 0x48, offset 0x1200 - 0x1200: 0x0080, 0x1201: 0x00c0, 0x1202: 0x00c0, 0x1203: 0x00c0, 0x1204: 0x00c0, 0x1205: 0x00c0, - 0x1206: 0x00c0, 0x1207: 0x00c0, 0x1208: 0x00c0, 0x1209: 0x00c0, 0x120a: 0x00c0, 0x120b: 0x00c0, - 0x120c: 0x00c0, 0x120d: 0x00c0, 0x120e: 0x00c0, 0x120f: 0x00c0, 0x1210: 0x00c0, 0x1211: 0x00c0, - 0x1212: 0x00c0, 0x1213: 0x00c0, 0x1214: 0x00c0, 0x1215: 0x00c0, 0x1216: 0x00c0, 0x1217: 0x00c0, - 0x1218: 0x00c0, 0x1219: 0x00c0, 0x121a: 0x00c0, 0x121b: 0x00c0, 0x121c: 0x00c0, 0x121d: 0x00c0, - 0x121e: 0x00c0, 0x121f: 0x00c0, 0x1220: 0x00c0, 0x1221: 0x00c0, 0x1222: 0x00c0, 0x1223: 0x00c0, - 0x1224: 0x00c0, 0x1225: 0x00c0, 0x1226: 0x00c0, 0x1227: 0x00c0, 0x1228: 0x00c0, 0x1229: 0x00c0, - 0x122a: 0x00c0, 0x122b: 0x00c0, 0x122c: 0x00c0, 0x122d: 0x00c0, 0x122e: 0x00c0, 0x122f: 0x00c0, - 0x1230: 0x00c0, 0x1231: 0x00c0, 0x1232: 0x00c0, 0x1233: 0x00c0, 0x1234: 0x00c0, 0x1235: 0x00c0, - 0x1236: 0x00c0, 0x1237: 0x00c0, 0x1238: 0x00c0, 0x1239: 0x00c0, 0x123a: 0x00c0, 0x123b: 0x00c0, - 0x123c: 0x00c0, 0x123d: 0x00c0, 0x123e: 0x00c0, 0x123f: 0x00c0, - // Block 0x49, offset 0x1240 - 0x1240: 0x00c0, 0x1241: 0x00c0, 0x1242: 0x00c0, 0x1243: 0x00c0, 0x1244: 0x00c0, 0x1245: 0x00c0, - 0x1246: 0x00c0, 0x1247: 0x00c0, 0x1248: 0x00c0, 0x1249: 0x00c0, 0x124a: 0x00c0, 0x124b: 0x00c0, - 0x124c: 0x00c0, 0x124d: 0x00c0, 0x124e: 0x00c0, 0x124f: 0x00c0, 0x1250: 0x00c0, 0x1251: 0x00c0, - 0x1252: 0x00c0, 0x1253: 0x00c0, 0x1254: 0x00c0, 0x1255: 0x00c0, 0x1256: 0x00c0, 0x1257: 0x00c0, - 0x1258: 0x00c0, 0x1259: 0x00c0, 0x125a: 0x00c0, 0x125b: 0x00c0, 0x125c: 0x00c0, 0x125d: 0x00c0, - 0x125e: 0x00c0, 0x125f: 0x00c0, 0x1260: 0x00c0, 0x1261: 0x00c0, 0x1262: 0x00c0, 0x1263: 0x00c0, - 0x1264: 0x00c0, 0x1265: 0x00c0, 0x1266: 0x00c0, 0x1267: 0x00c0, 0x1268: 0x00c0, 0x1269: 0x00c0, - 0x126a: 0x00c0, 0x126b: 0x00c0, 0x126c: 0x00c0, 0x126d: 0x0080, 0x126e: 0x0080, 0x126f: 0x00c0, - 0x1270: 0x00c0, 0x1271: 0x00c0, 0x1272: 0x00c0, 0x1273: 0x00c0, 0x1274: 0x00c0, 0x1275: 0x00c0, - 0x1276: 0x00c0, 0x1277: 0x00c0, 0x1278: 0x00c0, 0x1279: 0x00c0, 0x127a: 0x00c0, 0x127b: 0x00c0, - 0x127c: 0x00c0, 0x127d: 0x00c0, 0x127e: 0x00c0, 0x127f: 0x00c0, - // Block 0x4a, offset 0x1280 - 0x1280: 0x0080, 0x1281: 0x00c0, 0x1282: 0x00c0, 0x1283: 0x00c0, 0x1284: 0x00c0, 0x1285: 0x00c0, - 0x1286: 0x00c0, 0x1287: 0x00c0, 0x1288: 0x00c0, 0x1289: 0x00c0, 0x128a: 0x00c0, 0x128b: 0x00c0, - 0x128c: 0x00c0, 0x128d: 0x00c0, 0x128e: 0x00c0, 0x128f: 0x00c0, 0x1290: 0x00c0, 0x1291: 0x00c0, - 0x1292: 0x00c0, 0x1293: 0x00c0, 0x1294: 0x00c0, 0x1295: 0x00c0, 0x1296: 0x00c0, 0x1297: 0x00c0, - 0x1298: 0x00c0, 0x1299: 0x00c0, 0x129a: 0x00c0, 0x129b: 0x0080, 0x129c: 0x0080, - 0x12a0: 0x00c0, 0x12a1: 0x00c0, 0x12a2: 0x00c0, 0x12a3: 0x00c0, - 0x12a4: 0x00c0, 0x12a5: 0x00c0, 0x12a6: 0x00c0, 0x12a7: 0x00c0, 0x12a8: 0x00c0, 0x12a9: 0x00c0, - 0x12aa: 0x00c0, 0x12ab: 0x00c0, 0x12ac: 0x00c0, 0x12ad: 0x00c0, 0x12ae: 0x00c0, 0x12af: 0x00c0, - 0x12b0: 0x00c0, 0x12b1: 0x00c0, 0x12b2: 0x00c0, 0x12b3: 0x00c0, 0x12b4: 0x00c0, 0x12b5: 0x00c0, - 0x12b6: 0x00c0, 0x12b7: 0x00c0, 0x12b8: 0x00c0, 0x12b9: 0x00c0, 0x12ba: 0x00c0, 0x12bb: 0x00c0, - 0x12bc: 0x00c0, 0x12bd: 0x00c0, 0x12be: 0x00c0, 0x12bf: 0x00c0, - // Block 0x4b, offset 0x12c0 - 0x12c0: 0x00c0, 0x12c1: 0x00c0, 0x12c2: 0x00c0, 0x12c3: 0x00c0, 0x12c4: 0x00c0, 0x12c5: 0x00c0, - 0x12c6: 0x00c0, 0x12c7: 0x00c0, 0x12c8: 0x00c0, 0x12c9: 0x00c0, 0x12ca: 0x00c0, 0x12cb: 0x00c0, - 0x12cc: 0x00c0, 0x12cd: 0x00c0, 0x12ce: 0x00c0, 0x12cf: 0x00c0, 0x12d0: 0x00c0, 0x12d1: 0x00c0, - 0x12d2: 0x00c0, 0x12d3: 0x00c0, 0x12d4: 0x00c0, 0x12d5: 0x00c0, 0x12d6: 0x00c0, 0x12d7: 0x00c0, - 0x12d8: 0x00c0, 0x12d9: 0x00c0, 0x12da: 0x00c0, 0x12db: 0x00c0, 0x12dc: 0x00c0, 0x12dd: 0x00c0, - 0x12de: 0x00c0, 0x12df: 0x00c0, 0x12e0: 0x00c0, 0x12e1: 0x00c0, 0x12e2: 0x00c0, 0x12e3: 0x00c0, - 0x12e4: 0x00c0, 0x12e5: 0x00c0, 0x12e6: 0x00c0, 0x12e7: 0x00c0, 0x12e8: 0x00c0, 0x12e9: 0x00c0, - 0x12ea: 0x00c0, 0x12eb: 0x0080, 0x12ec: 0x0080, 0x12ed: 0x0080, 0x12ee: 0x0080, 0x12ef: 0x0080, - 0x12f0: 0x0080, 0x12f1: 0x00c0, 0x12f2: 0x00c0, 0x12f3: 0x00c0, 0x12f4: 0x00c0, 0x12f5: 0x00c0, - 0x12f6: 0x00c0, 0x12f7: 0x00c0, 0x12f8: 0x00c0, - // Block 0x4c, offset 0x1300 - 0x1300: 0x00c0, 0x1301: 0x00c0, 0x1302: 0x00c0, 0x1303: 0x00c0, 0x1304: 0x00c0, 0x1305: 0x00c0, - 0x1306: 0x00c0, 0x1307: 0x00c0, 0x1308: 0x00c0, 0x1309: 0x00c0, 0x130a: 0x00c0, 0x130b: 0x00c0, - 0x130c: 0x00c0, 0x130e: 0x00c0, 0x130f: 0x00c0, 0x1310: 0x00c0, 0x1311: 0x00c0, - 0x1312: 0x00c3, 0x1313: 0x00c3, 0x1314: 0x00c6, - 0x1320: 0x00c0, 0x1321: 0x00c0, 0x1322: 0x00c0, 0x1323: 0x00c0, - 0x1324: 0x00c0, 0x1325: 0x00c0, 0x1326: 0x00c0, 0x1327: 0x00c0, 0x1328: 0x00c0, 0x1329: 0x00c0, - 0x132a: 0x00c0, 0x132b: 0x00c0, 0x132c: 0x00c0, 0x132d: 0x00c0, 0x132e: 0x00c0, 0x132f: 0x00c0, - 0x1330: 0x00c0, 0x1331: 0x00c0, 0x1332: 0x00c3, 0x1333: 0x00c3, 0x1334: 0x00c6, 0x1335: 0x0080, - 0x1336: 0x0080, - // Block 0x4d, offset 0x1340 - 0x1340: 0x00c0, 0x1341: 0x00c0, 0x1342: 0x00c0, 0x1343: 0x00c0, 0x1344: 0x00c0, 0x1345: 0x00c0, - 0x1346: 0x00c0, 0x1347: 0x00c0, 0x1348: 0x00c0, 0x1349: 0x00c0, 0x134a: 0x00c0, 0x134b: 0x00c0, - 0x134c: 0x00c0, 0x134d: 0x00c0, 0x134e: 0x00c0, 0x134f: 0x00c0, 0x1350: 0x00c0, 0x1351: 0x00c0, - 0x1352: 0x00c3, 0x1353: 0x00c3, - 0x1360: 0x00c0, 0x1361: 0x00c0, 0x1362: 0x00c0, 0x1363: 0x00c0, - 0x1364: 0x00c0, 0x1365: 0x00c0, 0x1366: 0x00c0, 0x1367: 0x00c0, 0x1368: 0x00c0, 0x1369: 0x00c0, - 0x136a: 0x00c0, 0x136b: 0x00c0, 0x136c: 0x00c0, 0x136e: 0x00c0, 0x136f: 0x00c0, - 0x1370: 0x00c0, 0x1372: 0x00c3, 0x1373: 0x00c3, - // Block 0x4e, offset 0x1380 - 0x1380: 0x00c0, 0x1381: 0x00c0, 0x1382: 0x00c0, 0x1383: 0x00c0, 0x1384: 0x00c0, 0x1385: 0x00c0, - 0x1386: 0x00c0, 0x1387: 0x00c0, 0x1388: 0x00c0, 0x1389: 0x00c0, 0x138a: 0x00c0, 0x138b: 0x00c0, - 0x138c: 0x00c0, 0x138d: 0x00c0, 0x138e: 0x00c0, 0x138f: 0x00c0, 0x1390: 0x00c0, 0x1391: 0x00c0, - 0x1392: 0x00c0, 0x1393: 0x00c0, 0x1394: 0x00c0, 0x1395: 0x00c0, 0x1396: 0x00c0, 0x1397: 0x00c0, - 0x1398: 0x00c0, 0x1399: 0x00c0, 0x139a: 0x00c0, 0x139b: 0x00c0, 0x139c: 0x00c0, 0x139d: 0x00c0, - 0x139e: 0x00c0, 0x139f: 0x00c0, 0x13a0: 0x00c0, 0x13a1: 0x00c0, 0x13a2: 0x00c0, 0x13a3: 0x00c0, - 0x13a4: 0x00c0, 0x13a5: 0x00c0, 0x13a6: 0x00c0, 0x13a7: 0x00c0, 0x13a8: 0x00c0, 0x13a9: 0x00c0, - 0x13aa: 0x00c0, 0x13ab: 0x00c0, 0x13ac: 0x00c0, 0x13ad: 0x00c0, 0x13ae: 0x00c0, 0x13af: 0x00c0, - 0x13b0: 0x00c0, 0x13b1: 0x00c0, 0x13b2: 0x00c0, 0x13b3: 0x00c0, 0x13b4: 0x0040, 0x13b5: 0x0040, - 0x13b6: 0x00c0, 0x13b7: 0x00c3, 0x13b8: 0x00c3, 0x13b9: 0x00c3, 0x13ba: 0x00c3, 0x13bb: 0x00c3, - 0x13bc: 0x00c3, 0x13bd: 0x00c3, 0x13be: 0x00c0, 0x13bf: 0x00c0, - // Block 0x4f, offset 0x13c0 - 0x13c0: 0x00c0, 0x13c1: 0x00c0, 0x13c2: 0x00c0, 0x13c3: 0x00c0, 0x13c4: 0x00c0, 0x13c5: 0x00c0, - 0x13c6: 0x00c3, 0x13c7: 0x00c0, 0x13c8: 0x00c0, 0x13c9: 0x00c3, 0x13ca: 0x00c3, 0x13cb: 0x00c3, - 0x13cc: 0x00c3, 0x13cd: 0x00c3, 0x13ce: 0x00c3, 0x13cf: 0x00c3, 0x13d0: 0x00c3, 0x13d1: 0x00c3, - 0x13d2: 0x00c6, 0x13d3: 0x00c3, 0x13d4: 0x0080, 0x13d5: 0x0080, 0x13d6: 0x0080, 0x13d7: 0x00c0, - 0x13d8: 0x0080, 0x13d9: 0x0080, 0x13da: 0x0080, 0x13db: 0x0080, 0x13dc: 0x00c0, 0x13dd: 0x00c3, - 0x13e0: 0x00c0, 0x13e1: 0x00c0, 0x13e2: 0x00c0, 0x13e3: 0x00c0, - 0x13e4: 0x00c0, 0x13e5: 0x00c0, 0x13e6: 0x00c0, 0x13e7: 0x00c0, 0x13e8: 0x00c0, 0x13e9: 0x00c0, - 0x13f0: 0x0080, 0x13f1: 0x0080, 0x13f2: 0x0080, 0x13f3: 0x0080, 0x13f4: 0x0080, 0x13f5: 0x0080, - 0x13f6: 0x0080, 0x13f7: 0x0080, 0x13f8: 0x0080, 0x13f9: 0x0080, - // Block 0x50, offset 0x1400 - 0x1400: 0x0080, 0x1401: 0x0080, 0x1402: 0x0080, 0x1403: 0x0080, 0x1404: 0x0080, 0x1405: 0x0080, - 0x1406: 0x0080, 0x1407: 0x0082, 0x1408: 0x0080, 0x1409: 0x0080, 0x140a: 0x0080, 0x140b: 0x0040, - 0x140c: 0x0040, 0x140d: 0x0040, 0x140e: 0x0040, 0x1410: 0x00c0, 0x1411: 0x00c0, - 0x1412: 0x00c0, 0x1413: 0x00c0, 0x1414: 0x00c0, 0x1415: 0x00c0, 0x1416: 0x00c0, 0x1417: 0x00c0, - 0x1418: 0x00c0, 0x1419: 0x00c0, - 0x1420: 0x00c2, 0x1421: 0x00c2, 0x1422: 0x00c2, 0x1423: 0x00c2, - 0x1424: 0x00c2, 0x1425: 0x00c2, 0x1426: 0x00c2, 0x1427: 0x00c2, 0x1428: 0x00c2, 0x1429: 0x00c2, - 0x142a: 0x00c2, 0x142b: 0x00c2, 0x142c: 0x00c2, 0x142d: 0x00c2, 0x142e: 0x00c2, 0x142f: 0x00c2, - 0x1430: 0x00c2, 0x1431: 0x00c2, 0x1432: 0x00c2, 0x1433: 0x00c2, 0x1434: 0x00c2, 0x1435: 0x00c2, - 0x1436: 0x00c2, 0x1437: 0x00c2, 0x1438: 0x00c2, 0x1439: 0x00c2, 0x143a: 0x00c2, 0x143b: 0x00c2, - 0x143c: 0x00c2, 0x143d: 0x00c2, 0x143e: 0x00c2, 0x143f: 0x00c2, - // Block 0x51, offset 0x1440 - 0x1440: 0x00c2, 0x1441: 0x00c2, 0x1442: 0x00c2, 0x1443: 0x00c2, 0x1444: 0x00c2, 0x1445: 0x00c2, - 0x1446: 0x00c2, 0x1447: 0x00c2, 0x1448: 0x00c2, 0x1449: 0x00c2, 0x144a: 0x00c2, 0x144b: 0x00c2, - 0x144c: 0x00c2, 0x144d: 0x00c2, 0x144e: 0x00c2, 0x144f: 0x00c2, 0x1450: 0x00c2, 0x1451: 0x00c2, - 0x1452: 0x00c2, 0x1453: 0x00c2, 0x1454: 0x00c2, 0x1455: 0x00c2, 0x1456: 0x00c2, 0x1457: 0x00c2, - 0x1458: 0x00c2, 0x1459: 0x00c2, 0x145a: 0x00c2, 0x145b: 0x00c2, 0x145c: 0x00c2, 0x145d: 0x00c2, - 0x145e: 0x00c2, 0x145f: 0x00c2, 0x1460: 0x00c2, 0x1461: 0x00c2, 0x1462: 0x00c2, 0x1463: 0x00c2, - 0x1464: 0x00c2, 0x1465: 0x00c2, 0x1466: 0x00c2, 0x1467: 0x00c2, 0x1468: 0x00c2, 0x1469: 0x00c2, - 0x146a: 0x00c2, 0x146b: 0x00c2, 0x146c: 0x00c2, 0x146d: 0x00c2, 0x146e: 0x00c2, 0x146f: 0x00c2, - 0x1470: 0x00c2, 0x1471: 0x00c2, 0x1472: 0x00c2, 0x1473: 0x00c2, 0x1474: 0x00c2, 0x1475: 0x00c2, - 0x1476: 0x00c2, 0x1477: 0x00c2, - // Block 0x52, offset 0x1480 - 0x1480: 0x00c0, 0x1481: 0x00c0, 0x1482: 0x00c0, 0x1483: 0x00c0, 0x1484: 0x00c0, 0x1485: 0x00c3, - 0x1486: 0x00c3, 0x1487: 0x00c2, 0x1488: 0x00c2, 0x1489: 0x00c2, 0x148a: 0x00c2, 0x148b: 0x00c2, - 0x148c: 0x00c2, 0x148d: 0x00c2, 0x148e: 0x00c2, 0x148f: 0x00c2, 0x1490: 0x00c2, 0x1491: 0x00c2, - 0x1492: 0x00c2, 0x1493: 0x00c2, 0x1494: 0x00c2, 0x1495: 0x00c2, 0x1496: 0x00c2, 0x1497: 0x00c2, - 0x1498: 0x00c2, 0x1499: 0x00c2, 0x149a: 0x00c2, 0x149b: 0x00c2, 0x149c: 0x00c2, 0x149d: 0x00c2, - 0x149e: 0x00c2, 0x149f: 0x00c2, 0x14a0: 0x00c2, 0x14a1: 0x00c2, 0x14a2: 0x00c2, 0x14a3: 0x00c2, - 0x14a4: 0x00c2, 0x14a5: 0x00c2, 0x14a6: 0x00c2, 0x14a7: 0x00c2, 0x14a8: 0x00c2, 0x14a9: 0x00c3, - 0x14aa: 0x00c2, - 0x14b0: 0x00c0, 0x14b1: 0x00c0, 0x14b2: 0x00c0, 0x14b3: 0x00c0, 0x14b4: 0x00c0, 0x14b5: 0x00c0, - 0x14b6: 0x00c0, 0x14b7: 0x00c0, 0x14b8: 0x00c0, 0x14b9: 0x00c0, 0x14ba: 0x00c0, 0x14bb: 0x00c0, - 0x14bc: 0x00c0, 0x14bd: 0x00c0, 0x14be: 0x00c0, 0x14bf: 0x00c0, - // Block 0x53, offset 0x14c0 - 0x14c0: 0x00c0, 0x14c1: 0x00c0, 0x14c2: 0x00c0, 0x14c3: 0x00c0, 0x14c4: 0x00c0, 0x14c5: 0x00c0, - 0x14c6: 0x00c0, 0x14c7: 0x00c0, 0x14c8: 0x00c0, 0x14c9: 0x00c0, 0x14ca: 0x00c0, 0x14cb: 0x00c0, - 0x14cc: 0x00c0, 0x14cd: 0x00c0, 0x14ce: 0x00c0, 0x14cf: 0x00c0, 0x14d0: 0x00c0, 0x14d1: 0x00c0, - 0x14d2: 0x00c0, 0x14d3: 0x00c0, 0x14d4: 0x00c0, 0x14d5: 0x00c0, 0x14d6: 0x00c0, 0x14d7: 0x00c0, - 0x14d8: 0x00c0, 0x14d9: 0x00c0, 0x14da: 0x00c0, 0x14db: 0x00c0, 0x14dc: 0x00c0, 0x14dd: 0x00c0, - 0x14de: 0x00c0, 0x14df: 0x00c0, 0x14e0: 0x00c0, 0x14e1: 0x00c0, 0x14e2: 0x00c0, 0x14e3: 0x00c0, - 0x14e4: 0x00c0, 0x14e5: 0x00c0, 0x14e6: 0x00c0, 0x14e7: 0x00c0, 0x14e8: 0x00c0, 0x14e9: 0x00c0, - 0x14ea: 0x00c0, 0x14eb: 0x00c0, 0x14ec: 0x00c0, 0x14ed: 0x00c0, 0x14ee: 0x00c0, 0x14ef: 0x00c0, - 0x14f0: 0x00c0, 0x14f1: 0x00c0, 0x14f2: 0x00c0, 0x14f3: 0x00c0, 0x14f4: 0x00c0, 0x14f5: 0x00c0, - // Block 0x54, offset 0x1500 - 0x1500: 0x00c0, 0x1501: 0x00c0, 0x1502: 0x00c0, 0x1503: 0x00c0, 0x1504: 0x00c0, 0x1505: 0x00c0, - 0x1506: 0x00c0, 0x1507: 0x00c0, 0x1508: 0x00c0, 0x1509: 0x00c0, 0x150a: 0x00c0, 0x150b: 0x00c0, - 0x150c: 0x00c0, 0x150d: 0x00c0, 0x150e: 0x00c0, 0x150f: 0x00c0, 0x1510: 0x00c0, 0x1511: 0x00c0, - 0x1512: 0x00c0, 0x1513: 0x00c0, 0x1514: 0x00c0, 0x1515: 0x00c0, 0x1516: 0x00c0, 0x1517: 0x00c0, - 0x1518: 0x00c0, 0x1519: 0x00c0, 0x151a: 0x00c0, 0x151b: 0x00c0, 0x151c: 0x00c0, 0x151d: 0x00c0, - 0x151e: 0x00c0, 0x1520: 0x00c3, 0x1521: 0x00c3, 0x1522: 0x00c3, 0x1523: 0x00c0, - 0x1524: 0x00c0, 0x1525: 0x00c0, 0x1526: 0x00c0, 0x1527: 0x00c3, 0x1528: 0x00c3, 0x1529: 0x00c0, - 0x152a: 0x00c0, 0x152b: 0x00c0, - 0x1530: 0x00c0, 0x1531: 0x00c0, 0x1532: 0x00c3, 0x1533: 0x00c0, 0x1534: 0x00c0, 0x1535: 0x00c0, - 0x1536: 0x00c0, 0x1537: 0x00c0, 0x1538: 0x00c0, 0x1539: 0x00c3, 0x153a: 0x00c3, 0x153b: 0x00c3, - // Block 0x55, offset 0x1540 - 0x1540: 0x0080, 0x1544: 0x0080, 0x1545: 0x0080, - 0x1546: 0x00c0, 0x1547: 0x00c0, 0x1548: 0x00c0, 0x1549: 0x00c0, 0x154a: 0x00c0, 0x154b: 0x00c0, - 0x154c: 0x00c0, 0x154d: 0x00c0, 0x154e: 0x00c0, 0x154f: 0x00c0, 0x1550: 0x00c0, 0x1551: 0x00c0, - 0x1552: 0x00c0, 0x1553: 0x00c0, 0x1554: 0x00c0, 0x1555: 0x00c0, 0x1556: 0x00c0, 0x1557: 0x00c0, - 0x1558: 0x00c0, 0x1559: 0x00c0, 0x155a: 0x00c0, 0x155b: 0x00c0, 0x155c: 0x00c0, 0x155d: 0x00c0, - 0x155e: 0x00c0, 0x155f: 0x00c0, 0x1560: 0x00c0, 0x1561: 0x00c0, 0x1562: 0x00c0, 0x1563: 0x00c0, - 0x1564: 0x00c0, 0x1565: 0x00c0, 0x1566: 0x00c0, 0x1567: 0x00c0, 0x1568: 0x00c0, 0x1569: 0x00c0, - 0x156a: 0x00c0, 0x156b: 0x00c0, 0x156c: 0x00c0, 0x156d: 0x00c0, - 0x1570: 0x00c0, 0x1571: 0x00c0, 0x1572: 0x00c0, 0x1573: 0x00c0, 0x1574: 0x00c0, - // Block 0x56, offset 0x1580 - 0x1580: 0x00c0, 0x1581: 0x00c0, 0x1582: 0x00c0, 0x1583: 0x00c0, 0x1584: 0x00c0, 0x1585: 0x00c0, - 0x1586: 0x00c0, 0x1587: 0x00c0, 0x1588: 0x00c0, 0x1589: 0x00c0, 0x158a: 0x00c0, 0x158b: 0x00c0, - 0x158c: 0x00c0, 0x158d: 0x00c0, 0x158e: 0x00c0, 0x158f: 0x00c0, 0x1590: 0x00c0, 0x1591: 0x00c0, - 0x1592: 0x00c0, 0x1593: 0x00c0, 0x1594: 0x00c0, 0x1595: 0x00c0, 0x1596: 0x00c0, 0x1597: 0x00c0, - 0x1598: 0x00c0, 0x1599: 0x00c0, 0x159a: 0x00c0, 0x159b: 0x00c0, 0x159c: 0x00c0, 0x159d: 0x00c0, - 0x159e: 0x00c0, 0x159f: 0x00c0, 0x15a0: 0x00c0, 0x15a1: 0x00c0, 0x15a2: 0x00c0, 0x15a3: 0x00c0, - 0x15a4: 0x00c0, 0x15a5: 0x00c0, 0x15a6: 0x00c0, 0x15a7: 0x00c0, 0x15a8: 0x00c0, 0x15a9: 0x00c0, - 0x15aa: 0x00c0, 0x15ab: 0x00c0, - 0x15b0: 0x00c0, 0x15b1: 0x00c0, 0x15b2: 0x00c0, 0x15b3: 0x00c0, 0x15b4: 0x00c0, 0x15b5: 0x00c0, - 0x15b6: 0x00c0, 0x15b7: 0x00c0, 0x15b8: 0x00c0, 0x15b9: 0x00c0, 0x15ba: 0x00c0, 0x15bb: 0x00c0, - 0x15bc: 0x00c0, 0x15bd: 0x00c0, 0x15be: 0x00c0, 0x15bf: 0x00c0, - // Block 0x57, offset 0x15c0 - 0x15c0: 0x00c0, 0x15c1: 0x00c0, 0x15c2: 0x00c0, 0x15c3: 0x00c0, 0x15c4: 0x00c0, 0x15c5: 0x00c0, - 0x15c6: 0x00c0, 0x15c7: 0x00c0, 0x15c8: 0x00c0, 0x15c9: 0x00c0, - 0x15d0: 0x00c0, 0x15d1: 0x00c0, - 0x15d2: 0x00c0, 0x15d3: 0x00c0, 0x15d4: 0x00c0, 0x15d5: 0x00c0, 0x15d6: 0x00c0, 0x15d7: 0x00c0, - 0x15d8: 0x00c0, 0x15d9: 0x00c0, 0x15da: 0x0080, - 0x15de: 0x0080, 0x15df: 0x0080, 0x15e0: 0x0080, 0x15e1: 0x0080, 0x15e2: 0x0080, 0x15e3: 0x0080, - 0x15e4: 0x0080, 0x15e5: 0x0080, 0x15e6: 0x0080, 0x15e7: 0x0080, 0x15e8: 0x0080, 0x15e9: 0x0080, - 0x15ea: 0x0080, 0x15eb: 0x0080, 0x15ec: 0x0080, 0x15ed: 0x0080, 0x15ee: 0x0080, 0x15ef: 0x0080, - 0x15f0: 0x0080, 0x15f1: 0x0080, 0x15f2: 0x0080, 0x15f3: 0x0080, 0x15f4: 0x0080, 0x15f5: 0x0080, - 0x15f6: 0x0080, 0x15f7: 0x0080, 0x15f8: 0x0080, 0x15f9: 0x0080, 0x15fa: 0x0080, 0x15fb: 0x0080, - 0x15fc: 0x0080, 0x15fd: 0x0080, 0x15fe: 0x0080, 0x15ff: 0x0080, - // Block 0x58, offset 0x1600 - 0x1600: 0x00c0, 0x1601: 0x00c0, 0x1602: 0x00c0, 0x1603: 0x00c0, 0x1604: 0x00c0, 0x1605: 0x00c0, - 0x1606: 0x00c0, 0x1607: 0x00c0, 0x1608: 0x00c0, 0x1609: 0x00c0, 0x160a: 0x00c0, 0x160b: 0x00c0, - 0x160c: 0x00c0, 0x160d: 0x00c0, 0x160e: 0x00c0, 0x160f: 0x00c0, 0x1610: 0x00c0, 0x1611: 0x00c0, - 0x1612: 0x00c0, 0x1613: 0x00c0, 0x1614: 0x00c0, 0x1615: 0x00c0, 0x1616: 0x00c0, 0x1617: 0x00c3, - 0x1618: 0x00c3, 0x1619: 0x00c0, 0x161a: 0x00c0, 0x161b: 0x00c3, - 0x161e: 0x0080, 0x161f: 0x0080, 0x1620: 0x00c0, 0x1621: 0x00c0, 0x1622: 0x00c0, 0x1623: 0x00c0, - 0x1624: 0x00c0, 0x1625: 0x00c0, 0x1626: 0x00c0, 0x1627: 0x00c0, 0x1628: 0x00c0, 0x1629: 0x00c0, - 0x162a: 0x00c0, 0x162b: 0x00c0, 0x162c: 0x00c0, 0x162d: 0x00c0, 0x162e: 0x00c0, 0x162f: 0x00c0, - 0x1630: 0x00c0, 0x1631: 0x00c0, 0x1632: 0x00c0, 0x1633: 0x00c0, 0x1634: 0x00c0, 0x1635: 0x00c0, - 0x1636: 0x00c0, 0x1637: 0x00c0, 0x1638: 0x00c0, 0x1639: 0x00c0, 0x163a: 0x00c0, 0x163b: 0x00c0, - 0x163c: 0x00c0, 0x163d: 0x00c0, 0x163e: 0x00c0, 0x163f: 0x00c0, - // Block 0x59, offset 0x1640 - 0x1640: 0x00c0, 0x1641: 0x00c0, 0x1642: 0x00c0, 0x1643: 0x00c0, 0x1644: 0x00c0, 0x1645: 0x00c0, - 0x1646: 0x00c0, 0x1647: 0x00c0, 0x1648: 0x00c0, 0x1649: 0x00c0, 0x164a: 0x00c0, 0x164b: 0x00c0, - 0x164c: 0x00c0, 0x164d: 0x00c0, 0x164e: 0x00c0, 0x164f: 0x00c0, 0x1650: 0x00c0, 0x1651: 0x00c0, - 0x1652: 0x00c0, 0x1653: 0x00c0, 0x1654: 0x00c0, 0x1655: 0x00c0, 0x1656: 0x00c3, 0x1657: 0x00c0, - 0x1658: 0x00c3, 0x1659: 0x00c3, 0x165a: 0x00c3, 0x165b: 0x00c3, 0x165c: 0x00c3, 0x165d: 0x00c3, - 0x165e: 0x00c3, 0x1660: 0x00c6, 0x1661: 0x00c0, 0x1662: 0x00c3, 0x1663: 0x00c0, - 0x1664: 0x00c0, 0x1665: 0x00c3, 0x1666: 0x00c3, 0x1667: 0x00c3, 0x1668: 0x00c3, 0x1669: 0x00c3, - 0x166a: 0x00c3, 0x166b: 0x00c3, 0x166c: 0x00c3, 0x166d: 0x00c0, 0x166e: 0x00c0, 0x166f: 0x00c0, - 0x1670: 0x00c0, 0x1671: 0x00c0, 0x1672: 0x00c0, 0x1673: 0x00c3, 0x1674: 0x00c3, 0x1675: 0x00c3, - 0x1676: 0x00c3, 0x1677: 0x00c3, 0x1678: 0x00c3, 0x1679: 0x00c3, 0x167a: 0x00c3, 0x167b: 0x00c3, - 0x167c: 0x00c3, 0x167f: 0x00c3, - // Block 0x5a, offset 0x1680 - 0x1680: 0x00c0, 0x1681: 0x00c0, 0x1682: 0x00c0, 0x1683: 0x00c0, 0x1684: 0x00c0, 0x1685: 0x00c0, - 0x1686: 0x00c0, 0x1687: 0x00c0, 0x1688: 0x00c0, 0x1689: 0x00c0, - 0x1690: 0x00c0, 0x1691: 0x00c0, - 0x1692: 0x00c0, 0x1693: 0x00c0, 0x1694: 0x00c0, 0x1695: 0x00c0, 0x1696: 0x00c0, 0x1697: 0x00c0, - 0x1698: 0x00c0, 0x1699: 0x00c0, - 0x16a0: 0x0080, 0x16a1: 0x0080, 0x16a2: 0x0080, 0x16a3: 0x0080, - 0x16a4: 0x0080, 0x16a5: 0x0080, 0x16a6: 0x0080, 0x16a7: 0x00c0, 0x16a8: 0x0080, 0x16a9: 0x0080, - 0x16aa: 0x0080, 0x16ab: 0x0080, 0x16ac: 0x0080, 0x16ad: 0x0080, - 0x16b0: 0x00c3, 0x16b1: 0x00c3, 0x16b2: 0x00c3, 0x16b3: 0x00c3, 0x16b4: 0x00c3, 0x16b5: 0x00c3, - 0x16b6: 0x00c3, 0x16b7: 0x00c3, 0x16b8: 0x00c3, 0x16b9: 0x00c3, 0x16ba: 0x00c3, 0x16bb: 0x00c3, - 0x16bc: 0x00c3, 0x16bd: 0x00c3, 0x16be: 0x0083, - // Block 0x5b, offset 0x16c0 - 0x16c0: 0x00c3, 0x16c1: 0x00c3, 0x16c2: 0x00c3, 0x16c3: 0x00c3, 0x16c4: 0x00c0, 0x16c5: 0x00c0, - 0x16c6: 0x00c0, 0x16c7: 0x00c0, 0x16c8: 0x00c0, 0x16c9: 0x00c0, 0x16ca: 0x00c0, 0x16cb: 0x00c0, - 0x16cc: 0x00c0, 0x16cd: 0x00c0, 0x16ce: 0x00c0, 0x16cf: 0x00c0, 0x16d0: 0x00c0, 0x16d1: 0x00c0, - 0x16d2: 0x00c0, 0x16d3: 0x00c0, 0x16d4: 0x00c0, 0x16d5: 0x00c0, 0x16d6: 0x00c0, 0x16d7: 0x00c0, - 0x16d8: 0x00c0, 0x16d9: 0x00c0, 0x16da: 0x00c0, 0x16db: 0x00c0, 0x16dc: 0x00c0, 0x16dd: 0x00c0, - 0x16de: 0x00c0, 0x16df: 0x00c0, 0x16e0: 0x00c0, 0x16e1: 0x00c0, 0x16e2: 0x00c0, 0x16e3: 0x00c0, - 0x16e4: 0x00c0, 0x16e5: 0x00c0, 0x16e6: 0x00c0, 0x16e7: 0x00c0, 0x16e8: 0x00c0, 0x16e9: 0x00c0, - 0x16ea: 0x00c0, 0x16eb: 0x00c0, 0x16ec: 0x00c0, 0x16ed: 0x00c0, 0x16ee: 0x00c0, 0x16ef: 0x00c0, - 0x16f0: 0x00c0, 0x16f1: 0x00c0, 0x16f2: 0x00c0, 0x16f3: 0x00c0, 0x16f4: 0x00c3, 0x16f5: 0x00c0, - 0x16f6: 0x00c3, 0x16f7: 0x00c3, 0x16f8: 0x00c3, 0x16f9: 0x00c3, 0x16fa: 0x00c3, 0x16fb: 0x00c0, - 0x16fc: 0x00c3, 0x16fd: 0x00c0, 0x16fe: 0x00c0, 0x16ff: 0x00c0, - // Block 0x5c, offset 0x1700 - 0x1700: 0x00c0, 0x1701: 0x00c0, 0x1702: 0x00c3, 0x1703: 0x00c0, 0x1704: 0x00c5, 0x1705: 0x00c0, - 0x1706: 0x00c0, 0x1707: 0x00c0, 0x1708: 0x00c0, 0x1709: 0x00c0, 0x170a: 0x00c0, 0x170b: 0x00c0, - 0x1710: 0x00c0, 0x1711: 0x00c0, - 0x1712: 0x00c0, 0x1713: 0x00c0, 0x1714: 0x00c0, 0x1715: 0x00c0, 0x1716: 0x00c0, 0x1717: 0x00c0, - 0x1718: 0x00c0, 0x1719: 0x00c0, 0x171a: 0x0080, 0x171b: 0x0080, 0x171c: 0x0080, 0x171d: 0x0080, - 0x171e: 0x0080, 0x171f: 0x0080, 0x1720: 0x0080, 0x1721: 0x0080, 0x1722: 0x0080, 0x1723: 0x0080, - 0x1724: 0x0080, 0x1725: 0x0080, 0x1726: 0x0080, 0x1727: 0x0080, 0x1728: 0x0080, 0x1729: 0x0080, - 0x172a: 0x0080, 0x172b: 0x00c3, 0x172c: 0x00c3, 0x172d: 0x00c3, 0x172e: 0x00c3, 0x172f: 0x00c3, - 0x1730: 0x00c3, 0x1731: 0x00c3, 0x1732: 0x00c3, 0x1733: 0x00c3, 0x1734: 0x0080, 0x1735: 0x0080, - 0x1736: 0x0080, 0x1737: 0x0080, 0x1738: 0x0080, 0x1739: 0x0080, 0x173a: 0x0080, 0x173b: 0x0080, - 0x173c: 0x0080, - // Block 0x5d, offset 0x1740 - 0x1740: 0x00c3, 0x1741: 0x00c3, 0x1742: 0x00c0, 0x1743: 0x00c0, 0x1744: 0x00c0, 0x1745: 0x00c0, - 0x1746: 0x00c0, 0x1747: 0x00c0, 0x1748: 0x00c0, 0x1749: 0x00c0, 0x174a: 0x00c0, 0x174b: 0x00c0, - 0x174c: 0x00c0, 0x174d: 0x00c0, 0x174e: 0x00c0, 0x174f: 0x00c0, 0x1750: 0x00c0, 0x1751: 0x00c0, - 0x1752: 0x00c0, 0x1753: 0x00c0, 0x1754: 0x00c0, 0x1755: 0x00c0, 0x1756: 0x00c0, 0x1757: 0x00c0, - 0x1758: 0x00c0, 0x1759: 0x00c0, 0x175a: 0x00c0, 0x175b: 0x00c0, 0x175c: 0x00c0, 0x175d: 0x00c0, - 0x175e: 0x00c0, 0x175f: 0x00c0, 0x1760: 0x00c0, 0x1761: 0x00c0, 0x1762: 0x00c3, 0x1763: 0x00c3, - 0x1764: 0x00c3, 0x1765: 0x00c3, 0x1766: 0x00c0, 0x1767: 0x00c0, 0x1768: 0x00c3, 0x1769: 0x00c3, - 0x176a: 0x00c5, 0x176b: 0x00c6, 0x176c: 0x00c3, 0x176d: 0x00c3, 0x176e: 0x00c0, 0x176f: 0x00c0, - 0x1770: 0x00c0, 0x1771: 0x00c0, 0x1772: 0x00c0, 0x1773: 0x00c0, 0x1774: 0x00c0, 0x1775: 0x00c0, - 0x1776: 0x00c0, 0x1777: 0x00c0, 0x1778: 0x00c0, 0x1779: 0x00c0, 0x177a: 0x00c0, 0x177b: 0x00c0, - 0x177c: 0x00c0, 0x177d: 0x00c0, 0x177e: 0x00c0, 0x177f: 0x00c0, - // Block 0x5e, offset 0x1780 - 0x1780: 0x00c0, 0x1781: 0x00c0, 0x1782: 0x00c0, 0x1783: 0x00c0, 0x1784: 0x00c0, 0x1785: 0x00c0, - 0x1786: 0x00c0, 0x1787: 0x00c0, 0x1788: 0x00c0, 0x1789: 0x00c0, 0x178a: 0x00c0, 0x178b: 0x00c0, - 0x178c: 0x00c0, 0x178d: 0x00c0, 0x178e: 0x00c0, 0x178f: 0x00c0, 0x1790: 0x00c0, 0x1791: 0x00c0, - 0x1792: 0x00c0, 0x1793: 0x00c0, 0x1794: 0x00c0, 0x1795: 0x00c0, 0x1796: 0x00c0, 0x1797: 0x00c0, - 0x1798: 0x00c0, 0x1799: 0x00c0, 0x179a: 0x00c0, 0x179b: 0x00c0, 0x179c: 0x00c0, 0x179d: 0x00c0, - 0x179e: 0x00c0, 0x179f: 0x00c0, 0x17a0: 0x00c0, 0x17a1: 0x00c0, 0x17a2: 0x00c0, 0x17a3: 0x00c0, - 0x17a4: 0x00c0, 0x17a5: 0x00c0, 0x17a6: 0x00c3, 0x17a7: 0x00c0, 0x17a8: 0x00c3, 0x17a9: 0x00c3, - 0x17aa: 0x00c0, 0x17ab: 0x00c0, 0x17ac: 0x00c0, 0x17ad: 0x00c3, 0x17ae: 0x00c0, 0x17af: 0x00c3, - 0x17b0: 0x00c3, 0x17b1: 0x00c3, 0x17b2: 0x00c5, 0x17b3: 0x00c5, - 0x17bc: 0x0080, 0x17bd: 0x0080, 0x17be: 0x0080, 0x17bf: 0x0080, - // Block 0x5f, offset 0x17c0 - 0x17c0: 0x00c0, 0x17c1: 0x00c0, 0x17c2: 0x00c0, 0x17c3: 0x00c0, 0x17c4: 0x00c0, 0x17c5: 0x00c0, - 0x17c6: 0x00c0, 0x17c7: 0x00c0, 0x17c8: 0x00c0, 0x17c9: 0x00c0, 0x17ca: 0x00c0, 0x17cb: 0x00c0, - 0x17cc: 0x00c0, 0x17cd: 0x00c0, 0x17ce: 0x00c0, 0x17cf: 0x00c0, 0x17d0: 0x00c0, 0x17d1: 0x00c0, - 0x17d2: 0x00c0, 0x17d3: 0x00c0, 0x17d4: 0x00c0, 0x17d5: 0x00c0, 0x17d6: 0x00c0, 0x17d7: 0x00c0, - 0x17d8: 0x00c0, 0x17d9: 0x00c0, 0x17da: 0x00c0, 0x17db: 0x00c0, 0x17dc: 0x00c0, 0x17dd: 0x00c0, - 0x17de: 0x00c0, 0x17df: 0x00c0, 0x17e0: 0x00c0, 0x17e1: 0x00c0, 0x17e2: 0x00c0, 0x17e3: 0x00c0, - 0x17e4: 0x00c0, 0x17e5: 0x00c0, 0x17e6: 0x00c0, 0x17e7: 0x00c0, 0x17e8: 0x00c0, 0x17e9: 0x00c0, - 0x17ea: 0x00c0, 0x17eb: 0x00c0, 0x17ec: 0x00c3, 0x17ed: 0x00c3, 0x17ee: 0x00c3, 0x17ef: 0x00c3, - 0x17f0: 0x00c3, 0x17f1: 0x00c3, 0x17f2: 0x00c3, 0x17f3: 0x00c3, 0x17f4: 0x00c0, 0x17f5: 0x00c0, - 0x17f6: 0x00c3, 0x17f7: 0x00c3, 0x17fb: 0x0080, - 0x17fc: 0x0080, 0x17fd: 0x0080, 0x17fe: 0x0080, 0x17ff: 0x0080, - // Block 0x60, offset 0x1800 - 0x1800: 0x00c0, 0x1801: 0x00c0, 0x1802: 0x00c0, 0x1803: 0x00c0, 0x1804: 0x00c0, 0x1805: 0x00c0, - 0x1806: 0x00c0, 0x1807: 0x00c0, 0x1808: 0x00c0, 0x1809: 0x00c0, - 0x180d: 0x00c0, 0x180e: 0x00c0, 0x180f: 0x00c0, 0x1810: 0x00c0, 0x1811: 0x00c0, - 0x1812: 0x00c0, 0x1813: 0x00c0, 0x1814: 0x00c0, 0x1815: 0x00c0, 0x1816: 0x00c0, 0x1817: 0x00c0, - 0x1818: 0x00c0, 0x1819: 0x00c0, 0x181a: 0x00c0, 0x181b: 0x00c0, 0x181c: 0x00c0, 0x181d: 0x00c0, - 0x181e: 0x00c0, 0x181f: 0x00c0, 0x1820: 0x00c0, 0x1821: 0x00c0, 0x1822: 0x00c0, 0x1823: 0x00c0, - 0x1824: 0x00c0, 0x1825: 0x00c0, 0x1826: 0x00c0, 0x1827: 0x00c0, 0x1828: 0x00c0, 0x1829: 0x00c0, - 0x182a: 0x00c0, 0x182b: 0x00c0, 0x182c: 0x00c0, 0x182d: 0x00c0, 0x182e: 0x00c0, 0x182f: 0x00c0, - 0x1830: 0x00c0, 0x1831: 0x00c0, 0x1832: 0x00c0, 0x1833: 0x00c0, 0x1834: 0x00c0, 0x1835: 0x00c0, - 0x1836: 0x00c0, 0x1837: 0x00c0, 0x1838: 0x00c0, 0x1839: 0x00c0, 0x183a: 0x00c0, 0x183b: 0x00c0, - 0x183c: 0x00c0, 0x183d: 0x00c0, 0x183e: 0x0080, 0x183f: 0x0080, - // Block 0x61, offset 0x1840 - 0x1840: 0x00c0, 0x1841: 0x00c0, 0x1842: 0x00c0, 0x1843: 0x00c0, 0x1844: 0x00c0, 0x1845: 0x00c0, - 0x1846: 0x00c0, 0x1847: 0x00c0, 0x1848: 0x00c0, - // Block 0x62, offset 0x1880 - 0x1880: 0x0080, 0x1881: 0x0080, 0x1882: 0x0080, 0x1883: 0x0080, 0x1884: 0x0080, 0x1885: 0x0080, - 0x1886: 0x0080, 0x1887: 0x0080, - 0x1890: 0x00c3, 0x1891: 0x00c3, - 0x1892: 0x00c3, 0x1893: 0x0080, 0x1894: 0x00c3, 0x1895: 0x00c3, 0x1896: 0x00c3, 0x1897: 0x00c3, - 0x1898: 0x00c3, 0x1899: 0x00c3, 0x189a: 0x00c3, 0x189b: 0x00c3, 0x189c: 0x00c3, 0x189d: 0x00c3, - 0x189e: 0x00c3, 0x189f: 0x00c3, 0x18a0: 0x00c3, 0x18a1: 0x00c0, 0x18a2: 0x00c3, 0x18a3: 0x00c3, - 0x18a4: 0x00c3, 0x18a5: 0x00c3, 0x18a6: 0x00c3, 0x18a7: 0x00c3, 0x18a8: 0x00c3, 0x18a9: 0x00c0, - 0x18aa: 0x00c0, 0x18ab: 0x00c0, 0x18ac: 0x00c0, 0x18ad: 0x00c3, 0x18ae: 0x00c0, 0x18af: 0x00c0, - 0x18b0: 0x00c0, 0x18b1: 0x00c0, 0x18b2: 0x00c0, 0x18b3: 0x00c0, 0x18b4: 0x00c3, 0x18b5: 0x00c0, - 0x18b6: 0x00c0, 0x18b8: 0x00c3, 0x18b9: 0x00c3, - // Block 0x63, offset 0x18c0 - 0x18c0: 0x00c0, 0x18c1: 0x00c0, 0x18c2: 0x00c0, 0x18c3: 0x00c0, 0x18c4: 0x00c0, 0x18c5: 0x00c0, - 0x18c6: 0x00c0, 0x18c7: 0x00c0, 0x18c8: 0x00c0, 0x18c9: 0x00c0, 0x18ca: 0x00c0, 0x18cb: 0x00c0, - 0x18cc: 0x00c0, 0x18cd: 0x00c0, 0x18ce: 0x00c0, 0x18cf: 0x00c0, 0x18d0: 0x00c0, 0x18d1: 0x00c0, - 0x18d2: 0x00c0, 0x18d3: 0x00c0, 0x18d4: 0x00c0, 0x18d5: 0x00c0, 0x18d6: 0x00c0, 0x18d7: 0x00c0, - 0x18d8: 0x00c0, 0x18d9: 0x00c0, 0x18da: 0x00c0, 0x18db: 0x00c0, 0x18dc: 0x00c0, 0x18dd: 0x00c0, - 0x18de: 0x00c0, 0x18df: 0x00c0, 0x18e0: 0x00c0, 0x18e1: 0x00c0, 0x18e2: 0x00c0, 0x18e3: 0x00c0, - 0x18e4: 0x00c0, 0x18e5: 0x00c0, 0x18e6: 0x00c8, 0x18e7: 0x00c8, 0x18e8: 0x00c8, 0x18e9: 0x00c8, - 0x18ea: 0x00c8, 0x18eb: 0x00c0, 0x18ec: 0x0080, 0x18ed: 0x0080, 0x18ee: 0x0080, 0x18ef: 0x00c0, - 0x18f0: 0x0080, 0x18f1: 0x0080, 0x18f2: 0x0080, 0x18f3: 0x0080, 0x18f4: 0x0080, 0x18f5: 0x0080, - 0x18f6: 0x0080, 0x18f7: 0x0080, 0x18f8: 0x0080, 0x18f9: 0x0080, 0x18fa: 0x0080, 0x18fb: 0x00c0, - 0x18fc: 0x0080, 0x18fd: 0x0080, 0x18fe: 0x0080, 0x18ff: 0x0080, - // Block 0x64, offset 0x1900 - 0x1900: 0x0080, 0x1901: 0x0080, 0x1902: 0x0080, 0x1903: 0x0080, 0x1904: 0x0080, 0x1905: 0x0080, - 0x1906: 0x0080, 0x1907: 0x0080, 0x1908: 0x0080, 0x1909: 0x0080, 0x190a: 0x0080, 0x190b: 0x0080, - 0x190c: 0x0080, 0x190d: 0x0080, 0x190e: 0x00c0, 0x190f: 0x0080, 0x1910: 0x0080, 0x1911: 0x0080, - 0x1912: 0x0080, 0x1913: 0x0080, 0x1914: 0x0080, 0x1915: 0x0080, 0x1916: 0x0080, 0x1917: 0x0080, - 0x1918: 0x0080, 0x1919: 0x0080, 0x191a: 0x0080, 0x191b: 0x0080, 0x191c: 0x0080, 0x191d: 0x0088, - 0x191e: 0x0088, 0x191f: 0x0088, 0x1920: 0x0088, 0x1921: 0x0088, 0x1922: 0x0080, 0x1923: 0x0080, - 0x1924: 0x0080, 0x1925: 0x0080, 0x1926: 0x0088, 0x1927: 0x0088, 0x1928: 0x0088, 0x1929: 0x0088, - 0x192a: 0x0088, 0x192b: 0x00c0, 0x192c: 0x00c0, 0x192d: 0x00c0, 0x192e: 0x00c0, 0x192f: 0x00c0, - 0x1930: 0x00c0, 0x1931: 0x00c0, 0x1932: 0x00c0, 0x1933: 0x00c0, 0x1934: 0x00c0, 0x1935: 0x00c0, - 0x1936: 0x00c0, 0x1937: 0x00c0, 0x1938: 0x0080, 0x1939: 0x00c0, 0x193a: 0x00c0, 0x193b: 0x00c0, - 0x193c: 0x00c0, 0x193d: 0x00c0, 0x193e: 0x00c0, 0x193f: 0x00c0, - // Block 0x65, offset 0x1940 - 0x1940: 0x00c0, 0x1941: 0x00c0, 0x1942: 0x00c0, 0x1943: 0x00c0, 0x1944: 0x00c0, 0x1945: 0x00c0, - 0x1946: 0x00c0, 0x1947: 0x00c0, 0x1948: 0x00c0, 0x1949: 0x00c0, 0x194a: 0x00c0, 0x194b: 0x00c0, - 0x194c: 0x00c0, 0x194d: 0x00c0, 0x194e: 0x00c0, 0x194f: 0x00c0, 0x1950: 0x00c0, 0x1951: 0x00c0, - 0x1952: 0x00c0, 0x1953: 0x00c0, 0x1954: 0x00c0, 0x1955: 0x00c0, 0x1956: 0x00c0, 0x1957: 0x00c0, - 0x1958: 0x00c0, 0x1959: 0x00c0, 0x195a: 0x00c0, 0x195b: 0x0080, 0x195c: 0x0080, 0x195d: 0x0080, - 0x195e: 0x0080, 0x195f: 0x0080, 0x1960: 0x0080, 0x1961: 0x0080, 0x1962: 0x0080, 0x1963: 0x0080, - 0x1964: 0x0080, 0x1965: 0x0080, 0x1966: 0x0080, 0x1967: 0x0080, 0x1968: 0x0080, 0x1969: 0x0080, - 0x196a: 0x0080, 0x196b: 0x0080, 0x196c: 0x0080, 0x196d: 0x0080, 0x196e: 0x0080, 0x196f: 0x0080, - 0x1970: 0x0080, 0x1971: 0x0080, 0x1972: 0x0080, 0x1973: 0x0080, 0x1974: 0x0080, 0x1975: 0x0080, - 0x1976: 0x0080, 0x1977: 0x0080, 0x1978: 0x0080, 0x1979: 0x0080, 0x197a: 0x0080, 0x197b: 0x0080, - 0x197c: 0x0080, 0x197d: 0x0080, 0x197e: 0x0080, 0x197f: 0x0088, - // Block 0x66, offset 0x1980 - 0x1980: 0x00c3, 0x1981: 0x00c3, 0x1982: 0x00c3, 0x1983: 0x00c3, 0x1984: 0x00c3, 0x1985: 0x00c3, - 0x1986: 0x00c3, 0x1987: 0x00c3, 0x1988: 0x00c3, 0x1989: 0x00c3, 0x198a: 0x00c3, 0x198b: 0x00c3, - 0x198c: 0x00c3, 0x198d: 0x00c3, 0x198e: 0x00c3, 0x198f: 0x00c3, 0x1990: 0x00c3, 0x1991: 0x00c3, - 0x1992: 0x00c3, 0x1993: 0x00c3, 0x1994: 0x00c3, 0x1995: 0x00c3, 0x1996: 0x00c3, 0x1997: 0x00c3, - 0x1998: 0x00c3, 0x1999: 0x00c3, 0x199a: 0x00c3, 0x199b: 0x00c3, 0x199c: 0x00c3, 0x199d: 0x00c3, - 0x199e: 0x00c3, 0x199f: 0x00c3, 0x19a0: 0x00c3, 0x19a1: 0x00c3, 0x19a2: 0x00c3, 0x19a3: 0x00c3, - 0x19a4: 0x00c3, 0x19a5: 0x00c3, 0x19a6: 0x00c3, 0x19a7: 0x00c3, 0x19a8: 0x00c3, 0x19a9: 0x00c3, - 0x19aa: 0x00c3, 0x19ab: 0x00c3, 0x19ac: 0x00c3, 0x19ad: 0x00c3, 0x19ae: 0x00c3, 0x19af: 0x00c3, - 0x19b0: 0x00c3, 0x19b1: 0x00c3, 0x19b2: 0x00c3, 0x19b3: 0x00c3, 0x19b4: 0x00c3, 0x19b5: 0x00c3, - 0x19bb: 0x00c3, - 0x19bc: 0x00c3, 0x19bd: 0x00c3, 0x19be: 0x00c3, 0x19bf: 0x00c3, - // Block 0x67, offset 0x19c0 - 0x19c0: 0x00c0, 0x19c1: 0x00c0, 0x19c2: 0x00c0, 0x19c3: 0x00c0, 0x19c4: 0x00c0, 0x19c5: 0x00c0, - 0x19c6: 0x00c0, 0x19c7: 0x00c0, 0x19c8: 0x00c0, 0x19c9: 0x00c0, 0x19ca: 0x00c0, 0x19cb: 0x00c0, - 0x19cc: 0x00c0, 0x19cd: 0x00c0, 0x19ce: 0x00c0, 0x19cf: 0x00c0, 0x19d0: 0x00c0, 0x19d1: 0x00c0, - 0x19d2: 0x00c0, 0x19d3: 0x00c0, 0x19d4: 0x00c0, 0x19d5: 0x00c0, 0x19d6: 0x00c0, 0x19d7: 0x00c0, - 0x19d8: 0x00c0, 0x19d9: 0x00c0, 0x19da: 0x0080, 0x19db: 0x0080, 0x19dc: 0x00c0, 0x19dd: 0x00c0, - 0x19de: 0x00c0, 0x19df: 0x00c0, 0x19e0: 0x00c0, 0x19e1: 0x00c0, 0x19e2: 0x00c0, 0x19e3: 0x00c0, - 0x19e4: 0x00c0, 0x19e5: 0x00c0, 0x19e6: 0x00c0, 0x19e7: 0x00c0, 0x19e8: 0x00c0, 0x19e9: 0x00c0, - 0x19ea: 0x00c0, 0x19eb: 0x00c0, 0x19ec: 0x00c0, 0x19ed: 0x00c0, 0x19ee: 0x00c0, 0x19ef: 0x00c0, - 0x19f0: 0x00c0, 0x19f1: 0x00c0, 0x19f2: 0x00c0, 0x19f3: 0x00c0, 0x19f4: 0x00c0, 0x19f5: 0x00c0, - 0x19f6: 0x00c0, 0x19f7: 0x00c0, 0x19f8: 0x00c0, 0x19f9: 0x00c0, 0x19fa: 0x00c0, 0x19fb: 0x00c0, - 0x19fc: 0x00c0, 0x19fd: 0x00c0, 0x19fe: 0x00c0, 0x19ff: 0x00c0, - // Block 0x68, offset 0x1a00 - 0x1a00: 0x00c8, 0x1a01: 0x00c8, 0x1a02: 0x00c8, 0x1a03: 0x00c8, 0x1a04: 0x00c8, 0x1a05: 0x00c8, - 0x1a06: 0x00c8, 0x1a07: 0x00c8, 0x1a08: 0x00c8, 0x1a09: 0x00c8, 0x1a0a: 0x00c8, 0x1a0b: 0x00c8, - 0x1a0c: 0x00c8, 0x1a0d: 0x00c8, 0x1a0e: 0x00c8, 0x1a0f: 0x00c8, 0x1a10: 0x00c8, 0x1a11: 0x00c8, - 0x1a12: 0x00c8, 0x1a13: 0x00c8, 0x1a14: 0x00c8, 0x1a15: 0x00c8, - 0x1a18: 0x00c8, 0x1a19: 0x00c8, 0x1a1a: 0x00c8, 0x1a1b: 0x00c8, 0x1a1c: 0x00c8, 0x1a1d: 0x00c8, - 0x1a20: 0x00c8, 0x1a21: 0x00c8, 0x1a22: 0x00c8, 0x1a23: 0x00c8, - 0x1a24: 0x00c8, 0x1a25: 0x00c8, 0x1a26: 0x00c8, 0x1a27: 0x00c8, 0x1a28: 0x00c8, 0x1a29: 0x00c8, - 0x1a2a: 0x00c8, 0x1a2b: 0x00c8, 0x1a2c: 0x00c8, 0x1a2d: 0x00c8, 0x1a2e: 0x00c8, 0x1a2f: 0x00c8, - 0x1a30: 0x00c8, 0x1a31: 0x00c8, 0x1a32: 0x00c8, 0x1a33: 0x00c8, 0x1a34: 0x00c8, 0x1a35: 0x00c8, - 0x1a36: 0x00c8, 0x1a37: 0x00c8, 0x1a38: 0x00c8, 0x1a39: 0x00c8, 0x1a3a: 0x00c8, 0x1a3b: 0x00c8, - 0x1a3c: 0x00c8, 0x1a3d: 0x00c8, 0x1a3e: 0x00c8, 0x1a3f: 0x00c8, - // Block 0x69, offset 0x1a40 - 0x1a40: 0x00c8, 0x1a41: 0x00c8, 0x1a42: 0x00c8, 0x1a43: 0x00c8, 0x1a44: 0x00c8, 0x1a45: 0x00c8, - 0x1a48: 0x00c8, 0x1a49: 0x00c8, 0x1a4a: 0x00c8, 0x1a4b: 0x00c8, - 0x1a4c: 0x00c8, 0x1a4d: 0x00c8, 0x1a50: 0x00c8, 0x1a51: 0x00c8, - 0x1a52: 0x00c8, 0x1a53: 0x00c8, 0x1a54: 0x00c8, 0x1a55: 0x00c8, 0x1a56: 0x00c8, 0x1a57: 0x00c8, - 0x1a59: 0x00c8, 0x1a5b: 0x00c8, 0x1a5d: 0x00c8, - 0x1a5f: 0x00c8, 0x1a60: 0x00c8, 0x1a61: 0x00c8, 0x1a62: 0x00c8, 0x1a63: 0x00c8, - 0x1a64: 0x00c8, 0x1a65: 0x00c8, 0x1a66: 0x00c8, 0x1a67: 0x00c8, 0x1a68: 0x00c8, 0x1a69: 0x00c8, - 0x1a6a: 0x00c8, 0x1a6b: 0x00c8, 0x1a6c: 0x00c8, 0x1a6d: 0x00c8, 0x1a6e: 0x00c8, 0x1a6f: 0x00c8, - 0x1a70: 0x00c8, 0x1a71: 0x0088, 0x1a72: 0x00c8, 0x1a73: 0x0088, 0x1a74: 0x00c8, 0x1a75: 0x0088, - 0x1a76: 0x00c8, 0x1a77: 0x0088, 0x1a78: 0x00c8, 0x1a79: 0x0088, 0x1a7a: 0x00c8, 0x1a7b: 0x0088, - 0x1a7c: 0x00c8, 0x1a7d: 0x0088, - // Block 0x6a, offset 0x1a80 - 0x1a80: 0x00c8, 0x1a81: 0x00c8, 0x1a82: 0x00c8, 0x1a83: 0x00c8, 0x1a84: 0x00c8, 0x1a85: 0x00c8, - 0x1a86: 0x00c8, 0x1a87: 0x00c8, 0x1a88: 0x0088, 0x1a89: 0x0088, 0x1a8a: 0x0088, 0x1a8b: 0x0088, - 0x1a8c: 0x0088, 0x1a8d: 0x0088, 0x1a8e: 0x0088, 0x1a8f: 0x0088, 0x1a90: 0x00c8, 0x1a91: 0x00c8, - 0x1a92: 0x00c8, 0x1a93: 0x00c8, 0x1a94: 0x00c8, 0x1a95: 0x00c8, 0x1a96: 0x00c8, 0x1a97: 0x00c8, - 0x1a98: 0x0088, 0x1a99: 0x0088, 0x1a9a: 0x0088, 0x1a9b: 0x0088, 0x1a9c: 0x0088, 0x1a9d: 0x0088, - 0x1a9e: 0x0088, 0x1a9f: 0x0088, 0x1aa0: 0x00c8, 0x1aa1: 0x00c8, 0x1aa2: 0x00c8, 0x1aa3: 0x00c8, - 0x1aa4: 0x00c8, 0x1aa5: 0x00c8, 0x1aa6: 0x00c8, 0x1aa7: 0x00c8, 0x1aa8: 0x0088, 0x1aa9: 0x0088, - 0x1aaa: 0x0088, 0x1aab: 0x0088, 0x1aac: 0x0088, 0x1aad: 0x0088, 0x1aae: 0x0088, 0x1aaf: 0x0088, - 0x1ab0: 0x00c8, 0x1ab1: 0x00c8, 0x1ab2: 0x00c8, 0x1ab3: 0x00c8, 0x1ab4: 0x00c8, - 0x1ab6: 0x00c8, 0x1ab7: 0x00c8, 0x1ab8: 0x00c8, 0x1ab9: 0x00c8, 0x1aba: 0x00c8, 0x1abb: 0x0088, - 0x1abc: 0x0088, 0x1abd: 0x0088, 0x1abe: 0x0088, 0x1abf: 0x0088, - // Block 0x6b, offset 0x1ac0 - 0x1ac0: 0x0088, 0x1ac1: 0x0088, 0x1ac2: 0x00c8, 0x1ac3: 0x00c8, 0x1ac4: 0x00c8, - 0x1ac6: 0x00c8, 0x1ac7: 0x00c8, 0x1ac8: 0x00c8, 0x1ac9: 0x0088, 0x1aca: 0x00c8, 0x1acb: 0x0088, - 0x1acc: 0x0088, 0x1acd: 0x0088, 0x1ace: 0x0088, 0x1acf: 0x0088, 0x1ad0: 0x00c8, 0x1ad1: 0x00c8, - 0x1ad2: 0x00c8, 0x1ad3: 0x0088, 0x1ad6: 0x00c8, 0x1ad7: 0x00c8, - 0x1ad8: 0x00c8, 0x1ad9: 0x00c8, 0x1ada: 0x00c8, 0x1adb: 0x0088, 0x1add: 0x0088, - 0x1ade: 0x0088, 0x1adf: 0x0088, 0x1ae0: 0x00c8, 0x1ae1: 0x00c8, 0x1ae2: 0x00c8, 0x1ae3: 0x0088, - 0x1ae4: 0x00c8, 0x1ae5: 0x00c8, 0x1ae6: 0x00c8, 0x1ae7: 0x00c8, 0x1ae8: 0x00c8, 0x1ae9: 0x00c8, - 0x1aea: 0x00c8, 0x1aeb: 0x0088, 0x1aec: 0x00c8, 0x1aed: 0x0088, 0x1aee: 0x0088, 0x1aef: 0x0088, - 0x1af2: 0x00c8, 0x1af3: 0x00c8, 0x1af4: 0x00c8, - 0x1af6: 0x00c8, 0x1af7: 0x00c8, 0x1af8: 0x00c8, 0x1af9: 0x0088, 0x1afa: 0x00c8, 0x1afb: 0x0088, - 0x1afc: 0x0088, 0x1afd: 0x0088, 0x1afe: 0x0088, - // Block 0x6c, offset 0x1b00 - 0x1b00: 0x0080, 0x1b01: 0x0080, 0x1b02: 0x0080, 0x1b03: 0x0080, 0x1b04: 0x0080, 0x1b05: 0x0080, - 0x1b06: 0x0080, 0x1b07: 0x0080, 0x1b08: 0x0080, 0x1b09: 0x0080, 0x1b0a: 0x0080, 0x1b0b: 0x0040, - 0x1b0c: 0x004d, 0x1b0d: 0x004e, 0x1b0e: 0x0040, 0x1b0f: 0x0040, 0x1b10: 0x0080, 0x1b11: 0x0080, - 0x1b12: 0x0080, 0x1b13: 0x0080, 0x1b14: 0x0080, 0x1b15: 0x0080, 0x1b16: 0x0080, 0x1b17: 0x0080, - 0x1b18: 0x0080, 0x1b19: 0x0080, 0x1b1a: 0x0080, 0x1b1b: 0x0080, 0x1b1c: 0x0080, 0x1b1d: 0x0080, - 0x1b1e: 0x0080, 0x1b1f: 0x0080, 0x1b20: 0x0080, 0x1b21: 0x0080, 0x1b22: 0x0080, 0x1b23: 0x0080, - 0x1b24: 0x0080, 0x1b25: 0x0080, 0x1b26: 0x0080, 0x1b27: 0x0080, 0x1b28: 0x0040, 0x1b29: 0x0040, - 0x1b2a: 0x0040, 0x1b2b: 0x0040, 0x1b2c: 0x0040, 0x1b2d: 0x0040, 0x1b2e: 0x0040, 0x1b2f: 0x0080, - 0x1b30: 0x0080, 0x1b31: 0x0080, 0x1b32: 0x0080, 0x1b33: 0x0080, 0x1b34: 0x0080, 0x1b35: 0x0080, - 0x1b36: 0x0080, 0x1b37: 0x0080, 0x1b38: 0x0080, 0x1b39: 0x0080, 0x1b3a: 0x0080, 0x1b3b: 0x0080, - 0x1b3c: 0x0080, 0x1b3d: 0x0080, 0x1b3e: 0x0080, 0x1b3f: 0x0080, - // Block 0x6d, offset 0x1b40 - 0x1b40: 0x0080, 0x1b41: 0x0080, 0x1b42: 0x0080, 0x1b43: 0x0080, 0x1b44: 0x0080, 0x1b45: 0x0080, - 0x1b46: 0x0080, 0x1b47: 0x0080, 0x1b48: 0x0080, 0x1b49: 0x0080, 0x1b4a: 0x0080, 0x1b4b: 0x0080, - 0x1b4c: 0x0080, 0x1b4d: 0x0080, 0x1b4e: 0x0080, 0x1b4f: 0x0080, 0x1b50: 0x0080, 0x1b51: 0x0080, - 0x1b52: 0x0080, 0x1b53: 0x0080, 0x1b54: 0x0080, 0x1b55: 0x0080, 0x1b56: 0x0080, 0x1b57: 0x0080, - 0x1b58: 0x0080, 0x1b59: 0x0080, 0x1b5a: 0x0080, 0x1b5b: 0x0080, 0x1b5c: 0x0080, 0x1b5d: 0x0080, - 0x1b5e: 0x0080, 0x1b5f: 0x0080, 0x1b60: 0x0040, 0x1b61: 0x0040, 0x1b62: 0x0040, 0x1b63: 0x0040, - 0x1b64: 0x0040, 0x1b66: 0x0040, 0x1b67: 0x0040, 0x1b68: 0x0040, 0x1b69: 0x0040, - 0x1b6a: 0x0040, 0x1b6b: 0x0040, 0x1b6c: 0x0040, 0x1b6d: 0x0040, 0x1b6e: 0x0040, 0x1b6f: 0x0040, - 0x1b70: 0x0080, 0x1b71: 0x0080, 0x1b74: 0x0080, 0x1b75: 0x0080, - 0x1b76: 0x0080, 0x1b77: 0x0080, 0x1b78: 0x0080, 0x1b79: 0x0080, 0x1b7a: 0x0080, 0x1b7b: 0x0080, - 0x1b7c: 0x0080, 0x1b7d: 0x0080, 0x1b7e: 0x0080, 0x1b7f: 0x0080, - // Block 0x6e, offset 0x1b80 - 0x1b80: 0x0080, 0x1b81: 0x0080, 0x1b82: 0x0080, 0x1b83: 0x0080, 0x1b84: 0x0080, 0x1b85: 0x0080, - 0x1b86: 0x0080, 0x1b87: 0x0080, 0x1b88: 0x0080, 0x1b89: 0x0080, 0x1b8a: 0x0080, 0x1b8b: 0x0080, - 0x1b8c: 0x0080, 0x1b8d: 0x0080, 0x1b8e: 0x0080, 0x1b90: 0x0080, 0x1b91: 0x0080, - 0x1b92: 0x0080, 0x1b93: 0x0080, 0x1b94: 0x0080, 0x1b95: 0x0080, 0x1b96: 0x0080, 0x1b97: 0x0080, - 0x1b98: 0x0080, 0x1b99: 0x0080, 0x1b9a: 0x0080, 0x1b9b: 0x0080, 0x1b9c: 0x0080, - 0x1ba0: 0x0080, 0x1ba1: 0x0080, 0x1ba2: 0x0080, 0x1ba3: 0x0080, - 0x1ba4: 0x0080, 0x1ba5: 0x0080, 0x1ba6: 0x0080, 0x1ba7: 0x0080, 0x1ba8: 0x0080, 0x1ba9: 0x0080, - 0x1baa: 0x0080, 0x1bab: 0x0080, 0x1bac: 0x0080, 0x1bad: 0x0080, 0x1bae: 0x0080, 0x1baf: 0x0080, - 0x1bb0: 0x0080, 0x1bb1: 0x0080, 0x1bb2: 0x0080, 0x1bb3: 0x0080, 0x1bb4: 0x0080, 0x1bb5: 0x0080, - 0x1bb6: 0x0080, 0x1bb7: 0x0080, 0x1bb8: 0x0080, 0x1bb9: 0x0080, 0x1bba: 0x0080, 0x1bbb: 0x0080, - 0x1bbc: 0x0080, 0x1bbd: 0x0080, 0x1bbe: 0x0080, - // Block 0x6f, offset 0x1bc0 - 0x1bd0: 0x00c3, 0x1bd1: 0x00c3, - 0x1bd2: 0x00c3, 0x1bd3: 0x00c3, 0x1bd4: 0x00c3, 0x1bd5: 0x00c3, 0x1bd6: 0x00c3, 0x1bd7: 0x00c3, - 0x1bd8: 0x00c3, 0x1bd9: 0x00c3, 0x1bda: 0x00c3, 0x1bdb: 0x00c3, 0x1bdc: 0x00c3, 0x1bdd: 0x0083, - 0x1bde: 0x0083, 0x1bdf: 0x0083, 0x1be0: 0x0083, 0x1be1: 0x00c3, 0x1be2: 0x0083, 0x1be3: 0x0083, - 0x1be4: 0x0083, 0x1be5: 0x00c3, 0x1be6: 0x00c3, 0x1be7: 0x00c3, 0x1be8: 0x00c3, 0x1be9: 0x00c3, - 0x1bea: 0x00c3, 0x1beb: 0x00c3, 0x1bec: 0x00c3, 0x1bed: 0x00c3, 0x1bee: 0x00c3, 0x1bef: 0x00c3, - 0x1bf0: 0x00c3, - // Block 0x70, offset 0x1c00 - 0x1c00: 0x0080, 0x1c01: 0x0080, 0x1c02: 0x0080, 0x1c03: 0x0080, 0x1c04: 0x0080, 0x1c05: 0x0080, - 0x1c06: 0x0080, 0x1c07: 0x0080, 0x1c08: 0x0080, 0x1c09: 0x0080, 0x1c0a: 0x0080, 0x1c0b: 0x0080, - 0x1c0c: 0x0080, 0x1c0d: 0x0080, 0x1c0e: 0x0080, 0x1c0f: 0x0080, 0x1c10: 0x0080, 0x1c11: 0x0080, - 0x1c12: 0x0080, 0x1c13: 0x0080, 0x1c14: 0x0080, 0x1c15: 0x0080, 0x1c16: 0x0080, 0x1c17: 0x0080, - 0x1c18: 0x0080, 0x1c19: 0x0080, 0x1c1a: 0x0080, 0x1c1b: 0x0080, 0x1c1c: 0x0080, 0x1c1d: 0x0080, - 0x1c1e: 0x0080, 0x1c1f: 0x0080, 0x1c20: 0x0080, 0x1c21: 0x0080, 0x1c22: 0x0080, 0x1c23: 0x0080, - 0x1c24: 0x0080, 0x1c25: 0x0080, 0x1c26: 0x0088, 0x1c27: 0x0080, 0x1c28: 0x0080, 0x1c29: 0x0080, - 0x1c2a: 0x0080, 0x1c2b: 0x0080, 0x1c2c: 0x0080, 0x1c2d: 0x0080, 0x1c2e: 0x0080, 0x1c2f: 0x0080, - 0x1c30: 0x0080, 0x1c31: 0x0080, 0x1c32: 0x00c0, 0x1c33: 0x0080, 0x1c34: 0x0080, 0x1c35: 0x0080, - 0x1c36: 0x0080, 0x1c37: 0x0080, 0x1c38: 0x0080, 0x1c39: 0x0080, 0x1c3a: 0x0080, 0x1c3b: 0x0080, - 0x1c3c: 0x0080, 0x1c3d: 0x0080, 0x1c3e: 0x0080, 0x1c3f: 0x0080, - // Block 0x71, offset 0x1c40 - 0x1c40: 0x0080, 0x1c41: 0x0080, 0x1c42: 0x0080, 0x1c43: 0x0080, 0x1c44: 0x0080, 0x1c45: 0x0080, - 0x1c46: 0x0080, 0x1c47: 0x0080, 0x1c48: 0x0080, 0x1c49: 0x0080, 0x1c4a: 0x0080, 0x1c4b: 0x0080, - 0x1c4c: 0x0080, 0x1c4d: 0x0080, 0x1c4e: 0x00c0, 0x1c4f: 0x0080, 0x1c50: 0x0080, 0x1c51: 0x0080, - 0x1c52: 0x0080, 0x1c53: 0x0080, 0x1c54: 0x0080, 0x1c55: 0x0080, 0x1c56: 0x0080, 0x1c57: 0x0080, - 0x1c58: 0x0080, 0x1c59: 0x0080, 0x1c5a: 0x0080, 0x1c5b: 0x0080, 0x1c5c: 0x0080, 0x1c5d: 0x0080, - 0x1c5e: 0x0080, 0x1c5f: 0x0080, 0x1c60: 0x0080, 0x1c61: 0x0080, 0x1c62: 0x0080, 0x1c63: 0x0080, - 0x1c64: 0x0080, 0x1c65: 0x0080, 0x1c66: 0x0080, 0x1c67: 0x0080, 0x1c68: 0x0080, 0x1c69: 0x0080, - 0x1c6a: 0x0080, 0x1c6b: 0x0080, 0x1c6c: 0x0080, 0x1c6d: 0x0080, 0x1c6e: 0x0080, 0x1c6f: 0x0080, - 0x1c70: 0x0080, 0x1c71: 0x0080, 0x1c72: 0x0080, 0x1c73: 0x0080, 0x1c74: 0x0080, 0x1c75: 0x0080, - 0x1c76: 0x0080, 0x1c77: 0x0080, 0x1c78: 0x0080, 0x1c79: 0x0080, 0x1c7a: 0x0080, 0x1c7b: 0x0080, - 0x1c7c: 0x0080, 0x1c7d: 0x0080, 0x1c7e: 0x0080, 0x1c7f: 0x0080, - // Block 0x72, offset 0x1c80 - 0x1c80: 0x0080, 0x1c81: 0x0080, 0x1c82: 0x0080, 0x1c83: 0x00c0, 0x1c84: 0x00c0, 0x1c85: 0x0080, - 0x1c86: 0x0080, 0x1c87: 0x0080, 0x1c88: 0x0080, 0x1c89: 0x0080, 0x1c8a: 0x0080, 0x1c8b: 0x0080, - 0x1c90: 0x0080, 0x1c91: 0x0080, - 0x1c92: 0x0080, 0x1c93: 0x0080, 0x1c94: 0x0080, 0x1c95: 0x0080, 0x1c96: 0x0080, 0x1c97: 0x0080, - 0x1c98: 0x0080, 0x1c99: 0x0080, 0x1c9a: 0x0080, 0x1c9b: 0x0080, 0x1c9c: 0x0080, 0x1c9d: 0x0080, - 0x1c9e: 0x0080, 0x1c9f: 0x0080, 0x1ca0: 0x0080, 0x1ca1: 0x0080, 0x1ca2: 0x0080, 0x1ca3: 0x0080, - 0x1ca4: 0x0080, 0x1ca5: 0x0080, 0x1ca6: 0x0080, 0x1ca7: 0x0080, 0x1ca8: 0x0080, 0x1ca9: 0x0080, - 0x1caa: 0x0080, 0x1cab: 0x0080, 0x1cac: 0x0080, 0x1cad: 0x0080, 0x1cae: 0x0080, 0x1caf: 0x0080, - 0x1cb0: 0x0080, 0x1cb1: 0x0080, 0x1cb2: 0x0080, 0x1cb3: 0x0080, 0x1cb4: 0x0080, 0x1cb5: 0x0080, - 0x1cb6: 0x0080, 0x1cb7: 0x0080, 0x1cb8: 0x0080, 0x1cb9: 0x0080, 0x1cba: 0x0080, 0x1cbb: 0x0080, - 0x1cbc: 0x0080, 0x1cbd: 0x0080, 0x1cbe: 0x0080, 0x1cbf: 0x0080, - // Block 0x73, offset 0x1cc0 - 0x1cc0: 0x0080, 0x1cc1: 0x0080, 0x1cc2: 0x0080, 0x1cc3: 0x0080, 0x1cc4: 0x0080, 0x1cc5: 0x0080, - 0x1cc6: 0x0080, 0x1cc7: 0x0080, 0x1cc8: 0x0080, 0x1cc9: 0x0080, 0x1cca: 0x0080, 0x1ccb: 0x0080, - 0x1ccc: 0x0080, 0x1ccd: 0x0080, 0x1cce: 0x0080, 0x1ccf: 0x0080, 0x1cd0: 0x0080, 0x1cd1: 0x0080, - 0x1cd2: 0x0080, 0x1cd3: 0x0080, 0x1cd4: 0x0080, 0x1cd5: 0x0080, 0x1cd6: 0x0080, 0x1cd7: 0x0080, - 0x1cd8: 0x0080, 0x1cd9: 0x0080, 0x1cda: 0x0080, 0x1cdb: 0x0080, 0x1cdc: 0x0080, 0x1cdd: 0x0080, - 0x1cde: 0x0080, 0x1cdf: 0x0080, 0x1ce0: 0x0080, 0x1ce1: 0x0080, 0x1ce2: 0x0080, 0x1ce3: 0x0080, - 0x1ce4: 0x0080, 0x1ce5: 0x0080, 0x1ce6: 0x0080, 0x1ce7: 0x0080, 0x1ce8: 0x0080, 0x1ce9: 0x0080, - 0x1cea: 0x0080, 0x1ceb: 0x0080, 0x1cec: 0x0080, 0x1ced: 0x0080, 0x1cee: 0x0080, 0x1cef: 0x0080, - 0x1cf0: 0x0080, 0x1cf1: 0x0080, 0x1cf2: 0x0080, 0x1cf3: 0x0080, 0x1cf4: 0x0080, 0x1cf5: 0x0080, - 0x1cf6: 0x0080, 0x1cf7: 0x0080, 0x1cf8: 0x0080, 0x1cf9: 0x0080, 0x1cfa: 0x0080, 0x1cfb: 0x0080, - 0x1cfc: 0x0080, 0x1cfd: 0x0080, 0x1cfe: 0x0080, 0x1cff: 0x0080, - // Block 0x74, offset 0x1d00 - 0x1d00: 0x0080, 0x1d01: 0x0080, 0x1d02: 0x0080, 0x1d03: 0x0080, 0x1d04: 0x0080, 0x1d05: 0x0080, - 0x1d06: 0x0080, 0x1d07: 0x0080, 0x1d08: 0x0080, 0x1d09: 0x0080, 0x1d0a: 0x0080, 0x1d0b: 0x0080, - 0x1d0c: 0x0080, 0x1d0d: 0x0080, 0x1d0e: 0x0080, 0x1d0f: 0x0080, 0x1d10: 0x0080, 0x1d11: 0x0080, - 0x1d12: 0x0080, 0x1d13: 0x0080, 0x1d14: 0x0080, 0x1d15: 0x0080, 0x1d16: 0x0080, 0x1d17: 0x0080, - 0x1d18: 0x0080, 0x1d19: 0x0080, 0x1d1a: 0x0080, 0x1d1b: 0x0080, 0x1d1c: 0x0080, 0x1d1d: 0x0080, - 0x1d1e: 0x0080, 0x1d1f: 0x0080, 0x1d20: 0x0080, 0x1d21: 0x0080, 0x1d22: 0x0080, 0x1d23: 0x0080, - 0x1d24: 0x0080, 0x1d25: 0x0080, 0x1d26: 0x0080, 0x1d27: 0x0080, 0x1d28: 0x0080, 0x1d29: 0x0080, - 0x1d2a: 0x0080, 0x1d2b: 0x0080, 0x1d2c: 0x0080, 0x1d2d: 0x0080, 0x1d2e: 0x0080, 0x1d2f: 0x0080, - 0x1d30: 0x0080, 0x1d31: 0x0080, 0x1d32: 0x0080, 0x1d33: 0x0080, 0x1d34: 0x0080, 0x1d35: 0x0080, - 0x1d36: 0x0080, 0x1d37: 0x0080, 0x1d38: 0x0080, 0x1d39: 0x0080, 0x1d3a: 0x0080, 0x1d3b: 0x0080, - 0x1d3c: 0x0080, 0x1d3d: 0x0080, 0x1d3e: 0x0080, - // Block 0x75, offset 0x1d40 - 0x1d40: 0x0080, 0x1d41: 0x0080, 0x1d42: 0x0080, 0x1d43: 0x0080, 0x1d44: 0x0080, 0x1d45: 0x0080, - 0x1d46: 0x0080, 0x1d47: 0x0080, 0x1d48: 0x0080, 0x1d49: 0x0080, 0x1d4a: 0x0080, 0x1d4b: 0x0080, - 0x1d4c: 0x0080, 0x1d4d: 0x0080, 0x1d4e: 0x0080, 0x1d4f: 0x0080, 0x1d50: 0x0080, 0x1d51: 0x0080, - 0x1d52: 0x0080, 0x1d53: 0x0080, 0x1d54: 0x0080, 0x1d55: 0x0080, 0x1d56: 0x0080, 0x1d57: 0x0080, - 0x1d58: 0x0080, 0x1d59: 0x0080, 0x1d5a: 0x0080, 0x1d5b: 0x0080, 0x1d5c: 0x0080, 0x1d5d: 0x0080, - 0x1d5e: 0x0080, 0x1d5f: 0x0080, 0x1d60: 0x0080, 0x1d61: 0x0080, 0x1d62: 0x0080, 0x1d63: 0x0080, - 0x1d64: 0x0080, 0x1d65: 0x0080, 0x1d66: 0x0080, - // Block 0x76, offset 0x1d80 - 0x1d80: 0x0080, 0x1d81: 0x0080, 0x1d82: 0x0080, 0x1d83: 0x0080, 0x1d84: 0x0080, 0x1d85: 0x0080, - 0x1d86: 0x0080, 0x1d87: 0x0080, 0x1d88: 0x0080, 0x1d89: 0x0080, 0x1d8a: 0x0080, - 0x1da0: 0x0080, 0x1da1: 0x0080, 0x1da2: 0x0080, 0x1da3: 0x0080, - 0x1da4: 0x0080, 0x1da5: 0x0080, 0x1da6: 0x0080, 0x1da7: 0x0080, 0x1da8: 0x0080, 0x1da9: 0x0080, - 0x1daa: 0x0080, 0x1dab: 0x0080, 0x1dac: 0x0080, 0x1dad: 0x0080, 0x1dae: 0x0080, 0x1daf: 0x0080, - 0x1db0: 0x0080, 0x1db1: 0x0080, 0x1db2: 0x0080, 0x1db3: 0x0080, 0x1db4: 0x0080, 0x1db5: 0x0080, - 0x1db6: 0x0080, 0x1db7: 0x0080, 0x1db8: 0x0080, 0x1db9: 0x0080, 0x1dba: 0x0080, 0x1dbb: 0x0080, - 0x1dbc: 0x0080, 0x1dbd: 0x0080, 0x1dbe: 0x0080, 0x1dbf: 0x0080, - // Block 0x77, offset 0x1dc0 - 0x1dc0: 0x0080, 0x1dc1: 0x0080, 0x1dc2: 0x0080, 0x1dc3: 0x0080, 0x1dc4: 0x0080, 0x1dc5: 0x0080, - 0x1dc6: 0x0080, 0x1dc7: 0x0080, 0x1dc8: 0x0080, 0x1dc9: 0x0080, 0x1dca: 0x0080, 0x1dcb: 0x0080, - 0x1dcc: 0x0080, 0x1dcd: 0x0080, 0x1dce: 0x0080, 0x1dcf: 0x0080, 0x1dd0: 0x0080, 0x1dd1: 0x0080, - 0x1dd2: 0x0080, 0x1dd3: 0x0080, 0x1dd4: 0x0080, 0x1dd5: 0x0080, 0x1dd6: 0x0080, 0x1dd7: 0x0080, - 0x1dd8: 0x0080, 0x1dd9: 0x0080, 0x1dda: 0x0080, 0x1ddb: 0x0080, 0x1ddc: 0x0080, 0x1ddd: 0x0080, - 0x1dde: 0x0080, 0x1ddf: 0x0080, 0x1de0: 0x0080, 0x1de1: 0x0080, 0x1de2: 0x0080, 0x1de3: 0x0080, - 0x1de4: 0x0080, 0x1de5: 0x0080, 0x1de6: 0x0080, 0x1de7: 0x0080, 0x1de8: 0x0080, 0x1de9: 0x0080, - 0x1dea: 0x0080, 0x1deb: 0x0080, 0x1dec: 0x0080, 0x1ded: 0x0080, 0x1dee: 0x0080, 0x1def: 0x0080, - 0x1df0: 0x0080, 0x1df1: 0x0080, 0x1df2: 0x0080, 0x1df3: 0x0080, - 0x1df6: 0x0080, 0x1df7: 0x0080, 0x1df8: 0x0080, 0x1df9: 0x0080, 0x1dfa: 0x0080, 0x1dfb: 0x0080, - 0x1dfc: 0x0080, 0x1dfd: 0x0080, 0x1dfe: 0x0080, 0x1dff: 0x0080, - // Block 0x78, offset 0x1e00 - 0x1e00: 0x0080, 0x1e01: 0x0080, 0x1e02: 0x0080, 0x1e03: 0x0080, 0x1e04: 0x0080, 0x1e05: 0x0080, - 0x1e06: 0x0080, 0x1e07: 0x0080, 0x1e08: 0x0080, 0x1e09: 0x0080, 0x1e0a: 0x0080, 0x1e0b: 0x0080, - 0x1e0c: 0x0080, 0x1e0d: 0x0080, 0x1e0e: 0x0080, 0x1e0f: 0x0080, 0x1e10: 0x0080, 0x1e11: 0x0080, - 0x1e12: 0x0080, 0x1e13: 0x0080, 0x1e14: 0x0080, 0x1e15: 0x0080, - 0x1e18: 0x0080, 0x1e19: 0x0080, 0x1e1a: 0x0080, 0x1e1b: 0x0080, 0x1e1c: 0x0080, 0x1e1d: 0x0080, - 0x1e1e: 0x0080, 0x1e1f: 0x0080, 0x1e20: 0x0080, 0x1e21: 0x0080, 0x1e22: 0x0080, 0x1e23: 0x0080, - 0x1e24: 0x0080, 0x1e25: 0x0080, 0x1e26: 0x0080, 0x1e27: 0x0080, 0x1e28: 0x0080, 0x1e29: 0x0080, - 0x1e2a: 0x0080, 0x1e2b: 0x0080, 0x1e2c: 0x0080, 0x1e2d: 0x0080, 0x1e2e: 0x0080, 0x1e2f: 0x0080, - 0x1e30: 0x0080, 0x1e31: 0x0080, 0x1e32: 0x0080, 0x1e33: 0x0080, 0x1e34: 0x0080, 0x1e35: 0x0080, - 0x1e36: 0x0080, 0x1e37: 0x0080, 0x1e38: 0x0080, 0x1e39: 0x0080, - 0x1e3d: 0x0080, 0x1e3e: 0x0080, 0x1e3f: 0x0080, - // Block 0x79, offset 0x1e40 - 0x1e40: 0x0080, 0x1e41: 0x0080, 0x1e42: 0x0080, 0x1e43: 0x0080, 0x1e44: 0x0080, 0x1e45: 0x0080, - 0x1e46: 0x0080, 0x1e47: 0x0080, 0x1e48: 0x0080, 0x1e4a: 0x0080, 0x1e4b: 0x0080, - 0x1e4c: 0x0080, 0x1e4d: 0x0080, 0x1e4e: 0x0080, 0x1e4f: 0x0080, 0x1e50: 0x0080, 0x1e51: 0x0080, - 0x1e6c: 0x0080, 0x1e6d: 0x0080, 0x1e6e: 0x0080, 0x1e6f: 0x0080, - // Block 0x7a, offset 0x1e80 - 0x1e80: 0x00c0, 0x1e81: 0x00c0, 0x1e82: 0x00c0, 0x1e83: 0x00c0, 0x1e84: 0x00c0, 0x1e85: 0x00c0, - 0x1e86: 0x00c0, 0x1e87: 0x00c0, 0x1e88: 0x00c0, 0x1e89: 0x00c0, 0x1e8a: 0x00c0, 0x1e8b: 0x00c0, - 0x1e8c: 0x00c0, 0x1e8d: 0x00c0, 0x1e8e: 0x00c0, 0x1e8f: 0x00c0, 0x1e90: 0x00c0, 0x1e91: 0x00c0, - 0x1e92: 0x00c0, 0x1e93: 0x00c0, 0x1e94: 0x00c0, 0x1e95: 0x00c0, 0x1e96: 0x00c0, 0x1e97: 0x00c0, - 0x1e98: 0x00c0, 0x1e99: 0x00c0, 0x1e9a: 0x00c0, 0x1e9b: 0x00c0, 0x1e9c: 0x00c0, 0x1e9d: 0x00c0, - 0x1e9e: 0x00c0, 0x1e9f: 0x00c0, 0x1ea0: 0x00c0, 0x1ea1: 0x00c0, 0x1ea2: 0x00c0, 0x1ea3: 0x00c0, - 0x1ea4: 0x00c0, 0x1ea5: 0x00c0, 0x1ea6: 0x00c0, 0x1ea7: 0x00c0, 0x1ea8: 0x00c0, 0x1ea9: 0x00c0, - 0x1eaa: 0x00c0, 0x1eab: 0x00c0, 0x1eac: 0x00c0, 0x1ead: 0x00c0, 0x1eae: 0x00c0, - 0x1eb0: 0x00c0, 0x1eb1: 0x00c0, 0x1eb2: 0x00c0, 0x1eb3: 0x00c0, 0x1eb4: 0x00c0, 0x1eb5: 0x00c0, - 0x1eb6: 0x00c0, 0x1eb7: 0x00c0, 0x1eb8: 0x00c0, 0x1eb9: 0x00c0, 0x1eba: 0x00c0, 0x1ebb: 0x00c0, - 0x1ebc: 0x00c0, 0x1ebd: 0x00c0, 0x1ebe: 0x00c0, 0x1ebf: 0x00c0, - // Block 0x7b, offset 0x1ec0 - 0x1ec0: 0x00c0, 0x1ec1: 0x00c0, 0x1ec2: 0x00c0, 0x1ec3: 0x00c0, 0x1ec4: 0x00c0, 0x1ec5: 0x00c0, - 0x1ec6: 0x00c0, 0x1ec7: 0x00c0, 0x1ec8: 0x00c0, 0x1ec9: 0x00c0, 0x1eca: 0x00c0, 0x1ecb: 0x00c0, - 0x1ecc: 0x00c0, 0x1ecd: 0x00c0, 0x1ece: 0x00c0, 0x1ecf: 0x00c0, 0x1ed0: 0x00c0, 0x1ed1: 0x00c0, - 0x1ed2: 0x00c0, 0x1ed3: 0x00c0, 0x1ed4: 0x00c0, 0x1ed5: 0x00c0, 0x1ed6: 0x00c0, 0x1ed7: 0x00c0, - 0x1ed8: 0x00c0, 0x1ed9: 0x00c0, 0x1eda: 0x00c0, 0x1edb: 0x00c0, 0x1edc: 0x00c0, 0x1edd: 0x00c0, - 0x1ede: 0x00c0, 0x1ee0: 0x00c0, 0x1ee1: 0x00c0, 0x1ee2: 0x00c0, 0x1ee3: 0x00c0, - 0x1ee4: 0x00c0, 0x1ee5: 0x00c0, 0x1ee6: 0x00c0, 0x1ee7: 0x00c0, 0x1ee8: 0x00c0, 0x1ee9: 0x00c0, - 0x1eea: 0x00c0, 0x1eeb: 0x00c0, 0x1eec: 0x00c0, 0x1eed: 0x00c0, 0x1eee: 0x00c0, 0x1eef: 0x00c0, - 0x1ef0: 0x00c0, 0x1ef1: 0x00c0, 0x1ef2: 0x00c0, 0x1ef3: 0x00c0, 0x1ef4: 0x00c0, 0x1ef5: 0x00c0, - 0x1ef6: 0x00c0, 0x1ef7: 0x00c0, 0x1ef8: 0x00c0, 0x1ef9: 0x00c0, 0x1efa: 0x00c0, 0x1efb: 0x00c0, - 0x1efc: 0x0080, 0x1efd: 0x0080, 0x1efe: 0x00c0, 0x1eff: 0x00c0, - // Block 0x7c, offset 0x1f00 - 0x1f00: 0x00c0, 0x1f01: 0x00c0, 0x1f02: 0x00c0, 0x1f03: 0x00c0, 0x1f04: 0x00c0, 0x1f05: 0x00c0, - 0x1f06: 0x00c0, 0x1f07: 0x00c0, 0x1f08: 0x00c0, 0x1f09: 0x00c0, 0x1f0a: 0x00c0, 0x1f0b: 0x00c0, - 0x1f0c: 0x00c0, 0x1f0d: 0x00c0, 0x1f0e: 0x00c0, 0x1f0f: 0x00c0, 0x1f10: 0x00c0, 0x1f11: 0x00c0, - 0x1f12: 0x00c0, 0x1f13: 0x00c0, 0x1f14: 0x00c0, 0x1f15: 0x00c0, 0x1f16: 0x00c0, 0x1f17: 0x00c0, - 0x1f18: 0x00c0, 0x1f19: 0x00c0, 0x1f1a: 0x00c0, 0x1f1b: 0x00c0, 0x1f1c: 0x00c0, 0x1f1d: 0x00c0, - 0x1f1e: 0x00c0, 0x1f1f: 0x00c0, 0x1f20: 0x00c0, 0x1f21: 0x00c0, 0x1f22: 0x00c0, 0x1f23: 0x00c0, - 0x1f24: 0x00c0, 0x1f25: 0x0080, 0x1f26: 0x0080, 0x1f27: 0x0080, 0x1f28: 0x0080, 0x1f29: 0x0080, - 0x1f2a: 0x0080, 0x1f2b: 0x00c0, 0x1f2c: 0x00c0, 0x1f2d: 0x00c0, 0x1f2e: 0x00c0, 0x1f2f: 0x00c3, - 0x1f30: 0x00c3, 0x1f31: 0x00c3, 0x1f32: 0x00c0, 0x1f33: 0x00c0, - 0x1f39: 0x0080, 0x1f3a: 0x0080, 0x1f3b: 0x0080, - 0x1f3c: 0x0080, 0x1f3d: 0x0080, 0x1f3e: 0x0080, 0x1f3f: 0x0080, - // Block 0x7d, offset 0x1f40 - 0x1f40: 0x00c0, 0x1f41: 0x00c0, 0x1f42: 0x00c0, 0x1f43: 0x00c0, 0x1f44: 0x00c0, 0x1f45: 0x00c0, - 0x1f46: 0x00c0, 0x1f47: 0x00c0, 0x1f48: 0x00c0, 0x1f49: 0x00c0, 0x1f4a: 0x00c0, 0x1f4b: 0x00c0, - 0x1f4c: 0x00c0, 0x1f4d: 0x00c0, 0x1f4e: 0x00c0, 0x1f4f: 0x00c0, 0x1f50: 0x00c0, 0x1f51: 0x00c0, - 0x1f52: 0x00c0, 0x1f53: 0x00c0, 0x1f54: 0x00c0, 0x1f55: 0x00c0, 0x1f56: 0x00c0, 0x1f57: 0x00c0, - 0x1f58: 0x00c0, 0x1f59: 0x00c0, 0x1f5a: 0x00c0, 0x1f5b: 0x00c0, 0x1f5c: 0x00c0, 0x1f5d: 0x00c0, - 0x1f5e: 0x00c0, 0x1f5f: 0x00c0, 0x1f60: 0x00c0, 0x1f61: 0x00c0, 0x1f62: 0x00c0, 0x1f63: 0x00c0, - 0x1f64: 0x00c0, 0x1f65: 0x00c0, 0x1f67: 0x00c0, - 0x1f6d: 0x00c0, - 0x1f70: 0x00c0, 0x1f71: 0x00c0, 0x1f72: 0x00c0, 0x1f73: 0x00c0, 0x1f74: 0x00c0, 0x1f75: 0x00c0, - 0x1f76: 0x00c0, 0x1f77: 0x00c0, 0x1f78: 0x00c0, 0x1f79: 0x00c0, 0x1f7a: 0x00c0, 0x1f7b: 0x00c0, - 0x1f7c: 0x00c0, 0x1f7d: 0x00c0, 0x1f7e: 0x00c0, 0x1f7f: 0x00c0, - // Block 0x7e, offset 0x1f80 - 0x1f80: 0x00c0, 0x1f81: 0x00c0, 0x1f82: 0x00c0, 0x1f83: 0x00c0, 0x1f84: 0x00c0, 0x1f85: 0x00c0, - 0x1f86: 0x00c0, 0x1f87: 0x00c0, 0x1f88: 0x00c0, 0x1f89: 0x00c0, 0x1f8a: 0x00c0, 0x1f8b: 0x00c0, - 0x1f8c: 0x00c0, 0x1f8d: 0x00c0, 0x1f8e: 0x00c0, 0x1f8f: 0x00c0, 0x1f90: 0x00c0, 0x1f91: 0x00c0, - 0x1f92: 0x00c0, 0x1f93: 0x00c0, 0x1f94: 0x00c0, 0x1f95: 0x00c0, 0x1f96: 0x00c0, 0x1f97: 0x00c0, - 0x1f98: 0x00c0, 0x1f99: 0x00c0, 0x1f9a: 0x00c0, 0x1f9b: 0x00c0, 0x1f9c: 0x00c0, 0x1f9d: 0x00c0, - 0x1f9e: 0x00c0, 0x1f9f: 0x00c0, 0x1fa0: 0x00c0, 0x1fa1: 0x00c0, 0x1fa2: 0x00c0, 0x1fa3: 0x00c0, - 0x1fa4: 0x00c0, 0x1fa5: 0x00c0, 0x1fa6: 0x00c0, 0x1fa7: 0x00c0, - 0x1faf: 0x0080, - 0x1fb0: 0x0080, - 0x1fbf: 0x00c6, - // Block 0x7f, offset 0x1fc0 - 0x1fc0: 0x00c0, 0x1fc1: 0x00c0, 0x1fc2: 0x00c0, 0x1fc3: 0x00c0, 0x1fc4: 0x00c0, 0x1fc5: 0x00c0, - 0x1fc6: 0x00c0, 0x1fc7: 0x00c0, 0x1fc8: 0x00c0, 0x1fc9: 0x00c0, 0x1fca: 0x00c0, 0x1fcb: 0x00c0, - 0x1fcc: 0x00c0, 0x1fcd: 0x00c0, 0x1fce: 0x00c0, 0x1fcf: 0x00c0, 0x1fd0: 0x00c0, 0x1fd1: 0x00c0, - 0x1fd2: 0x00c0, 0x1fd3: 0x00c0, 0x1fd4: 0x00c0, 0x1fd5: 0x00c0, 0x1fd6: 0x00c0, - 0x1fe0: 0x00c0, 0x1fe1: 0x00c0, 0x1fe2: 0x00c0, 0x1fe3: 0x00c0, - 0x1fe4: 0x00c0, 0x1fe5: 0x00c0, 0x1fe6: 0x00c0, 0x1fe8: 0x00c0, 0x1fe9: 0x00c0, - 0x1fea: 0x00c0, 0x1feb: 0x00c0, 0x1fec: 0x00c0, 0x1fed: 0x00c0, 0x1fee: 0x00c0, - 0x1ff0: 0x00c0, 0x1ff1: 0x00c0, 0x1ff2: 0x00c0, 0x1ff3: 0x00c0, 0x1ff4: 0x00c0, 0x1ff5: 0x00c0, - 0x1ff6: 0x00c0, 0x1ff8: 0x00c0, 0x1ff9: 0x00c0, 0x1ffa: 0x00c0, 0x1ffb: 0x00c0, - 0x1ffc: 0x00c0, 0x1ffd: 0x00c0, 0x1ffe: 0x00c0, - // Block 0x80, offset 0x2000 - 0x2000: 0x00c0, 0x2001: 0x00c0, 0x2002: 0x00c0, 0x2003: 0x00c0, 0x2004: 0x00c0, 0x2005: 0x00c0, - 0x2006: 0x00c0, 0x2008: 0x00c0, 0x2009: 0x00c0, 0x200a: 0x00c0, 0x200b: 0x00c0, - 0x200c: 0x00c0, 0x200d: 0x00c0, 0x200e: 0x00c0, 0x2010: 0x00c0, 0x2011: 0x00c0, - 0x2012: 0x00c0, 0x2013: 0x00c0, 0x2014: 0x00c0, 0x2015: 0x00c0, 0x2016: 0x00c0, - 0x2018: 0x00c0, 0x2019: 0x00c0, 0x201a: 0x00c0, 0x201b: 0x00c0, 0x201c: 0x00c0, 0x201d: 0x00c0, - 0x201e: 0x00c0, 0x2020: 0x00c3, 0x2021: 0x00c3, 0x2022: 0x00c3, 0x2023: 0x00c3, - 0x2024: 0x00c3, 0x2025: 0x00c3, 0x2026: 0x00c3, 0x2027: 0x00c3, 0x2028: 0x00c3, 0x2029: 0x00c3, - 0x202a: 0x00c3, 0x202b: 0x00c3, 0x202c: 0x00c3, 0x202d: 0x00c3, 0x202e: 0x00c3, 0x202f: 0x00c3, - 0x2030: 0x00c3, 0x2031: 0x00c3, 0x2032: 0x00c3, 0x2033: 0x00c3, 0x2034: 0x00c3, 0x2035: 0x00c3, - 0x2036: 0x00c3, 0x2037: 0x00c3, 0x2038: 0x00c3, 0x2039: 0x00c3, 0x203a: 0x00c3, 0x203b: 0x00c3, - 0x203c: 0x00c3, 0x203d: 0x00c3, 0x203e: 0x00c3, 0x203f: 0x00c3, - // Block 0x81, offset 0x2040 - 0x2040: 0x0080, 0x2041: 0x0080, 0x2042: 0x0080, 0x2043: 0x0080, 0x2044: 0x0080, 0x2045: 0x0080, - 0x2046: 0x0080, 0x2047: 0x0080, 0x2048: 0x0080, 0x2049: 0x0080, 0x204a: 0x0080, 0x204b: 0x0080, - 0x204c: 0x0080, 0x204d: 0x0080, 0x204e: 0x0080, 0x204f: 0x0080, 0x2050: 0x0080, 0x2051: 0x0080, - 0x2052: 0x0080, 0x2053: 0x0080, 0x2054: 0x0080, 0x2055: 0x0080, 0x2056: 0x0080, 0x2057: 0x0080, - 0x2058: 0x0080, 0x2059: 0x0080, 0x205a: 0x0080, 0x205b: 0x0080, 0x205c: 0x0080, 0x205d: 0x0080, - 0x205e: 0x0080, 0x205f: 0x0080, 0x2060: 0x0080, 0x2061: 0x0080, 0x2062: 0x0080, 0x2063: 0x0080, - 0x2064: 0x0080, 0x2065: 0x0080, 0x2066: 0x0080, 0x2067: 0x0080, 0x2068: 0x0080, 0x2069: 0x0080, - 0x206a: 0x0080, 0x206b: 0x0080, 0x206c: 0x0080, 0x206d: 0x0080, 0x206e: 0x0080, 0x206f: 0x00c0, - 0x2070: 0x0080, 0x2071: 0x0080, 0x2072: 0x0080, 0x2073: 0x0080, 0x2074: 0x0080, 0x2075: 0x0080, - 0x2076: 0x0080, 0x2077: 0x0080, 0x2078: 0x0080, 0x2079: 0x0080, 0x207a: 0x0080, 0x207b: 0x0080, - 0x207c: 0x0080, 0x207d: 0x0080, 0x207e: 0x0080, 0x207f: 0x0080, - // Block 0x82, offset 0x2080 - 0x2080: 0x0080, 0x2081: 0x0080, 0x2082: 0x0080, 0x2083: 0x0080, 0x2084: 0x0080, - // Block 0x83, offset 0x20c0 - 0x20c0: 0x008c, 0x20c1: 0x008c, 0x20c2: 0x008c, 0x20c3: 0x008c, 0x20c4: 0x008c, 0x20c5: 0x008c, - 0x20c6: 0x008c, 0x20c7: 0x008c, 0x20c8: 0x008c, 0x20c9: 0x008c, 0x20ca: 0x008c, 0x20cb: 0x008c, - 0x20cc: 0x008c, 0x20cd: 0x008c, 0x20ce: 0x008c, 0x20cf: 0x008c, 0x20d0: 0x008c, 0x20d1: 0x008c, - 0x20d2: 0x008c, 0x20d3: 0x008c, 0x20d4: 0x008c, 0x20d5: 0x008c, 0x20d6: 0x008c, 0x20d7: 0x008c, - 0x20d8: 0x008c, 0x20d9: 0x008c, 0x20db: 0x008c, 0x20dc: 0x008c, 0x20dd: 0x008c, - 0x20de: 0x008c, 0x20df: 0x008c, 0x20e0: 0x008c, 0x20e1: 0x008c, 0x20e2: 0x008c, 0x20e3: 0x008c, - 0x20e4: 0x008c, 0x20e5: 0x008c, 0x20e6: 0x008c, 0x20e7: 0x008c, 0x20e8: 0x008c, 0x20e9: 0x008c, - 0x20ea: 0x008c, 0x20eb: 0x008c, 0x20ec: 0x008c, 0x20ed: 0x008c, 0x20ee: 0x008c, 0x20ef: 0x008c, - 0x20f0: 0x008c, 0x20f1: 0x008c, 0x20f2: 0x008c, 0x20f3: 0x008c, 0x20f4: 0x008c, 0x20f5: 0x008c, - 0x20f6: 0x008c, 0x20f7: 0x008c, 0x20f8: 0x008c, 0x20f9: 0x008c, 0x20fa: 0x008c, 0x20fb: 0x008c, - 0x20fc: 0x008c, 0x20fd: 0x008c, 0x20fe: 0x008c, 0x20ff: 0x008c, - // Block 0x84, offset 0x2100 - 0x2100: 0x008c, 0x2101: 0x008c, 0x2102: 0x008c, 0x2103: 0x008c, 0x2104: 0x008c, 0x2105: 0x008c, - 0x2106: 0x008c, 0x2107: 0x008c, 0x2108: 0x008c, 0x2109: 0x008c, 0x210a: 0x008c, 0x210b: 0x008c, - 0x210c: 0x008c, 0x210d: 0x008c, 0x210e: 0x008c, 0x210f: 0x008c, 0x2110: 0x008c, 0x2111: 0x008c, - 0x2112: 0x008c, 0x2113: 0x008c, 0x2114: 0x008c, 0x2115: 0x008c, 0x2116: 0x008c, 0x2117: 0x008c, - 0x2118: 0x008c, 0x2119: 0x008c, 0x211a: 0x008c, 0x211b: 0x008c, 0x211c: 0x008c, 0x211d: 0x008c, - 0x211e: 0x008c, 0x211f: 0x008c, 0x2120: 0x008c, 0x2121: 0x008c, 0x2122: 0x008c, 0x2123: 0x008c, - 0x2124: 0x008c, 0x2125: 0x008c, 0x2126: 0x008c, 0x2127: 0x008c, 0x2128: 0x008c, 0x2129: 0x008c, - 0x212a: 0x008c, 0x212b: 0x008c, 0x212c: 0x008c, 0x212d: 0x008c, 0x212e: 0x008c, 0x212f: 0x008c, - 0x2130: 0x008c, 0x2131: 0x008c, 0x2132: 0x008c, 0x2133: 0x008c, - // Block 0x85, offset 0x2140 - 0x2140: 0x008c, 0x2141: 0x008c, 0x2142: 0x008c, 0x2143: 0x008c, 0x2144: 0x008c, 0x2145: 0x008c, - 0x2146: 0x008c, 0x2147: 0x008c, 0x2148: 0x008c, 0x2149: 0x008c, 0x214a: 0x008c, 0x214b: 0x008c, - 0x214c: 0x008c, 0x214d: 0x008c, 0x214e: 0x008c, 0x214f: 0x008c, 0x2150: 0x008c, 0x2151: 0x008c, - 0x2152: 0x008c, 0x2153: 0x008c, 0x2154: 0x008c, 0x2155: 0x008c, 0x2156: 0x008c, 0x2157: 0x008c, - 0x2158: 0x008c, 0x2159: 0x008c, 0x215a: 0x008c, 0x215b: 0x008c, 0x215c: 0x008c, 0x215d: 0x008c, - 0x215e: 0x008c, 0x215f: 0x008c, 0x2160: 0x008c, 0x2161: 0x008c, 0x2162: 0x008c, 0x2163: 0x008c, - 0x2164: 0x008c, 0x2165: 0x008c, 0x2166: 0x008c, 0x2167: 0x008c, 0x2168: 0x008c, 0x2169: 0x008c, - 0x216a: 0x008c, 0x216b: 0x008c, 0x216c: 0x008c, 0x216d: 0x008c, 0x216e: 0x008c, 0x216f: 0x008c, - 0x2170: 0x008c, 0x2171: 0x008c, 0x2172: 0x008c, 0x2173: 0x008c, 0x2174: 0x008c, 0x2175: 0x008c, - 0x2176: 0x008c, 0x2177: 0x008c, 0x2178: 0x008c, 0x2179: 0x008c, 0x217a: 0x008c, 0x217b: 0x008c, - 0x217c: 0x008c, 0x217d: 0x008c, 0x217e: 0x008c, 0x217f: 0x008c, - // Block 0x86, offset 0x2180 - 0x2180: 0x008c, 0x2181: 0x008c, 0x2182: 0x008c, 0x2183: 0x008c, 0x2184: 0x008c, 0x2185: 0x008c, - 0x2186: 0x008c, 0x2187: 0x008c, 0x2188: 0x008c, 0x2189: 0x008c, 0x218a: 0x008c, 0x218b: 0x008c, - 0x218c: 0x008c, 0x218d: 0x008c, 0x218e: 0x008c, 0x218f: 0x008c, 0x2190: 0x008c, 0x2191: 0x008c, - 0x2192: 0x008c, 0x2193: 0x008c, 0x2194: 0x008c, 0x2195: 0x008c, - 0x21b0: 0x0080, 0x21b1: 0x0080, 0x21b2: 0x0080, 0x21b3: 0x0080, 0x21b4: 0x0080, 0x21b5: 0x0080, - 0x21b6: 0x0080, 0x21b7: 0x0080, 0x21b8: 0x0080, 0x21b9: 0x0080, 0x21ba: 0x0080, 0x21bb: 0x0080, - // Block 0x87, offset 0x21c0 - 0x21c0: 0x0080, 0x21c1: 0x0080, 0x21c2: 0x0080, 0x21c3: 0x0080, 0x21c4: 0x0080, 0x21c5: 0x00cc, - 0x21c6: 0x00c0, 0x21c7: 0x00cc, 0x21c8: 0x0080, 0x21c9: 0x0080, 0x21ca: 0x0080, 0x21cb: 0x0080, - 0x21cc: 0x0080, 0x21cd: 0x0080, 0x21ce: 0x0080, 0x21cf: 0x0080, 0x21d0: 0x0080, 0x21d1: 0x0080, - 0x21d2: 0x0080, 0x21d3: 0x0080, 0x21d4: 0x0080, 0x21d5: 0x0080, 0x21d6: 0x0080, 0x21d7: 0x0080, - 0x21d8: 0x0080, 0x21d9: 0x0080, 0x21da: 0x0080, 0x21db: 0x0080, 0x21dc: 0x0080, 0x21dd: 0x0080, - 0x21de: 0x0080, 0x21df: 0x0080, 0x21e0: 0x0080, 0x21e1: 0x008c, 0x21e2: 0x008c, 0x21e3: 0x008c, - 0x21e4: 0x008c, 0x21e5: 0x008c, 0x21e6: 0x008c, 0x21e7: 0x008c, 0x21e8: 0x008c, 0x21e9: 0x008c, - 0x21ea: 0x00c3, 0x21eb: 0x00c3, 0x21ec: 0x00c3, 0x21ed: 0x00c3, 0x21ee: 0x0040, 0x21ef: 0x0040, - 0x21f0: 0x0080, 0x21f1: 0x0040, 0x21f2: 0x0040, 0x21f3: 0x0040, 0x21f4: 0x0040, 0x21f5: 0x0040, - 0x21f6: 0x0080, 0x21f7: 0x0080, 0x21f8: 0x008c, 0x21f9: 0x008c, 0x21fa: 0x008c, 0x21fb: 0x0040, - 0x21fc: 0x00c0, 0x21fd: 0x0080, 0x21fe: 0x0080, 0x21ff: 0x0080, - // Block 0x88, offset 0x2200 - 0x2201: 0x00cc, 0x2202: 0x00cc, 0x2203: 0x00cc, 0x2204: 0x00cc, 0x2205: 0x00cc, - 0x2206: 0x00cc, 0x2207: 0x00cc, 0x2208: 0x00cc, 0x2209: 0x00cc, 0x220a: 0x00cc, 0x220b: 0x00cc, - 0x220c: 0x00cc, 0x220d: 0x00cc, 0x220e: 0x00cc, 0x220f: 0x00cc, 0x2210: 0x00cc, 0x2211: 0x00cc, - 0x2212: 0x00cc, 0x2213: 0x00cc, 0x2214: 0x00cc, 0x2215: 0x00cc, 0x2216: 0x00cc, 0x2217: 0x00cc, - 0x2218: 0x00cc, 0x2219: 0x00cc, 0x221a: 0x00cc, 0x221b: 0x00cc, 0x221c: 0x00cc, 0x221d: 0x00cc, - 0x221e: 0x00cc, 0x221f: 0x00cc, 0x2220: 0x00cc, 0x2221: 0x00cc, 0x2222: 0x00cc, 0x2223: 0x00cc, - 0x2224: 0x00cc, 0x2225: 0x00cc, 0x2226: 0x00cc, 0x2227: 0x00cc, 0x2228: 0x00cc, 0x2229: 0x00cc, - 0x222a: 0x00cc, 0x222b: 0x00cc, 0x222c: 0x00cc, 0x222d: 0x00cc, 0x222e: 0x00cc, 0x222f: 0x00cc, - 0x2230: 0x00cc, 0x2231: 0x00cc, 0x2232: 0x00cc, 0x2233: 0x00cc, 0x2234: 0x00cc, 0x2235: 0x00cc, - 0x2236: 0x00cc, 0x2237: 0x00cc, 0x2238: 0x00cc, 0x2239: 0x00cc, 0x223a: 0x00cc, 0x223b: 0x00cc, - 0x223c: 0x00cc, 0x223d: 0x00cc, 0x223e: 0x00cc, 0x223f: 0x00cc, - // Block 0x89, offset 0x2240 - 0x2240: 0x00cc, 0x2241: 0x00cc, 0x2242: 0x00cc, 0x2243: 0x00cc, 0x2244: 0x00cc, 0x2245: 0x00cc, - 0x2246: 0x00cc, 0x2247: 0x00cc, 0x2248: 0x00cc, 0x2249: 0x00cc, 0x224a: 0x00cc, 0x224b: 0x00cc, - 0x224c: 0x00cc, 0x224d: 0x00cc, 0x224e: 0x00cc, 0x224f: 0x00cc, 0x2250: 0x00cc, 0x2251: 0x00cc, - 0x2252: 0x00cc, 0x2253: 0x00cc, 0x2254: 0x00cc, 0x2255: 0x00cc, 0x2256: 0x00cc, - 0x2259: 0x00c3, 0x225a: 0x00c3, 0x225b: 0x0080, 0x225c: 0x0080, 0x225d: 0x00cc, - 0x225e: 0x00cc, 0x225f: 0x008c, 0x2260: 0x0080, 0x2261: 0x00cc, 0x2262: 0x00cc, 0x2263: 0x00cc, - 0x2264: 0x00cc, 0x2265: 0x00cc, 0x2266: 0x00cc, 0x2267: 0x00cc, 0x2268: 0x00cc, 0x2269: 0x00cc, - 0x226a: 0x00cc, 0x226b: 0x00cc, 0x226c: 0x00cc, 0x226d: 0x00cc, 0x226e: 0x00cc, 0x226f: 0x00cc, - 0x2270: 0x00cc, 0x2271: 0x00cc, 0x2272: 0x00cc, 0x2273: 0x00cc, 0x2274: 0x00cc, 0x2275: 0x00cc, - 0x2276: 0x00cc, 0x2277: 0x00cc, 0x2278: 0x00cc, 0x2279: 0x00cc, 0x227a: 0x00cc, 0x227b: 0x00cc, - 0x227c: 0x00cc, 0x227d: 0x00cc, 0x227e: 0x00cc, 0x227f: 0x00cc, - // Block 0x8a, offset 0x2280 - 0x2280: 0x00cc, 0x2281: 0x00cc, 0x2282: 0x00cc, 0x2283: 0x00cc, 0x2284: 0x00cc, 0x2285: 0x00cc, - 0x2286: 0x00cc, 0x2287: 0x00cc, 0x2288: 0x00cc, 0x2289: 0x00cc, 0x228a: 0x00cc, 0x228b: 0x00cc, - 0x228c: 0x00cc, 0x228d: 0x00cc, 0x228e: 0x00cc, 0x228f: 0x00cc, 0x2290: 0x00cc, 0x2291: 0x00cc, - 0x2292: 0x00cc, 0x2293: 0x00cc, 0x2294: 0x00cc, 0x2295: 0x00cc, 0x2296: 0x00cc, 0x2297: 0x00cc, - 0x2298: 0x00cc, 0x2299: 0x00cc, 0x229a: 0x00cc, 0x229b: 0x00cc, 0x229c: 0x00cc, 0x229d: 0x00cc, - 0x229e: 0x00cc, 0x229f: 0x00cc, 0x22a0: 0x00cc, 0x22a1: 0x00cc, 0x22a2: 0x00cc, 0x22a3: 0x00cc, - 0x22a4: 0x00cc, 0x22a5: 0x00cc, 0x22a6: 0x00cc, 0x22a7: 0x00cc, 0x22a8: 0x00cc, 0x22a9: 0x00cc, - 0x22aa: 0x00cc, 0x22ab: 0x00cc, 0x22ac: 0x00cc, 0x22ad: 0x00cc, 0x22ae: 0x00cc, 0x22af: 0x00cc, - 0x22b0: 0x00cc, 0x22b1: 0x00cc, 0x22b2: 0x00cc, 0x22b3: 0x00cc, 0x22b4: 0x00cc, 0x22b5: 0x00cc, - 0x22b6: 0x00cc, 0x22b7: 0x00cc, 0x22b8: 0x00cc, 0x22b9: 0x00cc, 0x22ba: 0x00cc, 0x22bb: 0x00d2, - 0x22bc: 0x00c0, 0x22bd: 0x00cc, 0x22be: 0x00cc, 0x22bf: 0x008c, - // Block 0x8b, offset 0x22c0 - 0x22c5: 0x00c0, - 0x22c6: 0x00c0, 0x22c7: 0x00c0, 0x22c8: 0x00c0, 0x22c9: 0x00c0, 0x22ca: 0x00c0, 0x22cb: 0x00c0, - 0x22cc: 0x00c0, 0x22cd: 0x00c0, 0x22ce: 0x00c0, 0x22cf: 0x00c0, 0x22d0: 0x00c0, 0x22d1: 0x00c0, - 0x22d2: 0x00c0, 0x22d3: 0x00c0, 0x22d4: 0x00c0, 0x22d5: 0x00c0, 0x22d6: 0x00c0, 0x22d7: 0x00c0, - 0x22d8: 0x00c0, 0x22d9: 0x00c0, 0x22da: 0x00c0, 0x22db: 0x00c0, 0x22dc: 0x00c0, 0x22dd: 0x00c0, - 0x22de: 0x00c0, 0x22df: 0x00c0, 0x22e0: 0x00c0, 0x22e1: 0x00c0, 0x22e2: 0x00c0, 0x22e3: 0x00c0, - 0x22e4: 0x00c0, 0x22e5: 0x00c0, 0x22e6: 0x00c0, 0x22e7: 0x00c0, 0x22e8: 0x00c0, 0x22e9: 0x00c0, - 0x22ea: 0x00c0, 0x22eb: 0x00c0, 0x22ec: 0x00c0, 0x22ed: 0x00c0, - 0x22f1: 0x0080, 0x22f2: 0x0080, 0x22f3: 0x0080, 0x22f4: 0x0080, 0x22f5: 0x0080, - 0x22f6: 0x0080, 0x22f7: 0x0080, 0x22f8: 0x0080, 0x22f9: 0x0080, 0x22fa: 0x0080, 0x22fb: 0x0080, - 0x22fc: 0x0080, 0x22fd: 0x0080, 0x22fe: 0x0080, 0x22ff: 0x0080, - // Block 0x8c, offset 0x2300 - 0x2300: 0x0080, 0x2301: 0x0080, 0x2302: 0x0080, 0x2303: 0x0080, 0x2304: 0x0080, 0x2305: 0x0080, - 0x2306: 0x0080, 0x2307: 0x0080, 0x2308: 0x0080, 0x2309: 0x0080, 0x230a: 0x0080, 0x230b: 0x0080, - 0x230c: 0x0080, 0x230d: 0x0080, 0x230e: 0x0080, 0x230f: 0x0080, 0x2310: 0x0080, 0x2311: 0x0080, - 0x2312: 0x0080, 0x2313: 0x0080, 0x2314: 0x0080, 0x2315: 0x0080, 0x2316: 0x0080, 0x2317: 0x0080, - 0x2318: 0x0080, 0x2319: 0x0080, 0x231a: 0x0080, 0x231b: 0x0080, 0x231c: 0x0080, 0x231d: 0x0080, - 0x231e: 0x0080, 0x231f: 0x0080, 0x2320: 0x0080, 0x2321: 0x0080, 0x2322: 0x0080, 0x2323: 0x0080, - 0x2324: 0x0040, 0x2325: 0x0080, 0x2326: 0x0080, 0x2327: 0x0080, 0x2328: 0x0080, 0x2329: 0x0080, - 0x232a: 0x0080, 0x232b: 0x0080, 0x232c: 0x0080, 0x232d: 0x0080, 0x232e: 0x0080, 0x232f: 0x0080, - 0x2330: 0x0080, 0x2331: 0x0080, 0x2332: 0x0080, 0x2333: 0x0080, 0x2334: 0x0080, 0x2335: 0x0080, - 0x2336: 0x0080, 0x2337: 0x0080, 0x2338: 0x0080, 0x2339: 0x0080, 0x233a: 0x0080, 0x233b: 0x0080, - 0x233c: 0x0080, 0x233d: 0x0080, 0x233e: 0x0080, 0x233f: 0x0080, - // Block 0x8d, offset 0x2340 - 0x2340: 0x0080, 0x2341: 0x0080, 0x2342: 0x0080, 0x2343: 0x0080, 0x2344: 0x0080, 0x2345: 0x0080, - 0x2346: 0x0080, 0x2347: 0x0080, 0x2348: 0x0080, 0x2349: 0x0080, 0x234a: 0x0080, 0x234b: 0x0080, - 0x234c: 0x0080, 0x234d: 0x0080, 0x234e: 0x0080, 0x2350: 0x0080, 0x2351: 0x0080, - 0x2352: 0x0080, 0x2353: 0x0080, 0x2354: 0x0080, 0x2355: 0x0080, 0x2356: 0x0080, 0x2357: 0x0080, - 0x2358: 0x0080, 0x2359: 0x0080, 0x235a: 0x0080, 0x235b: 0x0080, 0x235c: 0x0080, 0x235d: 0x0080, - 0x235e: 0x0080, 0x235f: 0x0080, 0x2360: 0x00c0, 0x2361: 0x00c0, 0x2362: 0x00c0, 0x2363: 0x00c0, - 0x2364: 0x00c0, 0x2365: 0x00c0, 0x2366: 0x00c0, 0x2367: 0x00c0, 0x2368: 0x00c0, 0x2369: 0x00c0, - 0x236a: 0x00c0, 0x236b: 0x00c0, 0x236c: 0x00c0, 0x236d: 0x00c0, 0x236e: 0x00c0, 0x236f: 0x00c0, - 0x2370: 0x00c0, 0x2371: 0x00c0, 0x2372: 0x00c0, 0x2373: 0x00c0, 0x2374: 0x00c0, 0x2375: 0x00c0, - 0x2376: 0x00c0, 0x2377: 0x00c0, 0x2378: 0x00c0, 0x2379: 0x00c0, 0x237a: 0x00c0, - // Block 0x8e, offset 0x2380 - 0x2380: 0x0080, 0x2381: 0x0080, 0x2382: 0x0080, 0x2383: 0x0080, 0x2384: 0x0080, 0x2385: 0x0080, - 0x2386: 0x0080, 0x2387: 0x0080, 0x2388: 0x0080, 0x2389: 0x0080, 0x238a: 0x0080, 0x238b: 0x0080, - 0x238c: 0x0080, 0x238d: 0x0080, 0x238e: 0x0080, 0x238f: 0x0080, 0x2390: 0x0080, 0x2391: 0x0080, - 0x2392: 0x0080, 0x2393: 0x0080, 0x2394: 0x0080, 0x2395: 0x0080, 0x2396: 0x0080, 0x2397: 0x0080, - 0x2398: 0x0080, 0x2399: 0x0080, 0x239a: 0x0080, 0x239b: 0x0080, 0x239c: 0x0080, 0x239d: 0x0080, - 0x239e: 0x0080, 0x239f: 0x0080, 0x23a0: 0x0080, 0x23a1: 0x0080, 0x23a2: 0x0080, 0x23a3: 0x0080, - 0x23b0: 0x00cc, 0x23b1: 0x00cc, 0x23b2: 0x00cc, 0x23b3: 0x00cc, 0x23b4: 0x00cc, 0x23b5: 0x00cc, - 0x23b6: 0x00cc, 0x23b7: 0x00cc, 0x23b8: 0x00cc, 0x23b9: 0x00cc, 0x23ba: 0x00cc, 0x23bb: 0x00cc, - 0x23bc: 0x00cc, 0x23bd: 0x00cc, 0x23be: 0x00cc, 0x23bf: 0x00cc, - // Block 0x8f, offset 0x23c0 - 0x23c0: 0x0080, 0x23c1: 0x0080, 0x23c2: 0x0080, 0x23c3: 0x0080, 0x23c4: 0x0080, 0x23c5: 0x0080, - 0x23c6: 0x0080, 0x23c7: 0x0080, 0x23c8: 0x0080, 0x23c9: 0x0080, 0x23ca: 0x0080, 0x23cb: 0x0080, - 0x23cc: 0x0080, 0x23cd: 0x0080, 0x23ce: 0x0080, 0x23cf: 0x0080, 0x23d0: 0x0080, 0x23d1: 0x0080, - 0x23d2: 0x0080, 0x23d3: 0x0080, 0x23d4: 0x0080, 0x23d5: 0x0080, 0x23d6: 0x0080, 0x23d7: 0x0080, - 0x23d8: 0x0080, 0x23d9: 0x0080, 0x23da: 0x0080, 0x23db: 0x0080, 0x23dc: 0x0080, 0x23dd: 0x0080, - 0x23de: 0x0080, 0x23e0: 0x0080, 0x23e1: 0x0080, 0x23e2: 0x0080, 0x23e3: 0x0080, - 0x23e4: 0x0080, 0x23e5: 0x0080, 0x23e6: 0x0080, 0x23e7: 0x0080, 0x23e8: 0x0080, 0x23e9: 0x0080, - 0x23ea: 0x0080, 0x23eb: 0x0080, 0x23ec: 0x0080, 0x23ed: 0x0080, 0x23ee: 0x0080, 0x23ef: 0x0080, - 0x23f0: 0x0080, 0x23f1: 0x0080, 0x23f2: 0x0080, 0x23f3: 0x0080, 0x23f4: 0x0080, 0x23f5: 0x0080, - 0x23f6: 0x0080, 0x23f7: 0x0080, 0x23f8: 0x0080, 0x23f9: 0x0080, 0x23fa: 0x0080, 0x23fb: 0x0080, - 0x23fc: 0x0080, 0x23fd: 0x0080, 0x23fe: 0x0080, 0x23ff: 0x0080, - // Block 0x90, offset 0x2400 - 0x2400: 0x0080, 0x2401: 0x0080, 0x2402: 0x0080, 0x2403: 0x0080, 0x2404: 0x0080, 0x2405: 0x0080, - 0x2406: 0x0080, 0x2407: 0x0080, 0x2408: 0x0080, 0x2409: 0x0080, 0x240a: 0x0080, 0x240b: 0x0080, - 0x240c: 0x0080, 0x240d: 0x0080, 0x240e: 0x0080, 0x240f: 0x0080, 0x2410: 0x008c, 0x2411: 0x008c, - 0x2412: 0x008c, 0x2413: 0x008c, 0x2414: 0x008c, 0x2415: 0x008c, 0x2416: 0x008c, 0x2417: 0x008c, - 0x2418: 0x008c, 0x2419: 0x008c, 0x241a: 0x008c, 0x241b: 0x008c, 0x241c: 0x008c, 0x241d: 0x008c, - 0x241e: 0x008c, 0x241f: 0x008c, 0x2420: 0x008c, 0x2421: 0x008c, 0x2422: 0x008c, 0x2423: 0x008c, - 0x2424: 0x008c, 0x2425: 0x008c, 0x2426: 0x008c, 0x2427: 0x008c, 0x2428: 0x008c, 0x2429: 0x008c, - 0x242a: 0x008c, 0x242b: 0x008c, 0x242c: 0x008c, 0x242d: 0x008c, 0x242e: 0x008c, 0x242f: 0x008c, - 0x2430: 0x008c, 0x2431: 0x008c, 0x2432: 0x008c, 0x2433: 0x008c, 0x2434: 0x008c, 0x2435: 0x008c, - 0x2436: 0x008c, 0x2437: 0x008c, 0x2438: 0x008c, 0x2439: 0x008c, 0x243a: 0x008c, 0x243b: 0x008c, - 0x243c: 0x008c, 0x243d: 0x008c, 0x243e: 0x008c, - // Block 0x91, offset 0x2440 - 0x2440: 0x008c, 0x2441: 0x008c, 0x2442: 0x008c, 0x2443: 0x008c, 0x2444: 0x008c, 0x2445: 0x008c, - 0x2446: 0x008c, 0x2447: 0x008c, 0x2448: 0x008c, 0x2449: 0x008c, 0x244a: 0x008c, 0x244b: 0x008c, - 0x244c: 0x008c, 0x244d: 0x008c, 0x244e: 0x008c, 0x244f: 0x008c, 0x2450: 0x008c, 0x2451: 0x008c, - 0x2452: 0x008c, 0x2453: 0x008c, 0x2454: 0x008c, 0x2455: 0x008c, 0x2456: 0x008c, 0x2457: 0x008c, - 0x2458: 0x0080, 0x2459: 0x0080, 0x245a: 0x0080, 0x245b: 0x0080, 0x245c: 0x0080, 0x245d: 0x0080, - 0x245e: 0x0080, 0x245f: 0x0080, 0x2460: 0x0080, 0x2461: 0x0080, 0x2462: 0x0080, 0x2463: 0x0080, - 0x2464: 0x0080, 0x2465: 0x0080, 0x2466: 0x0080, 0x2467: 0x0080, 0x2468: 0x0080, 0x2469: 0x0080, - 0x246a: 0x0080, 0x246b: 0x0080, 0x246c: 0x0080, 0x246d: 0x0080, 0x246e: 0x0080, 0x246f: 0x0080, - 0x2470: 0x0080, 0x2471: 0x0080, 0x2472: 0x0080, 0x2473: 0x0080, 0x2474: 0x0080, 0x2475: 0x0080, - 0x2476: 0x0080, 0x2477: 0x0080, 0x2478: 0x0080, 0x2479: 0x0080, 0x247a: 0x0080, 0x247b: 0x0080, - 0x247c: 0x0080, 0x247d: 0x0080, 0x247e: 0x0080, 0x247f: 0x0080, - // Block 0x92, offset 0x2480 - 0x2480: 0x00cc, 0x2481: 0x00cc, 0x2482: 0x00cc, 0x2483: 0x00cc, 0x2484: 0x00cc, 0x2485: 0x00cc, - 0x2486: 0x00cc, 0x2487: 0x00cc, 0x2488: 0x00cc, 0x2489: 0x00cc, 0x248a: 0x00cc, 0x248b: 0x00cc, - 0x248c: 0x00cc, 0x248d: 0x00cc, 0x248e: 0x00cc, 0x248f: 0x00cc, 0x2490: 0x00cc, 0x2491: 0x00cc, - 0x2492: 0x00cc, 0x2493: 0x00cc, 0x2494: 0x00cc, 0x2495: 0x00cc, 0x2496: 0x00cc, 0x2497: 0x00cc, - 0x2498: 0x00cc, 0x2499: 0x00cc, 0x249a: 0x00cc, 0x249b: 0x00cc, 0x249c: 0x00cc, 0x249d: 0x00cc, - 0x249e: 0x00cc, 0x249f: 0x00cc, 0x24a0: 0x00cc, 0x24a1: 0x00cc, 0x24a2: 0x00cc, 0x24a3: 0x00cc, - 0x24a4: 0x00cc, 0x24a5: 0x00cc, 0x24a6: 0x00cc, 0x24a7: 0x00cc, 0x24a8: 0x00cc, 0x24a9: 0x00cc, - 0x24aa: 0x00cc, 0x24ab: 0x00cc, 0x24ac: 0x00cc, 0x24ad: 0x00cc, 0x24ae: 0x00cc, 0x24af: 0x00cc, - 0x24b0: 0x00cc, 0x24b1: 0x00cc, 0x24b2: 0x00cc, 0x24b3: 0x00cc, 0x24b4: 0x00cc, 0x24b5: 0x00cc, - 0x24b6: 0x00cc, 0x24b7: 0x00cc, 0x24b8: 0x00cc, 0x24b9: 0x00cc, 0x24ba: 0x00cc, 0x24bb: 0x00cc, - 0x24bc: 0x00cc, 0x24bd: 0x00cc, 0x24be: 0x00cc, 0x24bf: 0x00cc, - // Block 0x93, offset 0x24c0 - 0x24c0: 0x00cc, 0x24c1: 0x00cc, 0x24c2: 0x00cc, 0x24c3: 0x00cc, 0x24c4: 0x00cc, 0x24c5: 0x00cc, - 0x24c6: 0x00cc, 0x24c7: 0x00cc, 0x24c8: 0x00cc, 0x24c9: 0x00cc, 0x24ca: 0x00cc, 0x24cb: 0x00cc, - 0x24cc: 0x00cc, 0x24cd: 0x00cc, 0x24ce: 0x00cc, 0x24cf: 0x00cc, 0x24d0: 0x00cc, 0x24d1: 0x00cc, - 0x24d2: 0x00cc, 0x24d3: 0x00cc, 0x24d4: 0x00cc, 0x24d5: 0x00cc, 0x24d6: 0x00cc, 0x24d7: 0x00cc, - 0x24d8: 0x00cc, 0x24d9: 0x00cc, 0x24da: 0x00cc, 0x24db: 0x00cc, 0x24dc: 0x00cc, 0x24dd: 0x00cc, - 0x24de: 0x00cc, 0x24df: 0x00cc, 0x24e0: 0x00cc, 0x24e1: 0x00cc, 0x24e2: 0x00cc, 0x24e3: 0x00cc, - 0x24e4: 0x00cc, 0x24e5: 0x00cc, 0x24e6: 0x00cc, 0x24e7: 0x00cc, 0x24e8: 0x00cc, 0x24e9: 0x00cc, - 0x24ea: 0x00cc, 0x24eb: 0x00cc, 0x24ec: 0x00cc, 0x24ed: 0x00cc, 0x24ee: 0x00cc, 0x24ef: 0x00cc, - 0x24f0: 0x00cc, 0x24f1: 0x00cc, 0x24f2: 0x00cc, 0x24f3: 0x00cc, 0x24f4: 0x00cc, 0x24f5: 0x00cc, - // Block 0x94, offset 0x2500 - 0x2500: 0x00cc, 0x2501: 0x00cc, 0x2502: 0x00cc, 0x2503: 0x00cc, 0x2504: 0x00cc, 0x2505: 0x00cc, - 0x2506: 0x00cc, 0x2507: 0x00cc, 0x2508: 0x00cc, 0x2509: 0x00cc, 0x250a: 0x00cc, 0x250b: 0x00cc, - 0x250c: 0x00cc, 0x250d: 0x00cc, 0x250e: 0x00cc, 0x250f: 0x00cc, 0x2510: 0x00cc, 0x2511: 0x00cc, - 0x2512: 0x00cc, 0x2513: 0x00cc, 0x2514: 0x00cc, 0x2515: 0x00cc, - // Block 0x95, offset 0x2540 - 0x2540: 0x00c0, 0x2541: 0x00c0, 0x2542: 0x00c0, 0x2543: 0x00c0, 0x2544: 0x00c0, 0x2545: 0x00c0, - 0x2546: 0x00c0, 0x2547: 0x00c0, 0x2548: 0x00c0, 0x2549: 0x00c0, 0x254a: 0x00c0, 0x254b: 0x00c0, - 0x254c: 0x00c0, 0x2550: 0x0080, 0x2551: 0x0080, - 0x2552: 0x0080, 0x2553: 0x0080, 0x2554: 0x0080, 0x2555: 0x0080, 0x2556: 0x0080, 0x2557: 0x0080, - 0x2558: 0x0080, 0x2559: 0x0080, 0x255a: 0x0080, 0x255b: 0x0080, 0x255c: 0x0080, 0x255d: 0x0080, - 0x255e: 0x0080, 0x255f: 0x0080, 0x2560: 0x0080, 0x2561: 0x0080, 0x2562: 0x0080, 0x2563: 0x0080, - 0x2564: 0x0080, 0x2565: 0x0080, 0x2566: 0x0080, 0x2567: 0x0080, 0x2568: 0x0080, 0x2569: 0x0080, - 0x256a: 0x0080, 0x256b: 0x0080, 0x256c: 0x0080, 0x256d: 0x0080, 0x256e: 0x0080, 0x256f: 0x0080, - 0x2570: 0x0080, 0x2571: 0x0080, 0x2572: 0x0080, 0x2573: 0x0080, 0x2574: 0x0080, 0x2575: 0x0080, - 0x2576: 0x0080, 0x2577: 0x0080, 0x2578: 0x0080, 0x2579: 0x0080, 0x257a: 0x0080, 0x257b: 0x0080, - 0x257c: 0x0080, 0x257d: 0x0080, 0x257e: 0x0080, 0x257f: 0x0080, - // Block 0x96, offset 0x2580 - 0x2580: 0x0080, 0x2581: 0x0080, 0x2582: 0x0080, 0x2583: 0x0080, 0x2584: 0x0080, 0x2585: 0x0080, - 0x2586: 0x0080, - 0x2590: 0x00c0, 0x2591: 0x00c0, - 0x2592: 0x00c0, 0x2593: 0x00c0, 0x2594: 0x00c0, 0x2595: 0x00c0, 0x2596: 0x00c0, 0x2597: 0x00c0, - 0x2598: 0x00c0, 0x2599: 0x00c0, 0x259a: 0x00c0, 0x259b: 0x00c0, 0x259c: 0x00c0, 0x259d: 0x00c0, - 0x259e: 0x00c0, 0x259f: 0x00c0, 0x25a0: 0x00c0, 0x25a1: 0x00c0, 0x25a2: 0x00c0, 0x25a3: 0x00c0, - 0x25a4: 0x00c0, 0x25a5: 0x00c0, 0x25a6: 0x00c0, 0x25a7: 0x00c0, 0x25a8: 0x00c0, 0x25a9: 0x00c0, - 0x25aa: 0x00c0, 0x25ab: 0x00c0, 0x25ac: 0x00c0, 0x25ad: 0x00c0, 0x25ae: 0x00c0, 0x25af: 0x00c0, - 0x25b0: 0x00c0, 0x25b1: 0x00c0, 0x25b2: 0x00c0, 0x25b3: 0x00c0, 0x25b4: 0x00c0, 0x25b5: 0x00c0, - 0x25b6: 0x00c0, 0x25b7: 0x00c0, 0x25b8: 0x00c0, 0x25b9: 0x00c0, 0x25ba: 0x00c0, 0x25bb: 0x00c0, - 0x25bc: 0x00c0, 0x25bd: 0x00c0, 0x25be: 0x0080, 0x25bf: 0x0080, - // Block 0x97, offset 0x25c0 - 0x25c0: 0x00c0, 0x25c1: 0x00c0, 0x25c2: 0x00c0, 0x25c3: 0x00c0, 0x25c4: 0x00c0, 0x25c5: 0x00c0, - 0x25c6: 0x00c0, 0x25c7: 0x00c0, 0x25c8: 0x00c0, 0x25c9: 0x00c0, 0x25ca: 0x00c0, 0x25cb: 0x00c0, - 0x25cc: 0x00c0, 0x25cd: 0x0080, 0x25ce: 0x0080, 0x25cf: 0x0080, 0x25d0: 0x00c0, 0x25d1: 0x00c0, - 0x25d2: 0x00c0, 0x25d3: 0x00c0, 0x25d4: 0x00c0, 0x25d5: 0x00c0, 0x25d6: 0x00c0, 0x25d7: 0x00c0, - 0x25d8: 0x00c0, 0x25d9: 0x00c0, 0x25da: 0x00c0, 0x25db: 0x00c0, 0x25dc: 0x00c0, 0x25dd: 0x00c0, - 0x25de: 0x00c0, 0x25df: 0x00c0, 0x25e0: 0x00c0, 0x25e1: 0x00c0, 0x25e2: 0x00c0, 0x25e3: 0x00c0, - 0x25e4: 0x00c0, 0x25e5: 0x00c0, 0x25e6: 0x00c0, 0x25e7: 0x00c0, 0x25e8: 0x00c0, 0x25e9: 0x00c0, - 0x25ea: 0x00c0, 0x25eb: 0x00c0, - // Block 0x98, offset 0x2600 - 0x2600: 0x00c0, 0x2601: 0x00c0, 0x2602: 0x00c0, 0x2603: 0x00c0, 0x2604: 0x00c0, 0x2605: 0x00c0, - 0x2606: 0x00c0, 0x2607: 0x00c0, 0x2608: 0x00c0, 0x2609: 0x00c0, 0x260a: 0x00c0, 0x260b: 0x00c0, - 0x260c: 0x00c0, 0x260d: 0x00c0, 0x260e: 0x00c0, 0x260f: 0x00c0, 0x2610: 0x00c0, 0x2611: 0x00c0, - 0x2612: 0x00c0, 0x2613: 0x00c0, 0x2614: 0x00c0, 0x2615: 0x00c0, 0x2616: 0x00c0, 0x2617: 0x00c0, - 0x2618: 0x00c0, 0x2619: 0x00c0, 0x261a: 0x00c0, 0x261b: 0x00c0, 0x261c: 0x00c0, 0x261d: 0x00c0, - 0x261e: 0x00c0, 0x261f: 0x00c0, 0x2620: 0x00c0, 0x2621: 0x00c0, 0x2622: 0x00c0, 0x2623: 0x00c0, - 0x2624: 0x00c0, 0x2625: 0x00c0, 0x2626: 0x00c0, 0x2627: 0x00c0, 0x2628: 0x00c0, 0x2629: 0x00c0, - 0x262a: 0x00c0, 0x262b: 0x00c0, 0x262c: 0x00c0, 0x262d: 0x00c0, 0x262e: 0x00c0, 0x262f: 0x00c3, - 0x2630: 0x0083, 0x2631: 0x0083, 0x2632: 0x0083, 0x2633: 0x0080, 0x2634: 0x00c3, 0x2635: 0x00c3, - 0x2636: 0x00c3, 0x2637: 0x00c3, 0x2638: 0x00c3, 0x2639: 0x00c3, 0x263a: 0x00c3, 0x263b: 0x00c3, - 0x263c: 0x00c3, 0x263d: 0x00c3, 0x263e: 0x0080, 0x263f: 0x00c0, - // Block 0x99, offset 0x2640 - 0x2640: 0x00c0, 0x2641: 0x00c0, 0x2642: 0x00c0, 0x2643: 0x00c0, 0x2644: 0x00c0, 0x2645: 0x00c0, - 0x2646: 0x00c0, 0x2647: 0x00c0, 0x2648: 0x00c0, 0x2649: 0x00c0, 0x264a: 0x00c0, 0x264b: 0x00c0, - 0x264c: 0x00c0, 0x264d: 0x00c0, 0x264e: 0x00c0, 0x264f: 0x00c0, 0x2650: 0x00c0, 0x2651: 0x00c0, - 0x2652: 0x00c0, 0x2653: 0x00c0, 0x2654: 0x00c0, 0x2655: 0x00c0, 0x2656: 0x00c0, 0x2657: 0x00c0, - 0x2658: 0x00c0, 0x2659: 0x00c0, 0x265a: 0x00c0, 0x265b: 0x00c0, 0x265c: 0x0080, 0x265d: 0x0080, - 0x265e: 0x00c3, 0x265f: 0x00c3, 0x2660: 0x00c0, 0x2661: 0x00c0, 0x2662: 0x00c0, 0x2663: 0x00c0, - 0x2664: 0x00c0, 0x2665: 0x00c0, 0x2666: 0x00c0, 0x2667: 0x00c0, 0x2668: 0x00c0, 0x2669: 0x00c0, - 0x266a: 0x00c0, 0x266b: 0x00c0, 0x266c: 0x00c0, 0x266d: 0x00c0, 0x266e: 0x00c0, 0x266f: 0x00c0, - 0x2670: 0x00c0, 0x2671: 0x00c0, 0x2672: 0x00c0, 0x2673: 0x00c0, 0x2674: 0x00c0, 0x2675: 0x00c0, - 0x2676: 0x00c0, 0x2677: 0x00c0, 0x2678: 0x00c0, 0x2679: 0x00c0, 0x267a: 0x00c0, 0x267b: 0x00c0, - 0x267c: 0x00c0, 0x267d: 0x00c0, 0x267e: 0x00c0, 0x267f: 0x00c0, - // Block 0x9a, offset 0x2680 - 0x2680: 0x00c0, 0x2681: 0x00c0, 0x2682: 0x00c0, 0x2683: 0x00c0, 0x2684: 0x00c0, 0x2685: 0x00c0, - 0x2686: 0x00c0, 0x2687: 0x00c0, 0x2688: 0x00c0, 0x2689: 0x00c0, 0x268a: 0x00c0, 0x268b: 0x00c0, - 0x268c: 0x00c0, 0x268d: 0x00c0, 0x268e: 0x00c0, 0x268f: 0x00c0, 0x2690: 0x00c0, 0x2691: 0x00c0, - 0x2692: 0x00c0, 0x2693: 0x00c0, 0x2694: 0x00c0, 0x2695: 0x00c0, 0x2696: 0x00c0, 0x2697: 0x00c0, - 0x2698: 0x00c0, 0x2699: 0x00c0, 0x269a: 0x00c0, 0x269b: 0x00c0, 0x269c: 0x00c0, 0x269d: 0x00c0, - 0x269e: 0x00c0, 0x269f: 0x00c0, 0x26a0: 0x00c0, 0x26a1: 0x00c0, 0x26a2: 0x00c0, 0x26a3: 0x00c0, - 0x26a4: 0x00c0, 0x26a5: 0x00c0, 0x26a6: 0x0080, 0x26a7: 0x0080, 0x26a8: 0x0080, 0x26a9: 0x0080, - 0x26aa: 0x0080, 0x26ab: 0x0080, 0x26ac: 0x0080, 0x26ad: 0x0080, 0x26ae: 0x0080, 0x26af: 0x0080, - 0x26b0: 0x00c3, 0x26b1: 0x00c3, 0x26b2: 0x0080, 0x26b3: 0x0080, 0x26b4: 0x0080, 0x26b5: 0x0080, - 0x26b6: 0x0080, 0x26b7: 0x0080, - // Block 0x9b, offset 0x26c0 - 0x26c0: 0x0080, 0x26c1: 0x0080, 0x26c2: 0x0080, 0x26c3: 0x0080, 0x26c4: 0x0080, 0x26c5: 0x0080, - 0x26c6: 0x0080, 0x26c7: 0x0080, 0x26c8: 0x0080, 0x26c9: 0x0080, 0x26ca: 0x0080, 0x26cb: 0x0080, - 0x26cc: 0x0080, 0x26cd: 0x0080, 0x26ce: 0x0080, 0x26cf: 0x0080, 0x26d0: 0x0080, 0x26d1: 0x0080, - 0x26d2: 0x0080, 0x26d3: 0x0080, 0x26d4: 0x0080, 0x26d5: 0x0080, 0x26d6: 0x0080, 0x26d7: 0x00c0, - 0x26d8: 0x00c0, 0x26d9: 0x00c0, 0x26da: 0x00c0, 0x26db: 0x00c0, 0x26dc: 0x00c0, 0x26dd: 0x00c0, - 0x26de: 0x00c0, 0x26df: 0x00c0, 0x26e0: 0x0080, 0x26e1: 0x0080, 0x26e2: 0x00c0, 0x26e3: 0x00c0, - 0x26e4: 0x00c0, 0x26e5: 0x00c0, 0x26e6: 0x00c0, 0x26e7: 0x00c0, 0x26e8: 0x00c0, 0x26e9: 0x00c0, - 0x26ea: 0x00c0, 0x26eb: 0x00c0, 0x26ec: 0x00c0, 0x26ed: 0x00c0, 0x26ee: 0x00c0, 0x26ef: 0x00c0, - 0x26f0: 0x00c0, 0x26f1: 0x00c0, 0x26f2: 0x00c0, 0x26f3: 0x00c0, 0x26f4: 0x00c0, 0x26f5: 0x00c0, - 0x26f6: 0x00c0, 0x26f7: 0x00c0, 0x26f8: 0x00c0, 0x26f9: 0x00c0, 0x26fa: 0x00c0, 0x26fb: 0x00c0, - 0x26fc: 0x00c0, 0x26fd: 0x00c0, 0x26fe: 0x00c0, 0x26ff: 0x00c0, - // Block 0x9c, offset 0x2700 - 0x2700: 0x00c0, 0x2701: 0x00c0, 0x2702: 0x00c0, 0x2703: 0x00c0, 0x2704: 0x00c0, 0x2705: 0x00c0, - 0x2706: 0x00c0, 0x2707: 0x00c0, 0x2708: 0x00c0, 0x2709: 0x00c0, 0x270a: 0x00c0, 0x270b: 0x00c0, - 0x270c: 0x00c0, 0x270d: 0x00c0, 0x270e: 0x00c0, 0x270f: 0x00c0, 0x2710: 0x00c0, 0x2711: 0x00c0, - 0x2712: 0x00c0, 0x2713: 0x00c0, 0x2714: 0x00c0, 0x2715: 0x00c0, 0x2716: 0x00c0, 0x2717: 0x00c0, - 0x2718: 0x00c0, 0x2719: 0x00c0, 0x271a: 0x00c0, 0x271b: 0x00c0, 0x271c: 0x00c0, 0x271d: 0x00c0, - 0x271e: 0x00c0, 0x271f: 0x00c0, 0x2720: 0x00c0, 0x2721: 0x00c0, 0x2722: 0x00c0, 0x2723: 0x00c0, - 0x2724: 0x00c0, 0x2725: 0x00c0, 0x2726: 0x00c0, 0x2727: 0x00c0, 0x2728: 0x00c0, 0x2729: 0x00c0, - 0x272a: 0x00c0, 0x272b: 0x00c0, 0x272c: 0x00c0, 0x272d: 0x00c0, 0x272e: 0x00c0, 0x272f: 0x00c0, - 0x2730: 0x0080, 0x2731: 0x00c0, 0x2732: 0x00c0, 0x2733: 0x00c0, 0x2734: 0x00c0, 0x2735: 0x00c0, - 0x2736: 0x00c0, 0x2737: 0x00c0, 0x2738: 0x00c0, 0x2739: 0x00c0, 0x273a: 0x00c0, 0x273b: 0x00c0, - 0x273c: 0x00c0, 0x273d: 0x00c0, 0x273e: 0x00c0, 0x273f: 0x00c0, - // Block 0x9d, offset 0x2740 - 0x2740: 0x00c0, 0x2741: 0x00c0, 0x2742: 0x00c0, 0x2743: 0x00c0, 0x2744: 0x00c0, 0x2745: 0x00c0, - 0x2746: 0x00c0, 0x2747: 0x00c0, 0x2748: 0x00c0, 0x2749: 0x0080, 0x274a: 0x0080, 0x274b: 0x00c0, - 0x274c: 0x00c0, 0x274d: 0x00c0, 0x274e: 0x00c0, 0x274f: 0x00c0, 0x2750: 0x00c0, 0x2751: 0x00c0, - 0x2752: 0x00c0, 0x2753: 0x00c0, 0x2754: 0x00c0, 0x2755: 0x00c0, 0x2756: 0x00c0, 0x2757: 0x00c0, - 0x2758: 0x00c0, 0x2759: 0x00c0, 0x275a: 0x00c0, 0x275b: 0x00c0, 0x275c: 0x00c0, 0x275d: 0x00c0, - 0x275e: 0x00c0, 0x275f: 0x00c0, 0x2760: 0x00c0, 0x2761: 0x00c0, 0x2762: 0x00c0, 0x2763: 0x00c0, - 0x2764: 0x00c0, 0x2765: 0x00c0, 0x2766: 0x00c0, 0x2767: 0x00c0, 0x2768: 0x00c0, 0x2769: 0x00c0, - 0x276a: 0x00c0, 0x276b: 0x00c0, 0x276c: 0x00c0, 0x276d: 0x00c0, 0x276e: 0x00c0, - 0x2770: 0x00c0, 0x2771: 0x00c0, 0x2772: 0x00c0, 0x2773: 0x00c0, 0x2774: 0x00c0, 0x2775: 0x00c0, - 0x2776: 0x00c0, 0x2777: 0x00c0, - // Block 0x9e, offset 0x2780 - 0x27b7: 0x00c0, 0x27b8: 0x0080, 0x27b9: 0x0080, 0x27ba: 0x00c0, 0x27bb: 0x00c0, - 0x27bc: 0x00c0, 0x27bd: 0x00c0, 0x27be: 0x00c0, 0x27bf: 0x00c0, - // Block 0x9f, offset 0x27c0 - 0x27c0: 0x00c0, 0x27c1: 0x00c0, 0x27c2: 0x00c3, 0x27c3: 0x00c0, 0x27c4: 0x00c0, 0x27c5: 0x00c0, - 0x27c6: 0x00c6, 0x27c7: 0x00c0, 0x27c8: 0x00c0, 0x27c9: 0x00c0, 0x27ca: 0x00c0, 0x27cb: 0x00c3, - 0x27cc: 0x00c0, 0x27cd: 0x00c0, 0x27ce: 0x00c0, 0x27cf: 0x00c0, 0x27d0: 0x00c0, 0x27d1: 0x00c0, - 0x27d2: 0x00c0, 0x27d3: 0x00c0, 0x27d4: 0x00c0, 0x27d5: 0x00c0, 0x27d6: 0x00c0, 0x27d7: 0x00c0, - 0x27d8: 0x00c0, 0x27d9: 0x00c0, 0x27da: 0x00c0, 0x27db: 0x00c0, 0x27dc: 0x00c0, 0x27dd: 0x00c0, - 0x27de: 0x00c0, 0x27df: 0x00c0, 0x27e0: 0x00c0, 0x27e1: 0x00c0, 0x27e2: 0x00c0, 0x27e3: 0x00c0, - 0x27e4: 0x00c0, 0x27e5: 0x00c3, 0x27e6: 0x00c3, 0x27e7: 0x00c0, 0x27e8: 0x0080, 0x27e9: 0x0080, - 0x27ea: 0x0080, 0x27eb: 0x0080, - 0x27f0: 0x0080, 0x27f1: 0x0080, 0x27f2: 0x0080, 0x27f3: 0x0080, 0x27f4: 0x0080, 0x27f5: 0x0080, - 0x27f6: 0x0080, 0x27f7: 0x0080, 0x27f8: 0x0080, 0x27f9: 0x0080, - // Block 0xa0, offset 0x2800 - 0x2800: 0x00c2, 0x2801: 0x00c2, 0x2802: 0x00c2, 0x2803: 0x00c2, 0x2804: 0x00c2, 0x2805: 0x00c2, - 0x2806: 0x00c2, 0x2807: 0x00c2, 0x2808: 0x00c2, 0x2809: 0x00c2, 0x280a: 0x00c2, 0x280b: 0x00c2, - 0x280c: 0x00c2, 0x280d: 0x00c2, 0x280e: 0x00c2, 0x280f: 0x00c2, 0x2810: 0x00c2, 0x2811: 0x00c2, - 0x2812: 0x00c2, 0x2813: 0x00c2, 0x2814: 0x00c2, 0x2815: 0x00c2, 0x2816: 0x00c2, 0x2817: 0x00c2, - 0x2818: 0x00c2, 0x2819: 0x00c2, 0x281a: 0x00c2, 0x281b: 0x00c2, 0x281c: 0x00c2, 0x281d: 0x00c2, - 0x281e: 0x00c2, 0x281f: 0x00c2, 0x2820: 0x00c2, 0x2821: 0x00c2, 0x2822: 0x00c2, 0x2823: 0x00c2, - 0x2824: 0x00c2, 0x2825: 0x00c2, 0x2826: 0x00c2, 0x2827: 0x00c2, 0x2828: 0x00c2, 0x2829: 0x00c2, - 0x282a: 0x00c2, 0x282b: 0x00c2, 0x282c: 0x00c2, 0x282d: 0x00c2, 0x282e: 0x00c2, 0x282f: 0x00c2, - 0x2830: 0x00c2, 0x2831: 0x00c2, 0x2832: 0x00c1, 0x2833: 0x00c0, 0x2834: 0x0080, 0x2835: 0x0080, - 0x2836: 0x0080, 0x2837: 0x0080, - // Block 0xa1, offset 0x2840 - 0x2840: 0x00c0, 0x2841: 0x00c0, 0x2842: 0x00c0, 0x2843: 0x00c0, 0x2844: 0x00c6, 0x2845: 0x00c3, - 0x284e: 0x0080, 0x284f: 0x0080, 0x2850: 0x00c0, 0x2851: 0x00c0, - 0x2852: 0x00c0, 0x2853: 0x00c0, 0x2854: 0x00c0, 0x2855: 0x00c0, 0x2856: 0x00c0, 0x2857: 0x00c0, - 0x2858: 0x00c0, 0x2859: 0x00c0, - 0x2860: 0x00c3, 0x2861: 0x00c3, 0x2862: 0x00c3, 0x2863: 0x00c3, - 0x2864: 0x00c3, 0x2865: 0x00c3, 0x2866: 0x00c3, 0x2867: 0x00c3, 0x2868: 0x00c3, 0x2869: 0x00c3, - 0x286a: 0x00c3, 0x286b: 0x00c3, 0x286c: 0x00c3, 0x286d: 0x00c3, 0x286e: 0x00c3, 0x286f: 0x00c3, - 0x2870: 0x00c3, 0x2871: 0x00c3, 0x2872: 0x00c0, 0x2873: 0x00c0, 0x2874: 0x00c0, 0x2875: 0x00c0, - 0x2876: 0x00c0, 0x2877: 0x00c0, 0x2878: 0x0080, 0x2879: 0x0080, 0x287a: 0x0080, 0x287b: 0x00c0, - 0x287c: 0x0080, 0x287d: 0x00c0, - // Block 0xa2, offset 0x2880 - 0x2880: 0x00c0, 0x2881: 0x00c0, 0x2882: 0x00c0, 0x2883: 0x00c0, 0x2884: 0x00c0, 0x2885: 0x00c0, - 0x2886: 0x00c0, 0x2887: 0x00c0, 0x2888: 0x00c0, 0x2889: 0x00c0, 0x288a: 0x00c0, 0x288b: 0x00c0, - 0x288c: 0x00c0, 0x288d: 0x00c0, 0x288e: 0x00c0, 0x288f: 0x00c0, 0x2890: 0x00c0, 0x2891: 0x00c0, - 0x2892: 0x00c0, 0x2893: 0x00c0, 0x2894: 0x00c0, 0x2895: 0x00c0, 0x2896: 0x00c0, 0x2897: 0x00c0, - 0x2898: 0x00c0, 0x2899: 0x00c0, 0x289a: 0x00c0, 0x289b: 0x00c0, 0x289c: 0x00c0, 0x289d: 0x00c0, - 0x289e: 0x00c0, 0x289f: 0x00c0, 0x28a0: 0x00c0, 0x28a1: 0x00c0, 0x28a2: 0x00c0, 0x28a3: 0x00c0, - 0x28a4: 0x00c0, 0x28a5: 0x00c0, 0x28a6: 0x00c3, 0x28a7: 0x00c3, 0x28a8: 0x00c3, 0x28a9: 0x00c3, - 0x28aa: 0x00c3, 0x28ab: 0x00c3, 0x28ac: 0x00c3, 0x28ad: 0x00c3, 0x28ae: 0x0080, 0x28af: 0x0080, - 0x28b0: 0x00c0, 0x28b1: 0x00c0, 0x28b2: 0x00c0, 0x28b3: 0x00c0, 0x28b4: 0x00c0, 0x28b5: 0x00c0, - 0x28b6: 0x00c0, 0x28b7: 0x00c0, 0x28b8: 0x00c0, 0x28b9: 0x00c0, 0x28ba: 0x00c0, 0x28bb: 0x00c0, - 0x28bc: 0x00c0, 0x28bd: 0x00c0, 0x28be: 0x00c0, 0x28bf: 0x00c0, - // Block 0xa3, offset 0x28c0 - 0x28c0: 0x00c0, 0x28c1: 0x00c0, 0x28c2: 0x00c0, 0x28c3: 0x00c0, 0x28c4: 0x00c0, 0x28c5: 0x00c0, - 0x28c6: 0x00c0, 0x28c7: 0x00c3, 0x28c8: 0x00c3, 0x28c9: 0x00c3, 0x28ca: 0x00c3, 0x28cb: 0x00c3, - 0x28cc: 0x00c3, 0x28cd: 0x00c3, 0x28ce: 0x00c3, 0x28cf: 0x00c3, 0x28d0: 0x00c3, 0x28d1: 0x00c3, - 0x28d2: 0x00c0, 0x28d3: 0x00c5, - 0x28df: 0x0080, 0x28e0: 0x0040, 0x28e1: 0x0040, 0x28e2: 0x0040, 0x28e3: 0x0040, - 0x28e4: 0x0040, 0x28e5: 0x0040, 0x28e6: 0x0040, 0x28e7: 0x0040, 0x28e8: 0x0040, 0x28e9: 0x0040, - 0x28ea: 0x0040, 0x28eb: 0x0040, 0x28ec: 0x0040, 0x28ed: 0x0040, 0x28ee: 0x0040, 0x28ef: 0x0040, - 0x28f0: 0x0040, 0x28f1: 0x0040, 0x28f2: 0x0040, 0x28f3: 0x0040, 0x28f4: 0x0040, 0x28f5: 0x0040, - 0x28f6: 0x0040, 0x28f7: 0x0040, 0x28f8: 0x0040, 0x28f9: 0x0040, 0x28fa: 0x0040, 0x28fb: 0x0040, - 0x28fc: 0x0040, - // Block 0xa4, offset 0x2900 - 0x2900: 0x00c3, 0x2901: 0x00c3, 0x2902: 0x00c3, 0x2903: 0x00c0, 0x2904: 0x00c0, 0x2905: 0x00c0, - 0x2906: 0x00c0, 0x2907: 0x00c0, 0x2908: 0x00c0, 0x2909: 0x00c0, 0x290a: 0x00c0, 0x290b: 0x00c0, - 0x290c: 0x00c0, 0x290d: 0x00c0, 0x290e: 0x00c0, 0x290f: 0x00c0, 0x2910: 0x00c0, 0x2911: 0x00c0, - 0x2912: 0x00c0, 0x2913: 0x00c0, 0x2914: 0x00c0, 0x2915: 0x00c0, 0x2916: 0x00c0, 0x2917: 0x00c0, - 0x2918: 0x00c0, 0x2919: 0x00c0, 0x291a: 0x00c0, 0x291b: 0x00c0, 0x291c: 0x00c0, 0x291d: 0x00c0, - 0x291e: 0x00c0, 0x291f: 0x00c0, 0x2920: 0x00c0, 0x2921: 0x00c0, 0x2922: 0x00c0, 0x2923: 0x00c0, - 0x2924: 0x00c0, 0x2925: 0x00c0, 0x2926: 0x00c0, 0x2927: 0x00c0, 0x2928: 0x00c0, 0x2929: 0x00c0, - 0x292a: 0x00c0, 0x292b: 0x00c0, 0x292c: 0x00c0, 0x292d: 0x00c0, 0x292e: 0x00c0, 0x292f: 0x00c0, - 0x2930: 0x00c0, 0x2931: 0x00c0, 0x2932: 0x00c0, 0x2933: 0x00c3, 0x2934: 0x00c0, 0x2935: 0x00c0, - 0x2936: 0x00c3, 0x2937: 0x00c3, 0x2938: 0x00c3, 0x2939: 0x00c3, 0x293a: 0x00c0, 0x293b: 0x00c0, - 0x293c: 0x00c3, 0x293d: 0x00c0, 0x293e: 0x00c0, 0x293f: 0x00c0, - // Block 0xa5, offset 0x2940 - 0x2940: 0x00c5, 0x2941: 0x0080, 0x2942: 0x0080, 0x2943: 0x0080, 0x2944: 0x0080, 0x2945: 0x0080, - 0x2946: 0x0080, 0x2947: 0x0080, 0x2948: 0x0080, 0x2949: 0x0080, 0x294a: 0x0080, 0x294b: 0x0080, - 0x294c: 0x0080, 0x294d: 0x0080, 0x294f: 0x00c0, 0x2950: 0x00c0, 0x2951: 0x00c0, - 0x2952: 0x00c0, 0x2953: 0x00c0, 0x2954: 0x00c0, 0x2955: 0x00c0, 0x2956: 0x00c0, 0x2957: 0x00c0, - 0x2958: 0x00c0, 0x2959: 0x00c0, - 0x295e: 0x0080, 0x295f: 0x0080, 0x2960: 0x00c0, 0x2961: 0x00c0, 0x2962: 0x00c0, 0x2963: 0x00c0, - 0x2964: 0x00c0, 0x2965: 0x00c3, 0x2966: 0x00c0, 0x2967: 0x00c0, 0x2968: 0x00c0, 0x2969: 0x00c0, - 0x296a: 0x00c0, 0x296b: 0x00c0, 0x296c: 0x00c0, 0x296d: 0x00c0, 0x296e: 0x00c0, 0x296f: 0x00c0, - 0x2970: 0x00c0, 0x2971: 0x00c0, 0x2972: 0x00c0, 0x2973: 0x00c0, 0x2974: 0x00c0, 0x2975: 0x00c0, - 0x2976: 0x00c0, 0x2977: 0x00c0, 0x2978: 0x00c0, 0x2979: 0x00c0, 0x297a: 0x00c0, 0x297b: 0x00c0, - 0x297c: 0x00c0, 0x297d: 0x00c0, 0x297e: 0x00c0, - // Block 0xa6, offset 0x2980 - 0x2980: 0x00c0, 0x2981: 0x00c0, 0x2982: 0x00c0, 0x2983: 0x00c0, 0x2984: 0x00c0, 0x2985: 0x00c0, - 0x2986: 0x00c0, 0x2987: 0x00c0, 0x2988: 0x00c0, 0x2989: 0x00c0, 0x298a: 0x00c0, 0x298b: 0x00c0, - 0x298c: 0x00c0, 0x298d: 0x00c0, 0x298e: 0x00c0, 0x298f: 0x00c0, 0x2990: 0x00c0, 0x2991: 0x00c0, - 0x2992: 0x00c0, 0x2993: 0x00c0, 0x2994: 0x00c0, 0x2995: 0x00c0, 0x2996: 0x00c0, 0x2997: 0x00c0, - 0x2998: 0x00c0, 0x2999: 0x00c0, 0x299a: 0x00c0, 0x299b: 0x00c0, 0x299c: 0x00c0, 0x299d: 0x00c0, - 0x299e: 0x00c0, 0x299f: 0x00c0, 0x29a0: 0x00c0, 0x29a1: 0x00c0, 0x29a2: 0x00c0, 0x29a3: 0x00c0, - 0x29a4: 0x00c0, 0x29a5: 0x00c0, 0x29a6: 0x00c0, 0x29a7: 0x00c0, 0x29a8: 0x00c0, 0x29a9: 0x00c3, - 0x29aa: 0x00c3, 0x29ab: 0x00c3, 0x29ac: 0x00c3, 0x29ad: 0x00c3, 0x29ae: 0x00c3, 0x29af: 0x00c0, - 0x29b0: 0x00c0, 0x29b1: 0x00c3, 0x29b2: 0x00c3, 0x29b3: 0x00c0, 0x29b4: 0x00c0, 0x29b5: 0x00c3, - 0x29b6: 0x00c3, - // Block 0xa7, offset 0x29c0 - 0x29c0: 0x00c0, 0x29c1: 0x00c0, 0x29c2: 0x00c0, 0x29c3: 0x00c3, 0x29c4: 0x00c0, 0x29c5: 0x00c0, - 0x29c6: 0x00c0, 0x29c7: 0x00c0, 0x29c8: 0x00c0, 0x29c9: 0x00c0, 0x29ca: 0x00c0, 0x29cb: 0x00c0, - 0x29cc: 0x00c3, 0x29cd: 0x00c0, 0x29d0: 0x00c0, 0x29d1: 0x00c0, - 0x29d2: 0x00c0, 0x29d3: 0x00c0, 0x29d4: 0x00c0, 0x29d5: 0x00c0, 0x29d6: 0x00c0, 0x29d7: 0x00c0, - 0x29d8: 0x00c0, 0x29d9: 0x00c0, 0x29dc: 0x0080, 0x29dd: 0x0080, - 0x29de: 0x0080, 0x29df: 0x0080, 0x29e0: 0x00c0, 0x29e1: 0x00c0, 0x29e2: 0x00c0, 0x29e3: 0x00c0, - 0x29e4: 0x00c0, 0x29e5: 0x00c0, 0x29e6: 0x00c0, 0x29e7: 0x00c0, 0x29e8: 0x00c0, 0x29e9: 0x00c0, - 0x29ea: 0x00c0, 0x29eb: 0x00c0, 0x29ec: 0x00c0, 0x29ed: 0x00c0, 0x29ee: 0x00c0, 0x29ef: 0x00c0, - 0x29f0: 0x00c0, 0x29f1: 0x00c0, 0x29f2: 0x00c0, 0x29f3: 0x00c0, 0x29f4: 0x00c0, 0x29f5: 0x00c0, - 0x29f6: 0x00c0, 0x29f7: 0x0080, 0x29f8: 0x0080, 0x29f9: 0x0080, 0x29fa: 0x00c0, 0x29fb: 0x00c0, - 0x29fc: 0x00c3, 0x29fd: 0x00c0, 0x29fe: 0x00c0, 0x29ff: 0x00c0, - // Block 0xa8, offset 0x2a00 - 0x2a00: 0x00c0, 0x2a01: 0x00c0, 0x2a02: 0x00c0, 0x2a03: 0x00c0, 0x2a04: 0x00c0, 0x2a05: 0x00c0, - 0x2a06: 0x00c0, 0x2a07: 0x00c0, 0x2a08: 0x00c0, 0x2a09: 0x00c0, 0x2a0a: 0x00c0, 0x2a0b: 0x00c0, - 0x2a0c: 0x00c0, 0x2a0d: 0x00c0, 0x2a0e: 0x00c0, 0x2a0f: 0x00c0, 0x2a10: 0x00c0, 0x2a11: 0x00c0, - 0x2a12: 0x00c0, 0x2a13: 0x00c0, 0x2a14: 0x00c0, 0x2a15: 0x00c0, 0x2a16: 0x00c0, 0x2a17: 0x00c0, - 0x2a18: 0x00c0, 0x2a19: 0x00c0, 0x2a1a: 0x00c0, 0x2a1b: 0x00c0, 0x2a1c: 0x00c0, 0x2a1d: 0x00c0, - 0x2a1e: 0x00c0, 0x2a1f: 0x00c0, 0x2a20: 0x00c0, 0x2a21: 0x00c0, 0x2a22: 0x00c0, 0x2a23: 0x00c0, - 0x2a24: 0x00c0, 0x2a25: 0x00c0, 0x2a26: 0x00c0, 0x2a27: 0x00c0, 0x2a28: 0x00c0, 0x2a29: 0x00c0, - 0x2a2a: 0x00c0, 0x2a2b: 0x00c0, 0x2a2c: 0x00c0, 0x2a2d: 0x00c0, 0x2a2e: 0x00c0, 0x2a2f: 0x00c0, - 0x2a30: 0x00c3, 0x2a31: 0x00c0, 0x2a32: 0x00c3, 0x2a33: 0x00c3, 0x2a34: 0x00c3, 0x2a35: 0x00c0, - 0x2a36: 0x00c0, 0x2a37: 0x00c3, 0x2a38: 0x00c3, 0x2a39: 0x00c0, 0x2a3a: 0x00c0, 0x2a3b: 0x00c0, - 0x2a3c: 0x00c0, 0x2a3d: 0x00c0, 0x2a3e: 0x00c3, 0x2a3f: 0x00c3, - // Block 0xa9, offset 0x2a40 - 0x2a40: 0x00c0, 0x2a41: 0x00c3, 0x2a42: 0x00c0, - 0x2a5b: 0x00c0, 0x2a5c: 0x00c0, 0x2a5d: 0x00c0, - 0x2a5e: 0x0080, 0x2a5f: 0x0080, 0x2a60: 0x00c0, 0x2a61: 0x00c0, 0x2a62: 0x00c0, 0x2a63: 0x00c0, - 0x2a64: 0x00c0, 0x2a65: 0x00c0, 0x2a66: 0x00c0, 0x2a67: 0x00c0, 0x2a68: 0x00c0, 0x2a69: 0x00c0, - 0x2a6a: 0x00c0, 0x2a6b: 0x00c0, 0x2a6c: 0x00c3, 0x2a6d: 0x00c3, 0x2a6e: 0x00c0, 0x2a6f: 0x00c0, - 0x2a70: 0x0080, 0x2a71: 0x0080, 0x2a72: 0x00c0, 0x2a73: 0x00c0, 0x2a74: 0x00c0, 0x2a75: 0x00c0, - 0x2a76: 0x00c6, - // Block 0xaa, offset 0x2a80 - 0x2a81: 0x00c0, 0x2a82: 0x00c0, 0x2a83: 0x00c0, 0x2a84: 0x00c0, 0x2a85: 0x00c0, - 0x2a86: 0x00c0, 0x2a89: 0x00c0, 0x2a8a: 0x00c0, 0x2a8b: 0x00c0, - 0x2a8c: 0x00c0, 0x2a8d: 0x00c0, 0x2a8e: 0x00c0, 0x2a91: 0x00c0, - 0x2a92: 0x00c0, 0x2a93: 0x00c0, 0x2a94: 0x00c0, 0x2a95: 0x00c0, 0x2a96: 0x00c0, - 0x2aa0: 0x00c0, 0x2aa1: 0x00c0, 0x2aa2: 0x00c0, 0x2aa3: 0x00c0, - 0x2aa4: 0x00c0, 0x2aa5: 0x00c0, 0x2aa6: 0x00c0, 0x2aa8: 0x00c0, 0x2aa9: 0x00c0, - 0x2aaa: 0x00c0, 0x2aab: 0x00c0, 0x2aac: 0x00c0, 0x2aad: 0x00c0, 0x2aae: 0x00c0, - 0x2ab0: 0x00c0, 0x2ab1: 0x00c0, 0x2ab2: 0x00c0, 0x2ab3: 0x00c0, 0x2ab4: 0x00c0, 0x2ab5: 0x00c0, - 0x2ab6: 0x00c0, 0x2ab7: 0x00c0, 0x2ab8: 0x00c0, 0x2ab9: 0x00c0, 0x2aba: 0x00c0, 0x2abb: 0x00c0, - 0x2abc: 0x00c0, 0x2abd: 0x00c0, 0x2abe: 0x00c0, 0x2abf: 0x00c0, - // Block 0xab, offset 0x2ac0 - 0x2ac0: 0x00c0, 0x2ac1: 0x00c0, 0x2ac2: 0x00c0, 0x2ac3: 0x00c0, 0x2ac4: 0x00c0, 0x2ac5: 0x00c0, - 0x2ac6: 0x00c0, 0x2ac7: 0x00c0, 0x2ac8: 0x00c0, 0x2ac9: 0x00c0, 0x2aca: 0x00c0, 0x2acb: 0x00c0, - 0x2acc: 0x00c0, 0x2acd: 0x00c0, 0x2ace: 0x00c0, 0x2acf: 0x00c0, 0x2ad0: 0x00c0, 0x2ad1: 0x00c0, - 0x2ad2: 0x00c0, 0x2ad3: 0x00c0, 0x2ad4: 0x00c0, 0x2ad5: 0x00c0, 0x2ad6: 0x00c0, 0x2ad7: 0x00c0, - 0x2ad8: 0x00c0, 0x2ad9: 0x00c0, 0x2ada: 0x00c0, 0x2adb: 0x0080, 0x2adc: 0x0080, 0x2add: 0x0080, - 0x2ade: 0x0080, 0x2adf: 0x0080, 0x2ae0: 0x00c0, 0x2ae1: 0x00c0, 0x2ae2: 0x00c0, 0x2ae3: 0x00c0, - 0x2ae4: 0x00c0, 0x2ae5: 0x00c8, - 0x2af0: 0x00c0, 0x2af1: 0x00c0, 0x2af2: 0x00c0, 0x2af3: 0x00c0, 0x2af4: 0x00c0, 0x2af5: 0x00c0, - 0x2af6: 0x00c0, 0x2af7: 0x00c0, 0x2af8: 0x00c0, 0x2af9: 0x00c0, 0x2afa: 0x00c0, 0x2afb: 0x00c0, - 0x2afc: 0x00c0, 0x2afd: 0x00c0, 0x2afe: 0x00c0, 0x2aff: 0x00c0, - // Block 0xac, offset 0x2b00 - 0x2b00: 0x00c0, 0x2b01: 0x00c0, 0x2b02: 0x00c0, 0x2b03: 0x00c0, 0x2b04: 0x00c0, 0x2b05: 0x00c0, - 0x2b06: 0x00c0, 0x2b07: 0x00c0, 0x2b08: 0x00c0, 0x2b09: 0x00c0, 0x2b0a: 0x00c0, 0x2b0b: 0x00c0, - 0x2b0c: 0x00c0, 0x2b0d: 0x00c0, 0x2b0e: 0x00c0, 0x2b0f: 0x00c0, 0x2b10: 0x00c0, 0x2b11: 0x00c0, - 0x2b12: 0x00c0, 0x2b13: 0x00c0, 0x2b14: 0x00c0, 0x2b15: 0x00c0, 0x2b16: 0x00c0, 0x2b17: 0x00c0, - 0x2b18: 0x00c0, 0x2b19: 0x00c0, 0x2b1a: 0x00c0, 0x2b1b: 0x00c0, 0x2b1c: 0x00c0, 0x2b1d: 0x00c0, - 0x2b1e: 0x00c0, 0x2b1f: 0x00c0, 0x2b20: 0x00c0, 0x2b21: 0x00c0, 0x2b22: 0x00c0, 0x2b23: 0x00c0, - 0x2b24: 0x00c0, 0x2b25: 0x00c3, 0x2b26: 0x00c0, 0x2b27: 0x00c0, 0x2b28: 0x00c3, 0x2b29: 0x00c0, - 0x2b2a: 0x00c0, 0x2b2b: 0x0080, 0x2b2c: 0x00c0, 0x2b2d: 0x00c6, - 0x2b30: 0x00c0, 0x2b31: 0x00c0, 0x2b32: 0x00c0, 0x2b33: 0x00c0, 0x2b34: 0x00c0, 0x2b35: 0x00c0, - 0x2b36: 0x00c0, 0x2b37: 0x00c0, 0x2b38: 0x00c0, 0x2b39: 0x00c0, - // Block 0xad, offset 0x2b40 - 0x2b40: 0x00c0, 0x2b41: 0x00c0, 0x2b42: 0x00c0, 0x2b43: 0x00c0, 0x2b44: 0x00c0, 0x2b45: 0x00c0, - 0x2b46: 0x00c0, 0x2b47: 0x00c0, 0x2b48: 0x00c0, 0x2b49: 0x00c0, 0x2b4a: 0x00c0, 0x2b4b: 0x00c0, - 0x2b4c: 0x00c0, 0x2b4d: 0x00c0, 0x2b4e: 0x00c0, 0x2b4f: 0x00c0, 0x2b50: 0x00c0, 0x2b51: 0x00c0, - 0x2b52: 0x00c0, 0x2b53: 0x00c0, 0x2b54: 0x00c0, 0x2b55: 0x00c0, 0x2b56: 0x00c0, 0x2b57: 0x00c0, - 0x2b58: 0x00c0, 0x2b59: 0x00c0, 0x2b5a: 0x00c0, 0x2b5b: 0x00c0, 0x2b5c: 0x00c0, 0x2b5d: 0x00c0, - 0x2b5e: 0x00c0, 0x2b5f: 0x00c0, 0x2b60: 0x00c0, 0x2b61: 0x00c0, 0x2b62: 0x00c0, 0x2b63: 0x00c0, - 0x2b70: 0x0040, 0x2b71: 0x0040, 0x2b72: 0x0040, 0x2b73: 0x0040, 0x2b74: 0x0040, 0x2b75: 0x0040, - 0x2b76: 0x0040, 0x2b77: 0x0040, 0x2b78: 0x0040, 0x2b79: 0x0040, 0x2b7a: 0x0040, 0x2b7b: 0x0040, - 0x2b7c: 0x0040, 0x2b7d: 0x0040, 0x2b7e: 0x0040, 0x2b7f: 0x0040, - // Block 0xae, offset 0x2b80 - 0x2b80: 0x0040, 0x2b81: 0x0040, 0x2b82: 0x0040, 0x2b83: 0x0040, 0x2b84: 0x0040, 0x2b85: 0x0040, - 0x2b86: 0x0040, 0x2b8b: 0x0040, - 0x2b8c: 0x0040, 0x2b8d: 0x0040, 0x2b8e: 0x0040, 0x2b8f: 0x0040, 0x2b90: 0x0040, 0x2b91: 0x0040, - 0x2b92: 0x0040, 0x2b93: 0x0040, 0x2b94: 0x0040, 0x2b95: 0x0040, 0x2b96: 0x0040, 0x2b97: 0x0040, - 0x2b98: 0x0040, 0x2b99: 0x0040, 0x2b9a: 0x0040, 0x2b9b: 0x0040, 0x2b9c: 0x0040, 0x2b9d: 0x0040, - 0x2b9e: 0x0040, 0x2b9f: 0x0040, 0x2ba0: 0x0040, 0x2ba1: 0x0040, 0x2ba2: 0x0040, 0x2ba3: 0x0040, - 0x2ba4: 0x0040, 0x2ba5: 0x0040, 0x2ba6: 0x0040, 0x2ba7: 0x0040, 0x2ba8: 0x0040, 0x2ba9: 0x0040, - 0x2baa: 0x0040, 0x2bab: 0x0040, 0x2bac: 0x0040, 0x2bad: 0x0040, 0x2bae: 0x0040, 0x2baf: 0x0040, - 0x2bb0: 0x0040, 0x2bb1: 0x0040, 0x2bb2: 0x0040, 0x2bb3: 0x0040, 0x2bb4: 0x0040, 0x2bb5: 0x0040, - 0x2bb6: 0x0040, 0x2bb7: 0x0040, 0x2bb8: 0x0040, 0x2bb9: 0x0040, 0x2bba: 0x0040, 0x2bbb: 0x0040, - // Block 0xaf, offset 0x2bc0 - 0x2bc0: 0x008c, 0x2bc1: 0x008c, 0x2bc2: 0x008c, 0x2bc3: 0x008c, 0x2bc4: 0x008c, 0x2bc5: 0x008c, - 0x2bc6: 0x008c, 0x2bc7: 0x008c, 0x2bc8: 0x008c, 0x2bc9: 0x008c, 0x2bca: 0x008c, 0x2bcb: 0x008c, - 0x2bcc: 0x008c, 0x2bcd: 0x008c, 0x2bce: 0x00cc, 0x2bcf: 0x00cc, 0x2bd0: 0x008c, 0x2bd1: 0x00cc, - 0x2bd2: 0x008c, 0x2bd3: 0x00cc, 0x2bd4: 0x00cc, 0x2bd5: 0x008c, 0x2bd6: 0x008c, 0x2bd7: 0x008c, - 0x2bd8: 0x008c, 0x2bd9: 0x008c, 0x2bda: 0x008c, 0x2bdb: 0x008c, 0x2bdc: 0x008c, 0x2bdd: 0x008c, - 0x2bde: 0x008c, 0x2bdf: 0x00cc, 0x2be0: 0x008c, 0x2be1: 0x00cc, 0x2be2: 0x008c, 0x2be3: 0x00cc, - 0x2be4: 0x00cc, 0x2be5: 0x008c, 0x2be6: 0x008c, 0x2be7: 0x00cc, 0x2be8: 0x00cc, 0x2be9: 0x00cc, - 0x2bea: 0x008c, 0x2beb: 0x008c, 0x2bec: 0x008c, 0x2bed: 0x008c, 0x2bee: 0x008c, 0x2bef: 0x008c, - 0x2bf0: 0x008c, 0x2bf1: 0x008c, 0x2bf2: 0x008c, 0x2bf3: 0x008c, 0x2bf4: 0x008c, 0x2bf5: 0x008c, - 0x2bf6: 0x008c, 0x2bf7: 0x008c, 0x2bf8: 0x008c, 0x2bf9: 0x008c, 0x2bfa: 0x008c, 0x2bfb: 0x008c, - 0x2bfc: 0x008c, 0x2bfd: 0x008c, 0x2bfe: 0x008c, 0x2bff: 0x008c, - // Block 0xb0, offset 0x2c00 - 0x2c00: 0x008c, 0x2c01: 0x008c, 0x2c02: 0x008c, 0x2c03: 0x008c, 0x2c04: 0x008c, 0x2c05: 0x008c, - 0x2c06: 0x008c, 0x2c07: 0x008c, 0x2c08: 0x008c, 0x2c09: 0x008c, 0x2c0a: 0x008c, 0x2c0b: 0x008c, - 0x2c0c: 0x008c, 0x2c0d: 0x008c, 0x2c0e: 0x008c, 0x2c0f: 0x008c, 0x2c10: 0x008c, 0x2c11: 0x008c, - 0x2c12: 0x008c, 0x2c13: 0x008c, 0x2c14: 0x008c, 0x2c15: 0x008c, 0x2c16: 0x008c, 0x2c17: 0x008c, - 0x2c18: 0x008c, 0x2c19: 0x008c, 0x2c1a: 0x008c, 0x2c1b: 0x008c, 0x2c1c: 0x008c, 0x2c1d: 0x008c, - 0x2c1e: 0x008c, 0x2c1f: 0x008c, 0x2c20: 0x008c, 0x2c21: 0x008c, 0x2c22: 0x008c, 0x2c23: 0x008c, - 0x2c24: 0x008c, 0x2c25: 0x008c, 0x2c26: 0x008c, 0x2c27: 0x008c, 0x2c28: 0x008c, 0x2c29: 0x008c, - 0x2c2a: 0x008c, 0x2c2b: 0x008c, 0x2c2c: 0x008c, 0x2c2d: 0x008c, - 0x2c30: 0x008c, 0x2c31: 0x008c, 0x2c32: 0x008c, 0x2c33: 0x008c, 0x2c34: 0x008c, 0x2c35: 0x008c, - 0x2c36: 0x008c, 0x2c37: 0x008c, 0x2c38: 0x008c, 0x2c39: 0x008c, 0x2c3a: 0x008c, 0x2c3b: 0x008c, - 0x2c3c: 0x008c, 0x2c3d: 0x008c, 0x2c3e: 0x008c, 0x2c3f: 0x008c, - // Block 0xb1, offset 0x2c40 - 0x2c40: 0x008c, 0x2c41: 0x008c, 0x2c42: 0x008c, 0x2c43: 0x008c, 0x2c44: 0x008c, 0x2c45: 0x008c, - 0x2c46: 0x008c, 0x2c47: 0x008c, 0x2c48: 0x008c, 0x2c49: 0x008c, 0x2c4a: 0x008c, 0x2c4b: 0x008c, - 0x2c4c: 0x008c, 0x2c4d: 0x008c, 0x2c4e: 0x008c, 0x2c4f: 0x008c, 0x2c50: 0x008c, 0x2c51: 0x008c, - 0x2c52: 0x008c, 0x2c53: 0x008c, 0x2c54: 0x008c, 0x2c55: 0x008c, 0x2c56: 0x008c, 0x2c57: 0x008c, - 0x2c58: 0x008c, 0x2c59: 0x008c, - // Block 0xb2, offset 0x2c80 - 0x2c80: 0x0080, 0x2c81: 0x0080, 0x2c82: 0x0080, 0x2c83: 0x0080, 0x2c84: 0x0080, 0x2c85: 0x0080, - 0x2c86: 0x0080, - 0x2c93: 0x0080, 0x2c94: 0x0080, 0x2c95: 0x0080, 0x2c96: 0x0080, 0x2c97: 0x0080, - 0x2c9d: 0x008a, - 0x2c9e: 0x00cb, 0x2c9f: 0x008a, 0x2ca0: 0x008a, 0x2ca1: 0x008a, 0x2ca2: 0x008a, 0x2ca3: 0x008a, - 0x2ca4: 0x008a, 0x2ca5: 0x008a, 0x2ca6: 0x008a, 0x2ca7: 0x008a, 0x2ca8: 0x008a, 0x2ca9: 0x008a, - 0x2caa: 0x008a, 0x2cab: 0x008a, 0x2cac: 0x008a, 0x2cad: 0x008a, 0x2cae: 0x008a, 0x2caf: 0x008a, - 0x2cb0: 0x008a, 0x2cb1: 0x008a, 0x2cb2: 0x008a, 0x2cb3: 0x008a, 0x2cb4: 0x008a, 0x2cb5: 0x008a, - 0x2cb6: 0x008a, 0x2cb8: 0x008a, 0x2cb9: 0x008a, 0x2cba: 0x008a, 0x2cbb: 0x008a, - 0x2cbc: 0x008a, 0x2cbe: 0x008a, - // Block 0xb3, offset 0x2cc0 - 0x2cc0: 0x008a, 0x2cc1: 0x008a, 0x2cc3: 0x008a, 0x2cc4: 0x008a, - 0x2cc6: 0x008a, 0x2cc7: 0x008a, 0x2cc8: 0x008a, 0x2cc9: 0x008a, 0x2cca: 0x008a, 0x2ccb: 0x008a, - 0x2ccc: 0x008a, 0x2ccd: 0x008a, 0x2cce: 0x008a, 0x2ccf: 0x008a, 0x2cd0: 0x0080, 0x2cd1: 0x0080, - 0x2cd2: 0x0080, 0x2cd3: 0x0080, 0x2cd4: 0x0080, 0x2cd5: 0x0080, 0x2cd6: 0x0080, 0x2cd7: 0x0080, - 0x2cd8: 0x0080, 0x2cd9: 0x0080, 0x2cda: 0x0080, 0x2cdb: 0x0080, 0x2cdc: 0x0080, 0x2cdd: 0x0080, - 0x2cde: 0x0080, 0x2cdf: 0x0080, 0x2ce0: 0x0080, 0x2ce1: 0x0080, 0x2ce2: 0x0080, 0x2ce3: 0x0080, - 0x2ce4: 0x0080, 0x2ce5: 0x0080, 0x2ce6: 0x0080, 0x2ce7: 0x0080, 0x2ce8: 0x0080, 0x2ce9: 0x0080, - 0x2cea: 0x0080, 0x2ceb: 0x0080, 0x2cec: 0x0080, 0x2ced: 0x0080, 0x2cee: 0x0080, 0x2cef: 0x0080, - 0x2cf0: 0x0080, 0x2cf1: 0x0080, 0x2cf2: 0x0080, 0x2cf3: 0x0080, 0x2cf4: 0x0080, 0x2cf5: 0x0080, - 0x2cf6: 0x0080, 0x2cf7: 0x0080, 0x2cf8: 0x0080, 0x2cf9: 0x0080, 0x2cfa: 0x0080, 0x2cfb: 0x0080, - 0x2cfc: 0x0080, 0x2cfd: 0x0080, 0x2cfe: 0x0080, 0x2cff: 0x0080, - // Block 0xb4, offset 0x2d00 - 0x2d00: 0x0080, 0x2d01: 0x0080, - 0x2d13: 0x0080, 0x2d14: 0x0080, 0x2d15: 0x0080, 0x2d16: 0x0080, 0x2d17: 0x0080, - 0x2d18: 0x0080, 0x2d19: 0x0080, 0x2d1a: 0x0080, 0x2d1b: 0x0080, 0x2d1c: 0x0080, 0x2d1d: 0x0080, - 0x2d1e: 0x0080, 0x2d1f: 0x0080, 0x2d20: 0x0080, 0x2d21: 0x0080, 0x2d22: 0x0080, 0x2d23: 0x0080, - 0x2d24: 0x0080, 0x2d25: 0x0080, 0x2d26: 0x0080, 0x2d27: 0x0080, 0x2d28: 0x0080, 0x2d29: 0x0080, - 0x2d2a: 0x0080, 0x2d2b: 0x0080, 0x2d2c: 0x0080, 0x2d2d: 0x0080, 0x2d2e: 0x0080, 0x2d2f: 0x0080, - 0x2d30: 0x0080, 0x2d31: 0x0080, 0x2d32: 0x0080, 0x2d33: 0x0080, 0x2d34: 0x0080, 0x2d35: 0x0080, - 0x2d36: 0x0080, 0x2d37: 0x0080, 0x2d38: 0x0080, 0x2d39: 0x0080, 0x2d3a: 0x0080, 0x2d3b: 0x0080, - 0x2d3c: 0x0080, 0x2d3d: 0x0080, 0x2d3e: 0x0080, 0x2d3f: 0x0080, - // Block 0xb5, offset 0x2d40 - 0x2d50: 0x0080, 0x2d51: 0x0080, - 0x2d52: 0x0080, 0x2d53: 0x0080, 0x2d54: 0x0080, 0x2d55: 0x0080, 0x2d56: 0x0080, 0x2d57: 0x0080, - 0x2d58: 0x0080, 0x2d59: 0x0080, 0x2d5a: 0x0080, 0x2d5b: 0x0080, 0x2d5c: 0x0080, 0x2d5d: 0x0080, - 0x2d5e: 0x0080, 0x2d5f: 0x0080, 0x2d60: 0x0080, 0x2d61: 0x0080, 0x2d62: 0x0080, 0x2d63: 0x0080, - 0x2d64: 0x0080, 0x2d65: 0x0080, 0x2d66: 0x0080, 0x2d67: 0x0080, 0x2d68: 0x0080, 0x2d69: 0x0080, - 0x2d6a: 0x0080, 0x2d6b: 0x0080, 0x2d6c: 0x0080, 0x2d6d: 0x0080, 0x2d6e: 0x0080, 0x2d6f: 0x0080, - 0x2d70: 0x0080, 0x2d71: 0x0080, 0x2d72: 0x0080, 0x2d73: 0x0080, 0x2d74: 0x0080, 0x2d75: 0x0080, - 0x2d76: 0x0080, 0x2d77: 0x0080, 0x2d78: 0x0080, 0x2d79: 0x0080, 0x2d7a: 0x0080, 0x2d7b: 0x0080, - 0x2d7c: 0x0080, 0x2d7d: 0x0080, 0x2d7e: 0x0080, 0x2d7f: 0x0080, - // Block 0xb6, offset 0x2d80 - 0x2d80: 0x0080, 0x2d81: 0x0080, 0x2d82: 0x0080, 0x2d83: 0x0080, 0x2d84: 0x0080, 0x2d85: 0x0080, - 0x2d86: 0x0080, 0x2d87: 0x0080, 0x2d88: 0x0080, 0x2d89: 0x0080, 0x2d8a: 0x0080, 0x2d8b: 0x0080, - 0x2d8c: 0x0080, 0x2d8d: 0x0080, 0x2d8e: 0x0080, 0x2d8f: 0x0080, - 0x2d92: 0x0080, 0x2d93: 0x0080, 0x2d94: 0x0080, 0x2d95: 0x0080, 0x2d96: 0x0080, 0x2d97: 0x0080, - 0x2d98: 0x0080, 0x2d99: 0x0080, 0x2d9a: 0x0080, 0x2d9b: 0x0080, 0x2d9c: 0x0080, 0x2d9d: 0x0080, - 0x2d9e: 0x0080, 0x2d9f: 0x0080, 0x2da0: 0x0080, 0x2da1: 0x0080, 0x2da2: 0x0080, 0x2da3: 0x0080, - 0x2da4: 0x0080, 0x2da5: 0x0080, 0x2da6: 0x0080, 0x2da7: 0x0080, 0x2da8: 0x0080, 0x2da9: 0x0080, - 0x2daa: 0x0080, 0x2dab: 0x0080, 0x2dac: 0x0080, 0x2dad: 0x0080, 0x2dae: 0x0080, 0x2daf: 0x0080, - 0x2db0: 0x0080, 0x2db1: 0x0080, 0x2db2: 0x0080, 0x2db3: 0x0080, 0x2db4: 0x0080, 0x2db5: 0x0080, - 0x2db6: 0x0080, 0x2db7: 0x0080, 0x2db8: 0x0080, 0x2db9: 0x0080, 0x2dba: 0x0080, 0x2dbb: 0x0080, - 0x2dbc: 0x0080, 0x2dbd: 0x0080, 0x2dbe: 0x0080, 0x2dbf: 0x0080, - // Block 0xb7, offset 0x2dc0 - 0x2dc0: 0x0080, 0x2dc1: 0x0080, 0x2dc2: 0x0080, 0x2dc3: 0x0080, 0x2dc4: 0x0080, 0x2dc5: 0x0080, - 0x2dc6: 0x0080, 0x2dc7: 0x0080, - 0x2df0: 0x0080, 0x2df1: 0x0080, 0x2df2: 0x0080, 0x2df3: 0x0080, 0x2df4: 0x0080, 0x2df5: 0x0080, - 0x2df6: 0x0080, 0x2df7: 0x0080, 0x2df8: 0x0080, 0x2df9: 0x0080, 0x2dfa: 0x0080, 0x2dfb: 0x0080, - 0x2dfc: 0x0080, 0x2dfd: 0x0080, - // Block 0xb8, offset 0x2e00 - 0x2e00: 0x0040, 0x2e01: 0x0040, 0x2e02: 0x0040, 0x2e03: 0x0040, 0x2e04: 0x0040, 0x2e05: 0x0040, - 0x2e06: 0x0040, 0x2e07: 0x0040, 0x2e08: 0x0040, 0x2e09: 0x0040, 0x2e0a: 0x0040, 0x2e0b: 0x0040, - 0x2e0c: 0x0040, 0x2e0d: 0x0040, 0x2e0e: 0x0040, 0x2e0f: 0x0040, 0x2e10: 0x0080, 0x2e11: 0x0080, - 0x2e12: 0x0080, 0x2e13: 0x0080, 0x2e14: 0x0080, 0x2e15: 0x0080, 0x2e16: 0x0080, 0x2e17: 0x0080, - 0x2e18: 0x0080, 0x2e19: 0x0080, - 0x2e20: 0x00c3, 0x2e21: 0x00c3, 0x2e22: 0x00c3, 0x2e23: 0x00c3, - 0x2e24: 0x00c3, 0x2e25: 0x00c3, 0x2e26: 0x00c3, 0x2e27: 0x00c3, 0x2e28: 0x00c3, 0x2e29: 0x00c3, - 0x2e2a: 0x00c3, 0x2e2b: 0x00c3, 0x2e2c: 0x00c3, 0x2e2d: 0x00c3, 0x2e2e: 0x00c3, 0x2e2f: 0x00c3, - 0x2e30: 0x0080, 0x2e31: 0x0080, 0x2e32: 0x0080, 0x2e33: 0x0080, 0x2e34: 0x0080, 0x2e35: 0x0080, - 0x2e36: 0x0080, 0x2e37: 0x0080, 0x2e38: 0x0080, 0x2e39: 0x0080, 0x2e3a: 0x0080, 0x2e3b: 0x0080, - 0x2e3c: 0x0080, 0x2e3d: 0x0080, 0x2e3e: 0x0080, 0x2e3f: 0x0080, - // Block 0xb9, offset 0x2e40 - 0x2e40: 0x0080, 0x2e41: 0x0080, 0x2e42: 0x0080, 0x2e43: 0x0080, 0x2e44: 0x0080, 0x2e45: 0x0080, - 0x2e46: 0x0080, 0x2e47: 0x0080, 0x2e48: 0x0080, 0x2e49: 0x0080, 0x2e4a: 0x0080, 0x2e4b: 0x0080, - 0x2e4c: 0x0080, 0x2e4d: 0x0080, 0x2e4e: 0x0080, 0x2e4f: 0x0080, 0x2e50: 0x0080, 0x2e51: 0x0080, - 0x2e52: 0x0080, 0x2e54: 0x0080, 0x2e55: 0x0080, 0x2e56: 0x0080, 0x2e57: 0x0080, - 0x2e58: 0x0080, 0x2e59: 0x0080, 0x2e5a: 0x0080, 0x2e5b: 0x0080, 0x2e5c: 0x0080, 0x2e5d: 0x0080, - 0x2e5e: 0x0080, 0x2e5f: 0x0080, 0x2e60: 0x0080, 0x2e61: 0x0080, 0x2e62: 0x0080, 0x2e63: 0x0080, - 0x2e64: 0x0080, 0x2e65: 0x0080, 0x2e66: 0x0080, 0x2e68: 0x0080, 0x2e69: 0x0080, - 0x2e6a: 0x0080, 0x2e6b: 0x0080, - 0x2e70: 0x0080, 0x2e71: 0x0080, 0x2e72: 0x0080, 0x2e73: 0x00c0, 0x2e74: 0x0080, - 0x2e76: 0x0080, 0x2e77: 0x0080, 0x2e78: 0x0080, 0x2e79: 0x0080, 0x2e7a: 0x0080, 0x2e7b: 0x0080, - 0x2e7c: 0x0080, 0x2e7d: 0x0080, 0x2e7e: 0x0080, 0x2e7f: 0x0080, - // Block 0xba, offset 0x2e80 - 0x2e80: 0x0080, 0x2e81: 0x0080, 0x2e82: 0x0080, 0x2e83: 0x0080, 0x2e84: 0x0080, 0x2e85: 0x0080, - 0x2e86: 0x0080, 0x2e87: 0x0080, 0x2e88: 0x0080, 0x2e89: 0x0080, 0x2e8a: 0x0080, 0x2e8b: 0x0080, - 0x2e8c: 0x0080, 0x2e8d: 0x0080, 0x2e8e: 0x0080, 0x2e8f: 0x0080, 0x2e90: 0x0080, 0x2e91: 0x0080, - 0x2e92: 0x0080, 0x2e93: 0x0080, 0x2e94: 0x0080, 0x2e95: 0x0080, 0x2e96: 0x0080, 0x2e97: 0x0080, - 0x2e98: 0x0080, 0x2e99: 0x0080, 0x2e9a: 0x0080, 0x2e9b: 0x0080, 0x2e9c: 0x0080, 0x2e9d: 0x0080, - 0x2e9e: 0x0080, 0x2e9f: 0x0080, 0x2ea0: 0x0080, 0x2ea1: 0x0080, 0x2ea2: 0x0080, 0x2ea3: 0x0080, - 0x2ea4: 0x0080, 0x2ea5: 0x0080, 0x2ea6: 0x0080, 0x2ea7: 0x0080, 0x2ea8: 0x0080, 0x2ea9: 0x0080, - 0x2eaa: 0x0080, 0x2eab: 0x0080, 0x2eac: 0x0080, 0x2ead: 0x0080, 0x2eae: 0x0080, 0x2eaf: 0x0080, - 0x2eb0: 0x0080, 0x2eb1: 0x0080, 0x2eb2: 0x0080, 0x2eb3: 0x0080, 0x2eb4: 0x0080, 0x2eb5: 0x0080, - 0x2eb6: 0x0080, 0x2eb7: 0x0080, 0x2eb8: 0x0080, 0x2eb9: 0x0080, 0x2eba: 0x0080, 0x2ebb: 0x0080, - 0x2ebc: 0x0080, 0x2ebf: 0x0040, - // Block 0xbb, offset 0x2ec0 - 0x2ec1: 0x0080, 0x2ec2: 0x0080, 0x2ec3: 0x0080, 0x2ec4: 0x0080, 0x2ec5: 0x0080, - 0x2ec6: 0x0080, 0x2ec7: 0x0080, 0x2ec8: 0x0080, 0x2ec9: 0x0080, 0x2eca: 0x0080, 0x2ecb: 0x0080, - 0x2ecc: 0x0080, 0x2ecd: 0x0080, 0x2ece: 0x0080, 0x2ecf: 0x0080, 0x2ed0: 0x0080, 0x2ed1: 0x0080, - 0x2ed2: 0x0080, 0x2ed3: 0x0080, 0x2ed4: 0x0080, 0x2ed5: 0x0080, 0x2ed6: 0x0080, 0x2ed7: 0x0080, - 0x2ed8: 0x0080, 0x2ed9: 0x0080, 0x2eda: 0x0080, 0x2edb: 0x0080, 0x2edc: 0x0080, 0x2edd: 0x0080, - 0x2ede: 0x0080, 0x2edf: 0x0080, 0x2ee0: 0x0080, 0x2ee1: 0x0080, 0x2ee2: 0x0080, 0x2ee3: 0x0080, - 0x2ee4: 0x0080, 0x2ee5: 0x0080, 0x2ee6: 0x0080, 0x2ee7: 0x0080, 0x2ee8: 0x0080, 0x2ee9: 0x0080, - 0x2eea: 0x0080, 0x2eeb: 0x0080, 0x2eec: 0x0080, 0x2eed: 0x0080, 0x2eee: 0x0080, 0x2eef: 0x0080, - 0x2ef0: 0x0080, 0x2ef1: 0x0080, 0x2ef2: 0x0080, 0x2ef3: 0x0080, 0x2ef4: 0x0080, 0x2ef5: 0x0080, - 0x2ef6: 0x0080, 0x2ef7: 0x0080, 0x2ef8: 0x0080, 0x2ef9: 0x0080, 0x2efa: 0x0080, 0x2efb: 0x0080, - 0x2efc: 0x0080, 0x2efd: 0x0080, 0x2efe: 0x0080, 0x2eff: 0x0080, - // Block 0xbc, offset 0x2f00 - 0x2f00: 0x0080, 0x2f01: 0x0080, 0x2f02: 0x0080, 0x2f03: 0x0080, 0x2f04: 0x0080, 0x2f05: 0x0080, - 0x2f06: 0x0080, 0x2f07: 0x0080, 0x2f08: 0x0080, 0x2f09: 0x0080, 0x2f0a: 0x0080, 0x2f0b: 0x0080, - 0x2f0c: 0x0080, 0x2f0d: 0x0080, 0x2f0e: 0x0080, 0x2f0f: 0x0080, 0x2f10: 0x0080, 0x2f11: 0x0080, - 0x2f12: 0x0080, 0x2f13: 0x0080, 0x2f14: 0x0080, 0x2f15: 0x0080, 0x2f16: 0x0080, 0x2f17: 0x0080, - 0x2f18: 0x0080, 0x2f19: 0x0080, 0x2f1a: 0x0080, 0x2f1b: 0x0080, 0x2f1c: 0x0080, 0x2f1d: 0x0080, - 0x2f1e: 0x0080, 0x2f1f: 0x0080, 0x2f20: 0x0080, 0x2f21: 0x0080, 0x2f22: 0x0080, 0x2f23: 0x0080, - 0x2f24: 0x0080, 0x2f25: 0x0080, 0x2f26: 0x008c, 0x2f27: 0x008c, 0x2f28: 0x008c, 0x2f29: 0x008c, - 0x2f2a: 0x008c, 0x2f2b: 0x008c, 0x2f2c: 0x008c, 0x2f2d: 0x008c, 0x2f2e: 0x008c, 0x2f2f: 0x008c, - 0x2f30: 0x0080, 0x2f31: 0x008c, 0x2f32: 0x008c, 0x2f33: 0x008c, 0x2f34: 0x008c, 0x2f35: 0x008c, - 0x2f36: 0x008c, 0x2f37: 0x008c, 0x2f38: 0x008c, 0x2f39: 0x008c, 0x2f3a: 0x008c, 0x2f3b: 0x008c, - 0x2f3c: 0x008c, 0x2f3d: 0x008c, 0x2f3e: 0x008c, 0x2f3f: 0x008c, - // Block 0xbd, offset 0x2f40 - 0x2f40: 0x008c, 0x2f41: 0x008c, 0x2f42: 0x008c, 0x2f43: 0x008c, 0x2f44: 0x008c, 0x2f45: 0x008c, - 0x2f46: 0x008c, 0x2f47: 0x008c, 0x2f48: 0x008c, 0x2f49: 0x008c, 0x2f4a: 0x008c, 0x2f4b: 0x008c, - 0x2f4c: 0x008c, 0x2f4d: 0x008c, 0x2f4e: 0x008c, 0x2f4f: 0x008c, 0x2f50: 0x008c, 0x2f51: 0x008c, - 0x2f52: 0x008c, 0x2f53: 0x008c, 0x2f54: 0x008c, 0x2f55: 0x008c, 0x2f56: 0x008c, 0x2f57: 0x008c, - 0x2f58: 0x008c, 0x2f59: 0x008c, 0x2f5a: 0x008c, 0x2f5b: 0x008c, 0x2f5c: 0x008c, 0x2f5d: 0x008c, - 0x2f5e: 0x0080, 0x2f5f: 0x0080, 0x2f60: 0x0040, 0x2f61: 0x0080, 0x2f62: 0x0080, 0x2f63: 0x0080, - 0x2f64: 0x0080, 0x2f65: 0x0080, 0x2f66: 0x0080, 0x2f67: 0x0080, 0x2f68: 0x0080, 0x2f69: 0x0080, - 0x2f6a: 0x0080, 0x2f6b: 0x0080, 0x2f6c: 0x0080, 0x2f6d: 0x0080, 0x2f6e: 0x0080, 0x2f6f: 0x0080, - 0x2f70: 0x0080, 0x2f71: 0x0080, 0x2f72: 0x0080, 0x2f73: 0x0080, 0x2f74: 0x0080, 0x2f75: 0x0080, - 0x2f76: 0x0080, 0x2f77: 0x0080, 0x2f78: 0x0080, 0x2f79: 0x0080, 0x2f7a: 0x0080, 0x2f7b: 0x0080, - 0x2f7c: 0x0080, 0x2f7d: 0x0080, 0x2f7e: 0x0080, - // Block 0xbe, offset 0x2f80 - 0x2f82: 0x0080, 0x2f83: 0x0080, 0x2f84: 0x0080, 0x2f85: 0x0080, - 0x2f86: 0x0080, 0x2f87: 0x0080, 0x2f8a: 0x0080, 0x2f8b: 0x0080, - 0x2f8c: 0x0080, 0x2f8d: 0x0080, 0x2f8e: 0x0080, 0x2f8f: 0x0080, - 0x2f92: 0x0080, 0x2f93: 0x0080, 0x2f94: 0x0080, 0x2f95: 0x0080, 0x2f96: 0x0080, 0x2f97: 0x0080, - 0x2f9a: 0x0080, 0x2f9b: 0x0080, 0x2f9c: 0x0080, - 0x2fa0: 0x0080, 0x2fa1: 0x0080, 0x2fa2: 0x0080, 0x2fa3: 0x0080, - 0x2fa4: 0x0080, 0x2fa5: 0x0080, 0x2fa6: 0x0080, 0x2fa8: 0x0080, 0x2fa9: 0x0080, - 0x2faa: 0x0080, 0x2fab: 0x0080, 0x2fac: 0x0080, 0x2fad: 0x0080, 0x2fae: 0x0080, - 0x2fb9: 0x0040, 0x2fba: 0x0040, 0x2fbb: 0x0040, - 0x2fbc: 0x0080, 0x2fbd: 0x0080, - // Block 0xbf, offset 0x2fc0 - 0x2fc0: 0x00c0, 0x2fc1: 0x00c0, 0x2fc2: 0x00c0, 0x2fc3: 0x00c0, 0x2fc4: 0x00c0, 0x2fc5: 0x00c0, - 0x2fc6: 0x00c0, 0x2fc7: 0x00c0, 0x2fc8: 0x00c0, 0x2fc9: 0x00c0, 0x2fca: 0x00c0, 0x2fcb: 0x00c0, - 0x2fcd: 0x00c0, 0x2fce: 0x00c0, 0x2fcf: 0x00c0, 0x2fd0: 0x00c0, 0x2fd1: 0x00c0, - 0x2fd2: 0x00c0, 0x2fd3: 0x00c0, 0x2fd4: 0x00c0, 0x2fd5: 0x00c0, 0x2fd6: 0x00c0, 0x2fd7: 0x00c0, - 0x2fd8: 0x00c0, 0x2fd9: 0x00c0, 0x2fda: 0x00c0, 0x2fdb: 0x00c0, 0x2fdc: 0x00c0, 0x2fdd: 0x00c0, - 0x2fde: 0x00c0, 0x2fdf: 0x00c0, 0x2fe0: 0x00c0, 0x2fe1: 0x00c0, 0x2fe2: 0x00c0, 0x2fe3: 0x00c0, - 0x2fe4: 0x00c0, 0x2fe5: 0x00c0, 0x2fe6: 0x00c0, 0x2fe8: 0x00c0, 0x2fe9: 0x00c0, - 0x2fea: 0x00c0, 0x2feb: 0x00c0, 0x2fec: 0x00c0, 0x2fed: 0x00c0, 0x2fee: 0x00c0, 0x2fef: 0x00c0, - 0x2ff0: 0x00c0, 0x2ff1: 0x00c0, 0x2ff2: 0x00c0, 0x2ff3: 0x00c0, 0x2ff4: 0x00c0, 0x2ff5: 0x00c0, - 0x2ff6: 0x00c0, 0x2ff7: 0x00c0, 0x2ff8: 0x00c0, 0x2ff9: 0x00c0, 0x2ffa: 0x00c0, - 0x2ffc: 0x00c0, 0x2ffd: 0x00c0, 0x2fff: 0x00c0, - // Block 0xc0, offset 0x3000 - 0x3000: 0x00c0, 0x3001: 0x00c0, 0x3002: 0x00c0, 0x3003: 0x00c0, 0x3004: 0x00c0, 0x3005: 0x00c0, - 0x3006: 0x00c0, 0x3007: 0x00c0, 0x3008: 0x00c0, 0x3009: 0x00c0, 0x300a: 0x00c0, 0x300b: 0x00c0, - 0x300c: 0x00c0, 0x300d: 0x00c0, 0x3010: 0x00c0, 0x3011: 0x00c0, - 0x3012: 0x00c0, 0x3013: 0x00c0, 0x3014: 0x00c0, 0x3015: 0x00c0, 0x3016: 0x00c0, 0x3017: 0x00c0, - 0x3018: 0x00c0, 0x3019: 0x00c0, 0x301a: 0x00c0, 0x301b: 0x00c0, 0x301c: 0x00c0, 0x301d: 0x00c0, - // Block 0xc1, offset 0x3040 - 0x3040: 0x00c0, 0x3041: 0x00c0, 0x3042: 0x00c0, 0x3043: 0x00c0, 0x3044: 0x00c0, 0x3045: 0x00c0, - 0x3046: 0x00c0, 0x3047: 0x00c0, 0x3048: 0x00c0, 0x3049: 0x00c0, 0x304a: 0x00c0, 0x304b: 0x00c0, - 0x304c: 0x00c0, 0x304d: 0x00c0, 0x304e: 0x00c0, 0x304f: 0x00c0, 0x3050: 0x00c0, 0x3051: 0x00c0, - 0x3052: 0x00c0, 0x3053: 0x00c0, 0x3054: 0x00c0, 0x3055: 0x00c0, 0x3056: 0x00c0, 0x3057: 0x00c0, - 0x3058: 0x00c0, 0x3059: 0x00c0, 0x305a: 0x00c0, 0x305b: 0x00c0, 0x305c: 0x00c0, 0x305d: 0x00c0, - 0x305e: 0x00c0, 0x305f: 0x00c0, 0x3060: 0x00c0, 0x3061: 0x00c0, 0x3062: 0x00c0, 0x3063: 0x00c0, - 0x3064: 0x00c0, 0x3065: 0x00c0, 0x3066: 0x00c0, 0x3067: 0x00c0, 0x3068: 0x00c0, 0x3069: 0x00c0, - 0x306a: 0x00c0, 0x306b: 0x00c0, 0x306c: 0x00c0, 0x306d: 0x00c0, 0x306e: 0x00c0, 0x306f: 0x00c0, - 0x3070: 0x00c0, 0x3071: 0x00c0, 0x3072: 0x00c0, 0x3073: 0x00c0, 0x3074: 0x00c0, 0x3075: 0x00c0, - 0x3076: 0x00c0, 0x3077: 0x00c0, 0x3078: 0x00c0, 0x3079: 0x00c0, 0x307a: 0x00c0, - // Block 0xc2, offset 0x3080 - 0x3080: 0x0080, 0x3081: 0x0080, 0x3082: 0x0080, - 0x3087: 0x0080, 0x3088: 0x0080, 0x3089: 0x0080, 0x308a: 0x0080, 0x308b: 0x0080, - 0x308c: 0x0080, 0x308d: 0x0080, 0x308e: 0x0080, 0x308f: 0x0080, 0x3090: 0x0080, 0x3091: 0x0080, - 0x3092: 0x0080, 0x3093: 0x0080, 0x3094: 0x0080, 0x3095: 0x0080, 0x3096: 0x0080, 0x3097: 0x0080, - 0x3098: 0x0080, 0x3099: 0x0080, 0x309a: 0x0080, 0x309b: 0x0080, 0x309c: 0x0080, 0x309d: 0x0080, - 0x309e: 0x0080, 0x309f: 0x0080, 0x30a0: 0x0080, 0x30a1: 0x0080, 0x30a2: 0x0080, 0x30a3: 0x0080, - 0x30a4: 0x0080, 0x30a5: 0x0080, 0x30a6: 0x0080, 0x30a7: 0x0080, 0x30a8: 0x0080, 0x30a9: 0x0080, - 0x30aa: 0x0080, 0x30ab: 0x0080, 0x30ac: 0x0080, 0x30ad: 0x0080, 0x30ae: 0x0080, 0x30af: 0x0080, - 0x30b0: 0x0080, 0x30b1: 0x0080, 0x30b2: 0x0080, 0x30b3: 0x0080, - 0x30b7: 0x0080, 0x30b8: 0x0080, 0x30b9: 0x0080, 0x30ba: 0x0080, 0x30bb: 0x0080, - 0x30bc: 0x0080, 0x30bd: 0x0080, 0x30be: 0x0080, 0x30bf: 0x0080, - // Block 0xc3, offset 0x30c0 - 0x30c0: 0x0088, 0x30c1: 0x0088, 0x30c2: 0x0088, 0x30c3: 0x0088, 0x30c4: 0x0088, 0x30c5: 0x0088, - 0x30c6: 0x0088, 0x30c7: 0x0088, 0x30c8: 0x0088, 0x30c9: 0x0088, 0x30ca: 0x0088, 0x30cb: 0x0088, - 0x30cc: 0x0088, 0x30cd: 0x0088, 0x30ce: 0x0088, 0x30cf: 0x0088, 0x30d0: 0x0088, 0x30d1: 0x0088, - 0x30d2: 0x0088, 0x30d3: 0x0088, 0x30d4: 0x0088, 0x30d5: 0x0088, 0x30d6: 0x0088, 0x30d7: 0x0088, - 0x30d8: 0x0088, 0x30d9: 0x0088, 0x30da: 0x0088, 0x30db: 0x0088, 0x30dc: 0x0088, 0x30dd: 0x0088, - 0x30de: 0x0088, 0x30df: 0x0088, 0x30e0: 0x0088, 0x30e1: 0x0088, 0x30e2: 0x0088, 0x30e3: 0x0088, - 0x30e4: 0x0088, 0x30e5: 0x0088, 0x30e6: 0x0088, 0x30e7: 0x0088, 0x30e8: 0x0088, 0x30e9: 0x0088, - 0x30ea: 0x0088, 0x30eb: 0x0088, 0x30ec: 0x0088, 0x30ed: 0x0088, 0x30ee: 0x0088, 0x30ef: 0x0088, - 0x30f0: 0x0088, 0x30f1: 0x0088, 0x30f2: 0x0088, 0x30f3: 0x0088, 0x30f4: 0x0088, 0x30f5: 0x0088, - 0x30f6: 0x0088, 0x30f7: 0x0088, 0x30f8: 0x0088, 0x30f9: 0x0088, 0x30fa: 0x0088, 0x30fb: 0x0088, - 0x30fc: 0x0088, 0x30fd: 0x0088, 0x30fe: 0x0088, 0x30ff: 0x0088, - // Block 0xc4, offset 0x3100 - 0x3100: 0x0088, 0x3101: 0x0088, 0x3102: 0x0088, 0x3103: 0x0088, 0x3104: 0x0088, 0x3105: 0x0088, - 0x3106: 0x0088, 0x3107: 0x0088, 0x3108: 0x0088, 0x3109: 0x0088, 0x310a: 0x0088, 0x310b: 0x0088, - 0x310c: 0x0088, 0x310d: 0x0088, 0x310e: 0x0088, 0x3110: 0x0080, 0x3111: 0x0080, - 0x3112: 0x0080, 0x3113: 0x0080, 0x3114: 0x0080, 0x3115: 0x0080, 0x3116: 0x0080, 0x3117: 0x0080, - 0x3118: 0x0080, 0x3119: 0x0080, 0x311a: 0x0080, 0x311b: 0x0080, - 0x3120: 0x0088, - // Block 0xc5, offset 0x3140 - 0x3150: 0x0080, 0x3151: 0x0080, - 0x3152: 0x0080, 0x3153: 0x0080, 0x3154: 0x0080, 0x3155: 0x0080, 0x3156: 0x0080, 0x3157: 0x0080, - 0x3158: 0x0080, 0x3159: 0x0080, 0x315a: 0x0080, 0x315b: 0x0080, 0x315c: 0x0080, 0x315d: 0x0080, - 0x315e: 0x0080, 0x315f: 0x0080, 0x3160: 0x0080, 0x3161: 0x0080, 0x3162: 0x0080, 0x3163: 0x0080, - 0x3164: 0x0080, 0x3165: 0x0080, 0x3166: 0x0080, 0x3167: 0x0080, 0x3168: 0x0080, 0x3169: 0x0080, - 0x316a: 0x0080, 0x316b: 0x0080, 0x316c: 0x0080, 0x316d: 0x0080, 0x316e: 0x0080, 0x316f: 0x0080, - 0x3170: 0x0080, 0x3171: 0x0080, 0x3172: 0x0080, 0x3173: 0x0080, 0x3174: 0x0080, 0x3175: 0x0080, - 0x3176: 0x0080, 0x3177: 0x0080, 0x3178: 0x0080, 0x3179: 0x0080, 0x317a: 0x0080, 0x317b: 0x0080, - 0x317c: 0x0080, 0x317d: 0x00c3, - // Block 0xc6, offset 0x3180 - 0x3180: 0x00c0, 0x3181: 0x00c0, 0x3182: 0x00c0, 0x3183: 0x00c0, 0x3184: 0x00c0, 0x3185: 0x00c0, - 0x3186: 0x00c0, 0x3187: 0x00c0, 0x3188: 0x00c0, 0x3189: 0x00c0, 0x318a: 0x00c0, 0x318b: 0x00c0, - 0x318c: 0x00c0, 0x318d: 0x00c0, 0x318e: 0x00c0, 0x318f: 0x00c0, 0x3190: 0x00c0, 0x3191: 0x00c0, - 0x3192: 0x00c0, 0x3193: 0x00c0, 0x3194: 0x00c0, 0x3195: 0x00c0, 0x3196: 0x00c0, 0x3197: 0x00c0, - 0x3198: 0x00c0, 0x3199: 0x00c0, 0x319a: 0x00c0, 0x319b: 0x00c0, 0x319c: 0x00c0, - 0x31a0: 0x00c0, 0x31a1: 0x00c0, 0x31a2: 0x00c0, 0x31a3: 0x00c0, - 0x31a4: 0x00c0, 0x31a5: 0x00c0, 0x31a6: 0x00c0, 0x31a7: 0x00c0, 0x31a8: 0x00c0, 0x31a9: 0x00c0, - 0x31aa: 0x00c0, 0x31ab: 0x00c0, 0x31ac: 0x00c0, 0x31ad: 0x00c0, 0x31ae: 0x00c0, 0x31af: 0x00c0, - 0x31b0: 0x00c0, 0x31b1: 0x00c0, 0x31b2: 0x00c0, 0x31b3: 0x00c0, 0x31b4: 0x00c0, 0x31b5: 0x00c0, - 0x31b6: 0x00c0, 0x31b7: 0x00c0, 0x31b8: 0x00c0, 0x31b9: 0x00c0, 0x31ba: 0x00c0, 0x31bb: 0x00c0, - 0x31bc: 0x00c0, 0x31bd: 0x00c0, 0x31be: 0x00c0, 0x31bf: 0x00c0, - // Block 0xc7, offset 0x31c0 - 0x31c0: 0x00c0, 0x31c1: 0x00c0, 0x31c2: 0x00c0, 0x31c3: 0x00c0, 0x31c4: 0x00c0, 0x31c5: 0x00c0, - 0x31c6: 0x00c0, 0x31c7: 0x00c0, 0x31c8: 0x00c0, 0x31c9: 0x00c0, 0x31ca: 0x00c0, 0x31cb: 0x00c0, - 0x31cc: 0x00c0, 0x31cd: 0x00c0, 0x31ce: 0x00c0, 0x31cf: 0x00c0, 0x31d0: 0x00c0, - 0x31e0: 0x00c3, 0x31e1: 0x0080, 0x31e2: 0x0080, 0x31e3: 0x0080, - 0x31e4: 0x0080, 0x31e5: 0x0080, 0x31e6: 0x0080, 0x31e7: 0x0080, 0x31e8: 0x0080, 0x31e9: 0x0080, - 0x31ea: 0x0080, 0x31eb: 0x0080, 0x31ec: 0x0080, 0x31ed: 0x0080, 0x31ee: 0x0080, 0x31ef: 0x0080, - 0x31f0: 0x0080, 0x31f1: 0x0080, 0x31f2: 0x0080, 0x31f3: 0x0080, 0x31f4: 0x0080, 0x31f5: 0x0080, - 0x31f6: 0x0080, 0x31f7: 0x0080, 0x31f8: 0x0080, 0x31f9: 0x0080, 0x31fa: 0x0080, 0x31fb: 0x0080, - // Block 0xc8, offset 0x3200 - 0x3200: 0x00c0, 0x3201: 0x00c0, 0x3202: 0x00c0, 0x3203: 0x00c0, 0x3204: 0x00c0, 0x3205: 0x00c0, - 0x3206: 0x00c0, 0x3207: 0x00c0, 0x3208: 0x00c0, 0x3209: 0x00c0, 0x320a: 0x00c0, 0x320b: 0x00c0, - 0x320c: 0x00c0, 0x320d: 0x00c0, 0x320e: 0x00c0, 0x320f: 0x00c0, 0x3210: 0x00c0, 0x3211: 0x00c0, - 0x3212: 0x00c0, 0x3213: 0x00c0, 0x3214: 0x00c0, 0x3215: 0x00c0, 0x3216: 0x00c0, 0x3217: 0x00c0, - 0x3218: 0x00c0, 0x3219: 0x00c0, 0x321a: 0x00c0, 0x321b: 0x00c0, 0x321c: 0x00c0, 0x321d: 0x00c0, - 0x321e: 0x00c0, 0x321f: 0x00c0, 0x3220: 0x0080, 0x3221: 0x0080, 0x3222: 0x0080, 0x3223: 0x0080, - 0x3230: 0x00c0, 0x3231: 0x00c0, 0x3232: 0x00c0, 0x3233: 0x00c0, 0x3234: 0x00c0, 0x3235: 0x00c0, - 0x3236: 0x00c0, 0x3237: 0x00c0, 0x3238: 0x00c0, 0x3239: 0x00c0, 0x323a: 0x00c0, 0x323b: 0x00c0, - 0x323c: 0x00c0, 0x323d: 0x00c0, 0x323e: 0x00c0, 0x323f: 0x00c0, - // Block 0xc9, offset 0x3240 - 0x3240: 0x00c0, 0x3241: 0x0080, 0x3242: 0x00c0, 0x3243: 0x00c0, 0x3244: 0x00c0, 0x3245: 0x00c0, - 0x3246: 0x00c0, 0x3247: 0x00c0, 0x3248: 0x00c0, 0x3249: 0x00c0, 0x324a: 0x0080, - 0x3250: 0x00c0, 0x3251: 0x00c0, - 0x3252: 0x00c0, 0x3253: 0x00c0, 0x3254: 0x00c0, 0x3255: 0x00c0, 0x3256: 0x00c0, 0x3257: 0x00c0, - 0x3258: 0x00c0, 0x3259: 0x00c0, 0x325a: 0x00c0, 0x325b: 0x00c0, 0x325c: 0x00c0, 0x325d: 0x00c0, - 0x325e: 0x00c0, 0x325f: 0x00c0, 0x3260: 0x00c0, 0x3261: 0x00c0, 0x3262: 0x00c0, 0x3263: 0x00c0, - 0x3264: 0x00c0, 0x3265: 0x00c0, 0x3266: 0x00c0, 0x3267: 0x00c0, 0x3268: 0x00c0, 0x3269: 0x00c0, - 0x326a: 0x00c0, 0x326b: 0x00c0, 0x326c: 0x00c0, 0x326d: 0x00c0, 0x326e: 0x00c0, 0x326f: 0x00c0, - 0x3270: 0x00c0, 0x3271: 0x00c0, 0x3272: 0x00c0, 0x3273: 0x00c0, 0x3274: 0x00c0, 0x3275: 0x00c0, - 0x3276: 0x00c3, 0x3277: 0x00c3, 0x3278: 0x00c3, 0x3279: 0x00c3, 0x327a: 0x00c3, - // Block 0xca, offset 0x3280 - 0x3280: 0x00c0, 0x3281: 0x00c0, 0x3282: 0x00c0, 0x3283: 0x00c0, 0x3284: 0x00c0, 0x3285: 0x00c0, - 0x3286: 0x00c0, 0x3287: 0x00c0, 0x3288: 0x00c0, 0x3289: 0x00c0, 0x328a: 0x00c0, 0x328b: 0x00c0, - 0x328c: 0x00c0, 0x328d: 0x00c0, 0x328e: 0x00c0, 0x328f: 0x00c0, 0x3290: 0x00c0, 0x3291: 0x00c0, - 0x3292: 0x00c0, 0x3293: 0x00c0, 0x3294: 0x00c0, 0x3295: 0x00c0, 0x3296: 0x00c0, 0x3297: 0x00c0, - 0x3298: 0x00c0, 0x3299: 0x00c0, 0x329a: 0x00c0, 0x329b: 0x00c0, 0x329c: 0x00c0, 0x329d: 0x00c0, - 0x329f: 0x0080, 0x32a0: 0x00c0, 0x32a1: 0x00c0, 0x32a2: 0x00c0, 0x32a3: 0x00c0, - 0x32a4: 0x00c0, 0x32a5: 0x00c0, 0x32a6: 0x00c0, 0x32a7: 0x00c0, 0x32a8: 0x00c0, 0x32a9: 0x00c0, - 0x32aa: 0x00c0, 0x32ab: 0x00c0, 0x32ac: 0x00c0, 0x32ad: 0x00c0, 0x32ae: 0x00c0, 0x32af: 0x00c0, - 0x32b0: 0x00c0, 0x32b1: 0x00c0, 0x32b2: 0x00c0, 0x32b3: 0x00c0, 0x32b4: 0x00c0, 0x32b5: 0x00c0, - 0x32b6: 0x00c0, 0x32b7: 0x00c0, 0x32b8: 0x00c0, 0x32b9: 0x00c0, 0x32ba: 0x00c0, 0x32bb: 0x00c0, - 0x32bc: 0x00c0, 0x32bd: 0x00c0, 0x32be: 0x00c0, 0x32bf: 0x00c0, - // Block 0xcb, offset 0x32c0 - 0x32c0: 0x00c0, 0x32c1: 0x00c0, 0x32c2: 0x00c0, 0x32c3: 0x00c0, - 0x32c8: 0x00c0, 0x32c9: 0x00c0, 0x32ca: 0x00c0, 0x32cb: 0x00c0, - 0x32cc: 0x00c0, 0x32cd: 0x00c0, 0x32ce: 0x00c0, 0x32cf: 0x00c0, 0x32d0: 0x0080, 0x32d1: 0x0080, - 0x32d2: 0x0080, 0x32d3: 0x0080, 0x32d4: 0x0080, 0x32d5: 0x0080, - // Block 0xcc, offset 0x3300 - 0x3300: 0x00c0, 0x3301: 0x00c0, 0x3302: 0x00c0, 0x3303: 0x00c0, 0x3304: 0x00c0, 0x3305: 0x00c0, - 0x3306: 0x00c0, 0x3307: 0x00c0, 0x3308: 0x00c0, 0x3309: 0x00c0, 0x330a: 0x00c0, 0x330b: 0x00c0, - 0x330c: 0x00c0, 0x330d: 0x00c0, 0x330e: 0x00c0, 0x330f: 0x00c0, 0x3310: 0x00c0, 0x3311: 0x00c0, - 0x3312: 0x00c0, 0x3313: 0x00c0, 0x3314: 0x00c0, 0x3315: 0x00c0, 0x3316: 0x00c0, 0x3317: 0x00c0, - 0x3318: 0x00c0, 0x3319: 0x00c0, 0x331a: 0x00c0, 0x331b: 0x00c0, 0x331c: 0x00c0, 0x331d: 0x00c0, - 0x3320: 0x00c0, 0x3321: 0x00c0, 0x3322: 0x00c0, 0x3323: 0x00c0, - 0x3324: 0x00c0, 0x3325: 0x00c0, 0x3326: 0x00c0, 0x3327: 0x00c0, 0x3328: 0x00c0, 0x3329: 0x00c0, - 0x3330: 0x00c0, 0x3331: 0x00c0, 0x3332: 0x00c0, 0x3333: 0x00c0, 0x3334: 0x00c0, 0x3335: 0x00c0, - 0x3336: 0x00c0, 0x3337: 0x00c0, 0x3338: 0x00c0, 0x3339: 0x00c0, 0x333a: 0x00c0, 0x333b: 0x00c0, - 0x333c: 0x00c0, 0x333d: 0x00c0, 0x333e: 0x00c0, 0x333f: 0x00c0, - // Block 0xcd, offset 0x3340 - 0x3340: 0x00c0, 0x3341: 0x00c0, 0x3342: 0x00c0, 0x3343: 0x00c0, 0x3344: 0x00c0, 0x3345: 0x00c0, - 0x3346: 0x00c0, 0x3347: 0x00c0, 0x3348: 0x00c0, 0x3349: 0x00c0, 0x334a: 0x00c0, 0x334b: 0x00c0, - 0x334c: 0x00c0, 0x334d: 0x00c0, 0x334e: 0x00c0, 0x334f: 0x00c0, 0x3350: 0x00c0, 0x3351: 0x00c0, - 0x3352: 0x00c0, 0x3353: 0x00c0, - 0x3358: 0x00c0, 0x3359: 0x00c0, 0x335a: 0x00c0, 0x335b: 0x00c0, 0x335c: 0x00c0, 0x335d: 0x00c0, - 0x335e: 0x00c0, 0x335f: 0x00c0, 0x3360: 0x00c0, 0x3361: 0x00c0, 0x3362: 0x00c0, 0x3363: 0x00c0, - 0x3364: 0x00c0, 0x3365: 0x00c0, 0x3366: 0x00c0, 0x3367: 0x00c0, 0x3368: 0x00c0, 0x3369: 0x00c0, - 0x336a: 0x00c0, 0x336b: 0x00c0, 0x336c: 0x00c0, 0x336d: 0x00c0, 0x336e: 0x00c0, 0x336f: 0x00c0, - 0x3370: 0x00c0, 0x3371: 0x00c0, 0x3372: 0x00c0, 0x3373: 0x00c0, 0x3374: 0x00c0, 0x3375: 0x00c0, - 0x3376: 0x00c0, 0x3377: 0x00c0, 0x3378: 0x00c0, 0x3379: 0x00c0, 0x337a: 0x00c0, 0x337b: 0x00c0, - // Block 0xce, offset 0x3380 - 0x3380: 0x00c0, 0x3381: 0x00c0, 0x3382: 0x00c0, 0x3383: 0x00c0, 0x3384: 0x00c0, 0x3385: 0x00c0, - 0x3386: 0x00c0, 0x3387: 0x00c0, 0x3388: 0x00c0, 0x3389: 0x00c0, 0x338a: 0x00c0, 0x338b: 0x00c0, - 0x338c: 0x00c0, 0x338d: 0x00c0, 0x338e: 0x00c0, 0x338f: 0x00c0, 0x3390: 0x00c0, 0x3391: 0x00c0, - 0x3392: 0x00c0, 0x3393: 0x00c0, 0x3394: 0x00c0, 0x3395: 0x00c0, 0x3396: 0x00c0, 0x3397: 0x00c0, - 0x3398: 0x00c0, 0x3399: 0x00c0, 0x339a: 0x00c0, 0x339b: 0x00c0, 0x339c: 0x00c0, 0x339d: 0x00c0, - 0x339e: 0x00c0, 0x339f: 0x00c0, 0x33a0: 0x00c0, 0x33a1: 0x00c0, 0x33a2: 0x00c0, 0x33a3: 0x00c0, - 0x33a4: 0x00c0, 0x33a5: 0x00c0, 0x33a6: 0x00c0, 0x33a7: 0x00c0, - 0x33b0: 0x00c0, 0x33b1: 0x00c0, 0x33b2: 0x00c0, 0x33b3: 0x00c0, 0x33b4: 0x00c0, 0x33b5: 0x00c0, - 0x33b6: 0x00c0, 0x33b7: 0x00c0, 0x33b8: 0x00c0, 0x33b9: 0x00c0, 0x33ba: 0x00c0, 0x33bb: 0x00c0, - 0x33bc: 0x00c0, 0x33bd: 0x00c0, 0x33be: 0x00c0, 0x33bf: 0x00c0, - // Block 0xcf, offset 0x33c0 - 0x33c0: 0x00c0, 0x33c1: 0x00c0, 0x33c2: 0x00c0, 0x33c3: 0x00c0, 0x33c4: 0x00c0, 0x33c5: 0x00c0, - 0x33c6: 0x00c0, 0x33c7: 0x00c0, 0x33c8: 0x00c0, 0x33c9: 0x00c0, 0x33ca: 0x00c0, 0x33cb: 0x00c0, - 0x33cc: 0x00c0, 0x33cd: 0x00c0, 0x33ce: 0x00c0, 0x33cf: 0x00c0, 0x33d0: 0x00c0, 0x33d1: 0x00c0, - 0x33d2: 0x00c0, 0x33d3: 0x00c0, 0x33d4: 0x00c0, 0x33d5: 0x00c0, 0x33d6: 0x00c0, 0x33d7: 0x00c0, - 0x33d8: 0x00c0, 0x33d9: 0x00c0, 0x33da: 0x00c0, 0x33db: 0x00c0, 0x33dc: 0x00c0, 0x33dd: 0x00c0, - 0x33de: 0x00c0, 0x33df: 0x00c0, 0x33e0: 0x00c0, 0x33e1: 0x00c0, 0x33e2: 0x00c0, 0x33e3: 0x00c0, - 0x33ef: 0x0080, - // Block 0xd0, offset 0x3400 - 0x3400: 0x00c0, 0x3401: 0x00c0, 0x3402: 0x00c0, 0x3403: 0x00c0, 0x3404: 0x00c0, 0x3405: 0x00c0, - 0x3406: 0x00c0, 0x3407: 0x00c0, 0x3408: 0x00c0, 0x3409: 0x00c0, 0x340a: 0x00c0, 0x340b: 0x00c0, - 0x340c: 0x00c0, 0x340d: 0x00c0, 0x340e: 0x00c0, 0x340f: 0x00c0, 0x3410: 0x00c0, 0x3411: 0x00c0, - 0x3412: 0x00c0, 0x3413: 0x00c0, 0x3414: 0x00c0, 0x3415: 0x00c0, 0x3416: 0x00c0, 0x3417: 0x00c0, - 0x3418: 0x00c0, 0x3419: 0x00c0, 0x341a: 0x00c0, 0x341b: 0x00c0, 0x341c: 0x00c0, 0x341d: 0x00c0, - 0x341e: 0x00c0, 0x341f: 0x00c0, 0x3420: 0x00c0, 0x3421: 0x00c0, 0x3422: 0x00c0, 0x3423: 0x00c0, - 0x3424: 0x00c0, 0x3425: 0x00c0, 0x3426: 0x00c0, 0x3427: 0x00c0, 0x3428: 0x00c0, 0x3429: 0x00c0, - 0x342a: 0x00c0, 0x342b: 0x00c0, 0x342c: 0x00c0, 0x342d: 0x00c0, 0x342e: 0x00c0, 0x342f: 0x00c0, - 0x3430: 0x00c0, 0x3431: 0x00c0, 0x3432: 0x00c0, 0x3433: 0x00c0, 0x3434: 0x00c0, 0x3435: 0x00c0, - 0x3436: 0x00c0, - // Block 0xd1, offset 0x3440 - 0x3440: 0x00c0, 0x3441: 0x00c0, 0x3442: 0x00c0, 0x3443: 0x00c0, 0x3444: 0x00c0, 0x3445: 0x00c0, - 0x3446: 0x00c0, 0x3447: 0x00c0, 0x3448: 0x00c0, 0x3449: 0x00c0, 0x344a: 0x00c0, 0x344b: 0x00c0, - 0x344c: 0x00c0, 0x344d: 0x00c0, 0x344e: 0x00c0, 0x344f: 0x00c0, 0x3450: 0x00c0, 0x3451: 0x00c0, - 0x3452: 0x00c0, 0x3453: 0x00c0, 0x3454: 0x00c0, 0x3455: 0x00c0, - 0x3460: 0x00c0, 0x3461: 0x00c0, 0x3462: 0x00c0, 0x3463: 0x00c0, - 0x3464: 0x00c0, 0x3465: 0x00c0, 0x3466: 0x00c0, 0x3467: 0x00c0, - // Block 0xd2, offset 0x3480 - 0x3480: 0x00c0, 0x3481: 0x00c0, 0x3482: 0x00c0, 0x3483: 0x00c0, 0x3484: 0x00c0, 0x3485: 0x00c0, - 0x3488: 0x00c0, 0x348a: 0x00c0, 0x348b: 0x00c0, - 0x348c: 0x00c0, 0x348d: 0x00c0, 0x348e: 0x00c0, 0x348f: 0x00c0, 0x3490: 0x00c0, 0x3491: 0x00c0, - 0x3492: 0x00c0, 0x3493: 0x00c0, 0x3494: 0x00c0, 0x3495: 0x00c0, 0x3496: 0x00c0, 0x3497: 0x00c0, - 0x3498: 0x00c0, 0x3499: 0x00c0, 0x349a: 0x00c0, 0x349b: 0x00c0, 0x349c: 0x00c0, 0x349d: 0x00c0, - 0x349e: 0x00c0, 0x349f: 0x00c0, 0x34a0: 0x00c0, 0x34a1: 0x00c0, 0x34a2: 0x00c0, 0x34a3: 0x00c0, - 0x34a4: 0x00c0, 0x34a5: 0x00c0, 0x34a6: 0x00c0, 0x34a7: 0x00c0, 0x34a8: 0x00c0, 0x34a9: 0x00c0, - 0x34aa: 0x00c0, 0x34ab: 0x00c0, 0x34ac: 0x00c0, 0x34ad: 0x00c0, 0x34ae: 0x00c0, 0x34af: 0x00c0, - 0x34b0: 0x00c0, 0x34b1: 0x00c0, 0x34b2: 0x00c0, 0x34b3: 0x00c0, 0x34b4: 0x00c0, 0x34b5: 0x00c0, - 0x34b7: 0x00c0, 0x34b8: 0x00c0, - 0x34bc: 0x00c0, 0x34bf: 0x00c0, - // Block 0xd3, offset 0x34c0 - 0x34c0: 0x00c0, 0x34c1: 0x00c0, 0x34c2: 0x00c0, 0x34c3: 0x00c0, 0x34c4: 0x00c0, 0x34c5: 0x00c0, - 0x34c6: 0x00c0, 0x34c7: 0x00c0, 0x34c8: 0x00c0, 0x34c9: 0x00c0, 0x34ca: 0x00c0, 0x34cb: 0x00c0, - 0x34cc: 0x00c0, 0x34cd: 0x00c0, 0x34ce: 0x00c0, 0x34cf: 0x00c0, 0x34d0: 0x00c0, 0x34d1: 0x00c0, - 0x34d2: 0x00c0, 0x34d3: 0x00c0, 0x34d4: 0x00c0, 0x34d5: 0x00c0, 0x34d7: 0x0080, - 0x34d8: 0x0080, 0x34d9: 0x0080, 0x34da: 0x0080, 0x34db: 0x0080, 0x34dc: 0x0080, 0x34dd: 0x0080, - 0x34de: 0x0080, 0x34df: 0x0080, 0x34e0: 0x00c0, 0x34e1: 0x00c0, 0x34e2: 0x00c0, 0x34e3: 0x00c0, - 0x34e4: 0x00c0, 0x34e5: 0x00c0, 0x34e6: 0x00c0, 0x34e7: 0x00c0, 0x34e8: 0x00c0, 0x34e9: 0x00c0, - 0x34ea: 0x00c0, 0x34eb: 0x00c0, 0x34ec: 0x00c0, 0x34ed: 0x00c0, 0x34ee: 0x00c0, 0x34ef: 0x00c0, - 0x34f0: 0x00c0, 0x34f1: 0x00c0, 0x34f2: 0x00c0, 0x34f3: 0x00c0, 0x34f4: 0x00c0, 0x34f5: 0x00c0, - 0x34f6: 0x00c0, 0x34f7: 0x0080, 0x34f8: 0x0080, 0x34f9: 0x0080, 0x34fa: 0x0080, 0x34fb: 0x0080, - 0x34fc: 0x0080, 0x34fd: 0x0080, 0x34fe: 0x0080, 0x34ff: 0x0080, - // Block 0xd4, offset 0x3500 - 0x3500: 0x00c0, 0x3501: 0x00c0, 0x3502: 0x00c0, 0x3503: 0x00c0, 0x3504: 0x00c0, 0x3505: 0x00c0, - 0x3506: 0x00c0, 0x3507: 0x00c0, 0x3508: 0x00c0, 0x3509: 0x00c0, 0x350a: 0x00c0, 0x350b: 0x00c0, - 0x350c: 0x00c0, 0x350d: 0x00c0, 0x350e: 0x00c0, 0x350f: 0x00c0, 0x3510: 0x00c0, 0x3511: 0x00c0, - 0x3512: 0x00c0, 0x3513: 0x00c0, 0x3514: 0x00c0, 0x3515: 0x00c0, 0x3516: 0x00c0, 0x3517: 0x00c0, - 0x3518: 0x00c0, 0x3519: 0x00c0, 0x351a: 0x00c0, 0x351b: 0x00c0, 0x351c: 0x00c0, 0x351d: 0x00c0, - 0x351e: 0x00c0, - 0x3527: 0x0080, 0x3528: 0x0080, 0x3529: 0x0080, - 0x352a: 0x0080, 0x352b: 0x0080, 0x352c: 0x0080, 0x352d: 0x0080, 0x352e: 0x0080, 0x352f: 0x0080, - // Block 0xd5, offset 0x3540 - 0x3560: 0x00c0, 0x3561: 0x00c0, 0x3562: 0x00c0, 0x3563: 0x00c0, - 0x3564: 0x00c0, 0x3565: 0x00c0, 0x3566: 0x00c0, 0x3567: 0x00c0, 0x3568: 0x00c0, 0x3569: 0x00c0, - 0x356a: 0x00c0, 0x356b: 0x00c0, 0x356c: 0x00c0, 0x356d: 0x00c0, 0x356e: 0x00c0, 0x356f: 0x00c0, - 0x3570: 0x00c0, 0x3571: 0x00c0, 0x3572: 0x00c0, 0x3574: 0x00c0, 0x3575: 0x00c0, - 0x357b: 0x0080, - 0x357c: 0x0080, 0x357d: 0x0080, 0x357e: 0x0080, 0x357f: 0x0080, - // Block 0xd6, offset 0x3580 - 0x3580: 0x00c0, 0x3581: 0x00c0, 0x3582: 0x00c0, 0x3583: 0x00c0, 0x3584: 0x00c0, 0x3585: 0x00c0, - 0x3586: 0x00c0, 0x3587: 0x00c0, 0x3588: 0x00c0, 0x3589: 0x00c0, 0x358a: 0x00c0, 0x358b: 0x00c0, - 0x358c: 0x00c0, 0x358d: 0x00c0, 0x358e: 0x00c0, 0x358f: 0x00c0, 0x3590: 0x00c0, 0x3591: 0x00c0, - 0x3592: 0x00c0, 0x3593: 0x00c0, 0x3594: 0x00c0, 0x3595: 0x00c0, 0x3596: 0x0080, 0x3597: 0x0080, - 0x3598: 0x0080, 0x3599: 0x0080, 0x359a: 0x0080, 0x359b: 0x0080, - 0x359f: 0x0080, 0x35a0: 0x00c0, 0x35a1: 0x00c0, 0x35a2: 0x00c0, 0x35a3: 0x00c0, - 0x35a4: 0x00c0, 0x35a5: 0x00c0, 0x35a6: 0x00c0, 0x35a7: 0x00c0, 0x35a8: 0x00c0, 0x35a9: 0x00c0, - 0x35aa: 0x00c0, 0x35ab: 0x00c0, 0x35ac: 0x00c0, 0x35ad: 0x00c0, 0x35ae: 0x00c0, 0x35af: 0x00c0, - 0x35b0: 0x00c0, 0x35b1: 0x00c0, 0x35b2: 0x00c0, 0x35b3: 0x00c0, 0x35b4: 0x00c0, 0x35b5: 0x00c0, - 0x35b6: 0x00c0, 0x35b7: 0x00c0, 0x35b8: 0x00c0, 0x35b9: 0x00c0, - 0x35bf: 0x0080, - // Block 0xd7, offset 0x35c0 - 0x35c0: 0x00c0, 0x35c1: 0x00c0, 0x35c2: 0x00c0, 0x35c3: 0x00c0, 0x35c4: 0x00c0, 0x35c5: 0x00c0, - 0x35c6: 0x00c0, 0x35c7: 0x00c0, 0x35c8: 0x00c0, 0x35c9: 0x00c0, 0x35ca: 0x00c0, 0x35cb: 0x00c0, - 0x35cc: 0x00c0, 0x35cd: 0x00c0, 0x35ce: 0x00c0, 0x35cf: 0x00c0, 0x35d0: 0x00c0, 0x35d1: 0x00c0, - 0x35d2: 0x00c0, 0x35d3: 0x00c0, 0x35d4: 0x00c0, 0x35d5: 0x00c0, 0x35d6: 0x00c0, 0x35d7: 0x00c0, - 0x35d8: 0x00c0, 0x35d9: 0x00c0, 0x35da: 0x00c0, 0x35db: 0x00c0, 0x35dc: 0x00c0, 0x35dd: 0x00c0, - 0x35de: 0x00c0, 0x35df: 0x00c0, 0x35e0: 0x00c0, 0x35e1: 0x00c0, 0x35e2: 0x00c0, 0x35e3: 0x00c0, - 0x35e4: 0x00c0, 0x35e5: 0x00c0, 0x35e6: 0x00c0, 0x35e7: 0x00c0, 0x35e8: 0x00c0, 0x35e9: 0x00c0, - 0x35ea: 0x00c0, 0x35eb: 0x00c0, 0x35ec: 0x00c0, 0x35ed: 0x00c0, 0x35ee: 0x00c0, 0x35ef: 0x00c0, - 0x35f0: 0x00c0, 0x35f1: 0x00c0, 0x35f2: 0x00c0, 0x35f3: 0x00c0, 0x35f4: 0x00c0, 0x35f5: 0x00c0, - 0x35f6: 0x00c0, 0x35f7: 0x00c0, - 0x35fc: 0x0080, 0x35fd: 0x0080, 0x35fe: 0x00c0, 0x35ff: 0x00c0, - // Block 0xd8, offset 0x3600 - 0x3600: 0x00c0, 0x3601: 0x00c3, 0x3602: 0x00c3, 0x3603: 0x00c3, 0x3605: 0x00c3, - 0x3606: 0x00c3, - 0x360c: 0x00c3, 0x360d: 0x00c3, 0x360e: 0x00c3, 0x360f: 0x00c3, 0x3610: 0x00c0, 0x3611: 0x00c0, - 0x3612: 0x00c0, 0x3613: 0x00c0, 0x3615: 0x00c0, 0x3616: 0x00c0, 0x3617: 0x00c0, - 0x3619: 0x00c0, 0x361a: 0x00c0, 0x361b: 0x00c0, 0x361c: 0x00c0, 0x361d: 0x00c0, - 0x361e: 0x00c0, 0x361f: 0x00c0, 0x3620: 0x00c0, 0x3621: 0x00c0, 0x3622: 0x00c0, 0x3623: 0x00c0, - 0x3624: 0x00c0, 0x3625: 0x00c0, 0x3626: 0x00c0, 0x3627: 0x00c0, 0x3628: 0x00c0, 0x3629: 0x00c0, - 0x362a: 0x00c0, 0x362b: 0x00c0, 0x362c: 0x00c0, 0x362d: 0x00c0, 0x362e: 0x00c0, 0x362f: 0x00c0, - 0x3630: 0x00c0, 0x3631: 0x00c0, 0x3632: 0x00c0, 0x3633: 0x00c0, - 0x3638: 0x00c3, 0x3639: 0x00c3, 0x363a: 0x00c3, - 0x363f: 0x00c6, - // Block 0xd9, offset 0x3640 - 0x3640: 0x0080, 0x3641: 0x0080, 0x3642: 0x0080, 0x3643: 0x0080, 0x3644: 0x0080, 0x3645: 0x0080, - 0x3646: 0x0080, 0x3647: 0x0080, - 0x3650: 0x0080, 0x3651: 0x0080, - 0x3652: 0x0080, 0x3653: 0x0080, 0x3654: 0x0080, 0x3655: 0x0080, 0x3656: 0x0080, 0x3657: 0x0080, - 0x3658: 0x0080, - 0x3660: 0x00c0, 0x3661: 0x00c0, 0x3662: 0x00c0, 0x3663: 0x00c0, - 0x3664: 0x00c0, 0x3665: 0x00c0, 0x3666: 0x00c0, 0x3667: 0x00c0, 0x3668: 0x00c0, 0x3669: 0x00c0, - 0x366a: 0x00c0, 0x366b: 0x00c0, 0x366c: 0x00c0, 0x366d: 0x00c0, 0x366e: 0x00c0, 0x366f: 0x00c0, - 0x3670: 0x00c0, 0x3671: 0x00c0, 0x3672: 0x00c0, 0x3673: 0x00c0, 0x3674: 0x00c0, 0x3675: 0x00c0, - 0x3676: 0x00c0, 0x3677: 0x00c0, 0x3678: 0x00c0, 0x3679: 0x00c0, 0x367a: 0x00c0, 0x367b: 0x00c0, - 0x367c: 0x00c0, 0x367d: 0x0080, 0x367e: 0x0080, 0x367f: 0x0080, - // Block 0xda, offset 0x3680 - 0x3680: 0x00c0, 0x3681: 0x00c0, 0x3682: 0x00c0, 0x3683: 0x00c0, 0x3684: 0x00c0, 0x3685: 0x00c0, - 0x3686: 0x00c0, 0x3687: 0x00c0, 0x3688: 0x00c0, 0x3689: 0x00c0, 0x368a: 0x00c0, 0x368b: 0x00c0, - 0x368c: 0x00c0, 0x368d: 0x00c0, 0x368e: 0x00c0, 0x368f: 0x00c0, 0x3690: 0x00c0, 0x3691: 0x00c0, - 0x3692: 0x00c0, 0x3693: 0x00c0, 0x3694: 0x00c0, 0x3695: 0x00c0, 0x3696: 0x00c0, 0x3697: 0x00c0, - 0x3698: 0x00c0, 0x3699: 0x00c0, 0x369a: 0x00c0, 0x369b: 0x00c0, 0x369c: 0x00c0, 0x369d: 0x0080, - 0x369e: 0x0080, 0x369f: 0x0080, - // Block 0xdb, offset 0x36c0 - 0x36c0: 0x00c2, 0x36c1: 0x00c2, 0x36c2: 0x00c2, 0x36c3: 0x00c2, 0x36c4: 0x00c2, 0x36c5: 0x00c4, - 0x36c6: 0x00c0, 0x36c7: 0x00c4, 0x36c8: 0x0080, 0x36c9: 0x00c4, 0x36ca: 0x00c4, 0x36cb: 0x00c0, - 0x36cc: 0x00c0, 0x36cd: 0x00c1, 0x36ce: 0x00c4, 0x36cf: 0x00c4, 0x36d0: 0x00c4, 0x36d1: 0x00c4, - 0x36d2: 0x00c4, 0x36d3: 0x00c2, 0x36d4: 0x00c2, 0x36d5: 0x00c2, 0x36d6: 0x00c2, 0x36d7: 0x00c1, - 0x36d8: 0x00c2, 0x36d9: 0x00c2, 0x36da: 0x00c2, 0x36db: 0x00c2, 0x36dc: 0x00c2, 0x36dd: 0x00c4, - 0x36de: 0x00c2, 0x36df: 0x00c2, 0x36e0: 0x00c2, 0x36e1: 0x00c4, 0x36e2: 0x00c0, 0x36e3: 0x00c0, - 0x36e4: 0x00c4, 0x36e5: 0x00c3, 0x36e6: 0x00c3, - 0x36eb: 0x0082, 0x36ec: 0x0082, 0x36ed: 0x0082, 0x36ee: 0x0082, 0x36ef: 0x0084, - 0x36f0: 0x0080, 0x36f1: 0x0080, 0x36f2: 0x0080, 0x36f3: 0x0080, 0x36f4: 0x0080, 0x36f5: 0x0080, - 0x36f6: 0x0080, - // Block 0xdc, offset 0x3700 - 0x3700: 0x00c0, 0x3701: 0x00c0, 0x3702: 0x00c0, 0x3703: 0x00c0, 0x3704: 0x00c0, 0x3705: 0x00c0, - 0x3706: 0x00c0, 0x3707: 0x00c0, 0x3708: 0x00c0, 0x3709: 0x00c0, 0x370a: 0x00c0, 0x370b: 0x00c0, - 0x370c: 0x00c0, 0x370d: 0x00c0, 0x370e: 0x00c0, 0x370f: 0x00c0, 0x3710: 0x00c0, 0x3711: 0x00c0, - 0x3712: 0x00c0, 0x3713: 0x00c0, 0x3714: 0x00c0, 0x3715: 0x00c0, 0x3716: 0x00c0, 0x3717: 0x00c0, - 0x3718: 0x00c0, 0x3719: 0x00c0, 0x371a: 0x00c0, 0x371b: 0x00c0, 0x371c: 0x00c0, 0x371d: 0x00c0, - 0x371e: 0x00c0, 0x371f: 0x00c0, 0x3720: 0x00c0, 0x3721: 0x00c0, 0x3722: 0x00c0, 0x3723: 0x00c0, - 0x3724: 0x00c0, 0x3725: 0x00c0, 0x3726: 0x00c0, 0x3727: 0x00c0, 0x3728: 0x00c0, 0x3729: 0x00c0, - 0x372a: 0x00c0, 0x372b: 0x00c0, 0x372c: 0x00c0, 0x372d: 0x00c0, 0x372e: 0x00c0, 0x372f: 0x00c0, - 0x3730: 0x00c0, 0x3731: 0x00c0, 0x3732: 0x00c0, 0x3733: 0x00c0, 0x3734: 0x00c0, 0x3735: 0x00c0, - 0x3739: 0x0080, 0x373a: 0x0080, 0x373b: 0x0080, - 0x373c: 0x0080, 0x373d: 0x0080, 0x373e: 0x0080, 0x373f: 0x0080, - // Block 0xdd, offset 0x3740 - 0x3740: 0x00c0, 0x3741: 0x00c0, 0x3742: 0x00c0, 0x3743: 0x00c0, 0x3744: 0x00c0, 0x3745: 0x00c0, - 0x3746: 0x00c0, 0x3747: 0x00c0, 0x3748: 0x00c0, 0x3749: 0x00c0, 0x374a: 0x00c0, 0x374b: 0x00c0, - 0x374c: 0x00c0, 0x374d: 0x00c0, 0x374e: 0x00c0, 0x374f: 0x00c0, 0x3750: 0x00c0, 0x3751: 0x00c0, - 0x3752: 0x00c0, 0x3753: 0x00c0, 0x3754: 0x00c0, 0x3755: 0x00c0, - 0x3758: 0x0080, 0x3759: 0x0080, 0x375a: 0x0080, 0x375b: 0x0080, 0x375c: 0x0080, 0x375d: 0x0080, - 0x375e: 0x0080, 0x375f: 0x0080, 0x3760: 0x00c0, 0x3761: 0x00c0, 0x3762: 0x00c0, 0x3763: 0x00c0, - 0x3764: 0x00c0, 0x3765: 0x00c0, 0x3766: 0x00c0, 0x3767: 0x00c0, 0x3768: 0x00c0, 0x3769: 0x00c0, - 0x376a: 0x00c0, 0x376b: 0x00c0, 0x376c: 0x00c0, 0x376d: 0x00c0, 0x376e: 0x00c0, 0x376f: 0x00c0, - 0x3770: 0x00c0, 0x3771: 0x00c0, 0x3772: 0x00c0, - 0x3778: 0x0080, 0x3779: 0x0080, 0x377a: 0x0080, 0x377b: 0x0080, - 0x377c: 0x0080, 0x377d: 0x0080, 0x377e: 0x0080, 0x377f: 0x0080, - // Block 0xde, offset 0x3780 - 0x3780: 0x00c2, 0x3781: 0x00c4, 0x3782: 0x00c2, 0x3783: 0x00c4, 0x3784: 0x00c4, 0x3785: 0x00c4, - 0x3786: 0x00c2, 0x3787: 0x00c2, 0x3788: 0x00c2, 0x3789: 0x00c4, 0x378a: 0x00c2, 0x378b: 0x00c2, - 0x378c: 0x00c4, 0x378d: 0x00c2, 0x378e: 0x00c4, 0x378f: 0x00c4, 0x3790: 0x00c2, 0x3791: 0x00c4, - 0x3799: 0x0080, 0x379a: 0x0080, 0x379b: 0x0080, 0x379c: 0x0080, - 0x37a9: 0x0084, - 0x37aa: 0x0084, 0x37ab: 0x0084, 0x37ac: 0x0084, 0x37ad: 0x0082, 0x37ae: 0x0082, 0x37af: 0x0080, - // Block 0xdf, offset 0x37c0 - 0x37c0: 0x00c0, 0x37c1: 0x00c0, 0x37c2: 0x00c0, 0x37c3: 0x00c0, 0x37c4: 0x00c0, 0x37c5: 0x00c0, - 0x37c6: 0x00c0, 0x37c7: 0x00c0, 0x37c8: 0x00c0, 0x37c9: 0x00c0, 0x37ca: 0x00c0, 0x37cb: 0x00c0, - 0x37cc: 0x00c0, 0x37cd: 0x00c0, 0x37ce: 0x00c0, 0x37cf: 0x00c0, 0x37d0: 0x00c0, 0x37d1: 0x00c0, - 0x37d2: 0x00c0, 0x37d3: 0x00c0, 0x37d4: 0x00c0, 0x37d5: 0x00c0, 0x37d6: 0x00c0, 0x37d7: 0x00c0, - 0x37d8: 0x00c0, 0x37d9: 0x00c0, 0x37da: 0x00c0, 0x37db: 0x00c0, 0x37dc: 0x00c0, 0x37dd: 0x00c0, - 0x37de: 0x00c0, 0x37df: 0x00c0, 0x37e0: 0x00c0, 0x37e1: 0x00c0, 0x37e2: 0x00c0, 0x37e3: 0x00c0, - 0x37e4: 0x00c0, 0x37e5: 0x00c0, 0x37e6: 0x00c0, 0x37e7: 0x00c0, 0x37e8: 0x00c0, 0x37e9: 0x00c0, - 0x37ea: 0x00c0, 0x37eb: 0x00c0, 0x37ec: 0x00c0, 0x37ed: 0x00c0, 0x37ee: 0x00c0, 0x37ef: 0x00c0, - 0x37f0: 0x00c0, 0x37f1: 0x00c0, 0x37f2: 0x00c0, - // Block 0xe0, offset 0x3800 - 0x3800: 0x00c0, 0x3801: 0x00c0, 0x3802: 0x00c0, 0x3803: 0x00c0, 0x3804: 0x00c0, 0x3805: 0x00c0, - 0x3806: 0x00c0, 0x3807: 0x00c0, 0x3808: 0x00c0, 0x3809: 0x00c0, 0x380a: 0x00c0, 0x380b: 0x00c0, - 0x380c: 0x00c0, 0x380d: 0x00c0, 0x380e: 0x00c0, 0x380f: 0x00c0, 0x3810: 0x00c0, 0x3811: 0x00c0, - 0x3812: 0x00c0, 0x3813: 0x00c0, 0x3814: 0x00c0, 0x3815: 0x00c0, 0x3816: 0x00c0, 0x3817: 0x00c0, - 0x3818: 0x00c0, 0x3819: 0x00c0, 0x381a: 0x00c0, 0x381b: 0x00c0, 0x381c: 0x00c0, 0x381d: 0x00c0, - 0x381e: 0x00c0, 0x381f: 0x00c0, 0x3820: 0x00c0, 0x3821: 0x00c0, 0x3822: 0x00c0, 0x3823: 0x00c0, - 0x3824: 0x00c0, 0x3825: 0x00c0, 0x3826: 0x00c0, 0x3827: 0x00c0, 0x3828: 0x00c0, 0x3829: 0x00c0, - 0x382a: 0x00c0, 0x382b: 0x00c0, 0x382c: 0x00c0, 0x382d: 0x00c0, 0x382e: 0x00c0, 0x382f: 0x00c0, - 0x3830: 0x00c0, 0x3831: 0x00c0, 0x3832: 0x00c0, - 0x383a: 0x0080, 0x383b: 0x0080, - 0x383c: 0x0080, 0x383d: 0x0080, 0x383e: 0x0080, 0x383f: 0x0080, - // Block 0xe1, offset 0x3840 - 0x3860: 0x0080, 0x3861: 0x0080, 0x3862: 0x0080, 0x3863: 0x0080, - 0x3864: 0x0080, 0x3865: 0x0080, 0x3866: 0x0080, 0x3867: 0x0080, 0x3868: 0x0080, 0x3869: 0x0080, - 0x386a: 0x0080, 0x386b: 0x0080, 0x386c: 0x0080, 0x386d: 0x0080, 0x386e: 0x0080, 0x386f: 0x0080, - 0x3870: 0x0080, 0x3871: 0x0080, 0x3872: 0x0080, 0x3873: 0x0080, 0x3874: 0x0080, 0x3875: 0x0080, - 0x3876: 0x0080, 0x3877: 0x0080, 0x3878: 0x0080, 0x3879: 0x0080, 0x387a: 0x0080, 0x387b: 0x0080, - 0x387c: 0x0080, 0x387d: 0x0080, 0x387e: 0x0080, - // Block 0xe2, offset 0x3880 - 0x3880: 0x00c0, 0x3881: 0x00c3, 0x3882: 0x00c0, 0x3883: 0x00c0, 0x3884: 0x00c0, 0x3885: 0x00c0, - 0x3886: 0x00c0, 0x3887: 0x00c0, 0x3888: 0x00c0, 0x3889: 0x00c0, 0x388a: 0x00c0, 0x388b: 0x00c0, - 0x388c: 0x00c0, 0x388d: 0x00c0, 0x388e: 0x00c0, 0x388f: 0x00c0, 0x3890: 0x00c0, 0x3891: 0x00c0, - 0x3892: 0x00c0, 0x3893: 0x00c0, 0x3894: 0x00c0, 0x3895: 0x00c0, 0x3896: 0x00c0, 0x3897: 0x00c0, - 0x3898: 0x00c0, 0x3899: 0x00c0, 0x389a: 0x00c0, 0x389b: 0x00c0, 0x389c: 0x00c0, 0x389d: 0x00c0, - 0x389e: 0x00c0, 0x389f: 0x00c0, 0x38a0: 0x00c0, 0x38a1: 0x00c0, 0x38a2: 0x00c0, 0x38a3: 0x00c0, - 0x38a4: 0x00c0, 0x38a5: 0x00c0, 0x38a6: 0x00c0, 0x38a7: 0x00c0, 0x38a8: 0x00c0, 0x38a9: 0x00c0, - 0x38aa: 0x00c0, 0x38ab: 0x00c0, 0x38ac: 0x00c0, 0x38ad: 0x00c0, 0x38ae: 0x00c0, 0x38af: 0x00c0, - 0x38b0: 0x00c0, 0x38b1: 0x00c0, 0x38b2: 0x00c0, 0x38b3: 0x00c0, 0x38b4: 0x00c0, 0x38b5: 0x00c0, - 0x38b6: 0x00c0, 0x38b7: 0x00c0, 0x38b8: 0x00c3, 0x38b9: 0x00c3, 0x38ba: 0x00c3, 0x38bb: 0x00c3, - 0x38bc: 0x00c3, 0x38bd: 0x00c3, 0x38be: 0x00c3, 0x38bf: 0x00c3, - // Block 0xe3, offset 0x38c0 - 0x38c0: 0x00c3, 0x38c1: 0x00c3, 0x38c2: 0x00c3, 0x38c3: 0x00c3, 0x38c4: 0x00c3, 0x38c5: 0x00c3, - 0x38c6: 0x00c6, 0x38c7: 0x0080, 0x38c8: 0x0080, 0x38c9: 0x0080, 0x38ca: 0x0080, 0x38cb: 0x0080, - 0x38cc: 0x0080, 0x38cd: 0x0080, - 0x38d2: 0x0080, 0x38d3: 0x0080, 0x38d4: 0x0080, 0x38d5: 0x0080, 0x38d6: 0x0080, 0x38d7: 0x0080, - 0x38d8: 0x0080, 0x38d9: 0x0080, 0x38da: 0x0080, 0x38db: 0x0080, 0x38dc: 0x0080, 0x38dd: 0x0080, - 0x38de: 0x0080, 0x38df: 0x0080, 0x38e0: 0x0080, 0x38e1: 0x0080, 0x38e2: 0x0080, 0x38e3: 0x0080, - 0x38e4: 0x0080, 0x38e5: 0x0080, 0x38e6: 0x00c0, 0x38e7: 0x00c0, 0x38e8: 0x00c0, 0x38e9: 0x00c0, - 0x38ea: 0x00c0, 0x38eb: 0x00c0, 0x38ec: 0x00c0, 0x38ed: 0x00c0, 0x38ee: 0x00c0, 0x38ef: 0x00c0, - 0x38ff: 0x00c6, - // Block 0xe4, offset 0x3900 - 0x3900: 0x00c3, 0x3901: 0x00c3, 0x3902: 0x00c0, 0x3903: 0x00c0, 0x3904: 0x00c0, 0x3905: 0x00c0, - 0x3906: 0x00c0, 0x3907: 0x00c0, 0x3908: 0x00c0, 0x3909: 0x00c0, 0x390a: 0x00c0, 0x390b: 0x00c0, - 0x390c: 0x00c0, 0x390d: 0x00c0, 0x390e: 0x00c0, 0x390f: 0x00c0, 0x3910: 0x00c0, 0x3911: 0x00c0, - 0x3912: 0x00c0, 0x3913: 0x00c0, 0x3914: 0x00c0, 0x3915: 0x00c0, 0x3916: 0x00c0, 0x3917: 0x00c0, - 0x3918: 0x00c0, 0x3919: 0x00c0, 0x391a: 0x00c0, 0x391b: 0x00c0, 0x391c: 0x00c0, 0x391d: 0x00c0, - 0x391e: 0x00c0, 0x391f: 0x00c0, 0x3920: 0x00c0, 0x3921: 0x00c0, 0x3922: 0x00c0, 0x3923: 0x00c0, - 0x3924: 0x00c0, 0x3925: 0x00c0, 0x3926: 0x00c0, 0x3927: 0x00c0, 0x3928: 0x00c0, 0x3929: 0x00c0, - 0x392a: 0x00c0, 0x392b: 0x00c0, 0x392c: 0x00c0, 0x392d: 0x00c0, 0x392e: 0x00c0, 0x392f: 0x00c0, - 0x3930: 0x00c0, 0x3931: 0x00c0, 0x3932: 0x00c0, 0x3933: 0x00c3, 0x3934: 0x00c3, 0x3935: 0x00c3, - 0x3936: 0x00c3, 0x3937: 0x00c0, 0x3938: 0x00c0, 0x3939: 0x00c6, 0x393a: 0x00c3, 0x393b: 0x0080, - 0x393c: 0x0080, 0x393d: 0x0040, 0x393e: 0x0080, 0x393f: 0x0080, - // Block 0xe5, offset 0x3940 - 0x3940: 0x0080, 0x3941: 0x0080, - 0x3950: 0x00c0, 0x3951: 0x00c0, - 0x3952: 0x00c0, 0x3953: 0x00c0, 0x3954: 0x00c0, 0x3955: 0x00c0, 0x3956: 0x00c0, 0x3957: 0x00c0, - 0x3958: 0x00c0, 0x3959: 0x00c0, 0x395a: 0x00c0, 0x395b: 0x00c0, 0x395c: 0x00c0, 0x395d: 0x00c0, - 0x395e: 0x00c0, 0x395f: 0x00c0, 0x3960: 0x00c0, 0x3961: 0x00c0, 0x3962: 0x00c0, 0x3963: 0x00c0, - 0x3964: 0x00c0, 0x3965: 0x00c0, 0x3966: 0x00c0, 0x3967: 0x00c0, 0x3968: 0x00c0, - 0x3970: 0x00c0, 0x3971: 0x00c0, 0x3972: 0x00c0, 0x3973: 0x00c0, 0x3974: 0x00c0, 0x3975: 0x00c0, - 0x3976: 0x00c0, 0x3977: 0x00c0, 0x3978: 0x00c0, 0x3979: 0x00c0, - // Block 0xe6, offset 0x3980 - 0x3980: 0x00c3, 0x3981: 0x00c3, 0x3982: 0x00c3, 0x3983: 0x00c0, 0x3984: 0x00c0, 0x3985: 0x00c0, - 0x3986: 0x00c0, 0x3987: 0x00c0, 0x3988: 0x00c0, 0x3989: 0x00c0, 0x398a: 0x00c0, 0x398b: 0x00c0, - 0x398c: 0x00c0, 0x398d: 0x00c0, 0x398e: 0x00c0, 0x398f: 0x00c0, 0x3990: 0x00c0, 0x3991: 0x00c0, - 0x3992: 0x00c0, 0x3993: 0x00c0, 0x3994: 0x00c0, 0x3995: 0x00c0, 0x3996: 0x00c0, 0x3997: 0x00c0, - 0x3998: 0x00c0, 0x3999: 0x00c0, 0x399a: 0x00c0, 0x399b: 0x00c0, 0x399c: 0x00c0, 0x399d: 0x00c0, - 0x399e: 0x00c0, 0x399f: 0x00c0, 0x39a0: 0x00c0, 0x39a1: 0x00c0, 0x39a2: 0x00c0, 0x39a3: 0x00c0, - 0x39a4: 0x00c0, 0x39a5: 0x00c0, 0x39a6: 0x00c0, 0x39a7: 0x00c3, 0x39a8: 0x00c3, 0x39a9: 0x00c3, - 0x39aa: 0x00c3, 0x39ab: 0x00c3, 0x39ac: 0x00c0, 0x39ad: 0x00c3, 0x39ae: 0x00c3, 0x39af: 0x00c3, - 0x39b0: 0x00c3, 0x39b1: 0x00c3, 0x39b2: 0x00c3, 0x39b3: 0x00c6, 0x39b4: 0x00c6, - 0x39b6: 0x00c0, 0x39b7: 0x00c0, 0x39b8: 0x00c0, 0x39b9: 0x00c0, 0x39ba: 0x00c0, 0x39bb: 0x00c0, - 0x39bc: 0x00c0, 0x39bd: 0x00c0, 0x39be: 0x00c0, 0x39bf: 0x00c0, - // Block 0xe7, offset 0x39c0 - 0x39c0: 0x0080, 0x39c1: 0x0080, 0x39c2: 0x0080, 0x39c3: 0x0080, - 0x39d0: 0x00c0, 0x39d1: 0x00c0, - 0x39d2: 0x00c0, 0x39d3: 0x00c0, 0x39d4: 0x00c0, 0x39d5: 0x00c0, 0x39d6: 0x00c0, 0x39d7: 0x00c0, - 0x39d8: 0x00c0, 0x39d9: 0x00c0, 0x39da: 0x00c0, 0x39db: 0x00c0, 0x39dc: 0x00c0, 0x39dd: 0x00c0, - 0x39de: 0x00c0, 0x39df: 0x00c0, 0x39e0: 0x00c0, 0x39e1: 0x00c0, 0x39e2: 0x00c0, 0x39e3: 0x00c0, - 0x39e4: 0x00c0, 0x39e5: 0x00c0, 0x39e6: 0x00c0, 0x39e7: 0x00c0, 0x39e8: 0x00c0, 0x39e9: 0x00c0, - 0x39ea: 0x00c0, 0x39eb: 0x00c0, 0x39ec: 0x00c0, 0x39ed: 0x00c0, 0x39ee: 0x00c0, 0x39ef: 0x00c0, - 0x39f0: 0x00c0, 0x39f1: 0x00c0, 0x39f2: 0x00c0, 0x39f3: 0x00c3, 0x39f4: 0x0080, 0x39f5: 0x0080, - 0x39f6: 0x00c0, - // Block 0xe8, offset 0x3a00 - 0x3a00: 0x00c3, 0x3a01: 0x00c3, 0x3a02: 0x00c0, 0x3a03: 0x00c0, 0x3a04: 0x00c0, 0x3a05: 0x00c0, - 0x3a06: 0x00c0, 0x3a07: 0x00c0, 0x3a08: 0x00c0, 0x3a09: 0x00c0, 0x3a0a: 0x00c0, 0x3a0b: 0x00c0, - 0x3a0c: 0x00c0, 0x3a0d: 0x00c0, 0x3a0e: 0x00c0, 0x3a0f: 0x00c0, 0x3a10: 0x00c0, 0x3a11: 0x00c0, - 0x3a12: 0x00c0, 0x3a13: 0x00c0, 0x3a14: 0x00c0, 0x3a15: 0x00c0, 0x3a16: 0x00c0, 0x3a17: 0x00c0, - 0x3a18: 0x00c0, 0x3a19: 0x00c0, 0x3a1a: 0x00c0, 0x3a1b: 0x00c0, 0x3a1c: 0x00c0, 0x3a1d: 0x00c0, - 0x3a1e: 0x00c0, 0x3a1f: 0x00c0, 0x3a20: 0x00c0, 0x3a21: 0x00c0, 0x3a22: 0x00c0, 0x3a23: 0x00c0, - 0x3a24: 0x00c0, 0x3a25: 0x00c0, 0x3a26: 0x00c0, 0x3a27: 0x00c0, 0x3a28: 0x00c0, 0x3a29: 0x00c0, - 0x3a2a: 0x00c0, 0x3a2b: 0x00c0, 0x3a2c: 0x00c0, 0x3a2d: 0x00c0, 0x3a2e: 0x00c0, 0x3a2f: 0x00c0, - 0x3a30: 0x00c0, 0x3a31: 0x00c0, 0x3a32: 0x00c0, 0x3a33: 0x00c0, 0x3a34: 0x00c0, 0x3a35: 0x00c0, - 0x3a36: 0x00c3, 0x3a37: 0x00c3, 0x3a38: 0x00c3, 0x3a39: 0x00c3, 0x3a3a: 0x00c3, 0x3a3b: 0x00c3, - 0x3a3c: 0x00c3, 0x3a3d: 0x00c3, 0x3a3e: 0x00c3, 0x3a3f: 0x00c0, - // Block 0xe9, offset 0x3a40 - 0x3a40: 0x00c5, 0x3a41: 0x00c0, 0x3a42: 0x00c0, 0x3a43: 0x00c0, 0x3a44: 0x00c0, 0x3a45: 0x0080, - 0x3a46: 0x0080, 0x3a47: 0x0080, 0x3a48: 0x0080, 0x3a49: 0x0080, 0x3a4a: 0x00c3, 0x3a4b: 0x00c3, - 0x3a4c: 0x00c3, 0x3a4d: 0x0080, 0x3a50: 0x00c0, 0x3a51: 0x00c0, - 0x3a52: 0x00c0, 0x3a53: 0x00c0, 0x3a54: 0x00c0, 0x3a55: 0x00c0, 0x3a56: 0x00c0, 0x3a57: 0x00c0, - 0x3a58: 0x00c0, 0x3a59: 0x00c0, 0x3a5a: 0x00c0, 0x3a5b: 0x0080, 0x3a5c: 0x00c0, 0x3a5d: 0x0080, - 0x3a5e: 0x0080, 0x3a5f: 0x0080, 0x3a61: 0x0080, 0x3a62: 0x0080, 0x3a63: 0x0080, - 0x3a64: 0x0080, 0x3a65: 0x0080, 0x3a66: 0x0080, 0x3a67: 0x0080, 0x3a68: 0x0080, 0x3a69: 0x0080, - 0x3a6a: 0x0080, 0x3a6b: 0x0080, 0x3a6c: 0x0080, 0x3a6d: 0x0080, 0x3a6e: 0x0080, 0x3a6f: 0x0080, - 0x3a70: 0x0080, 0x3a71: 0x0080, 0x3a72: 0x0080, 0x3a73: 0x0080, 0x3a74: 0x0080, - // Block 0xea, offset 0x3a80 - 0x3a80: 0x00c0, 0x3a81: 0x00c0, 0x3a82: 0x00c0, 0x3a83: 0x00c0, 0x3a84: 0x00c0, 0x3a85: 0x00c0, - 0x3a86: 0x00c0, 0x3a87: 0x00c0, 0x3a88: 0x00c0, 0x3a89: 0x00c0, 0x3a8a: 0x00c0, 0x3a8b: 0x00c0, - 0x3a8c: 0x00c0, 0x3a8d: 0x00c0, 0x3a8e: 0x00c0, 0x3a8f: 0x00c0, 0x3a90: 0x00c0, 0x3a91: 0x00c0, - 0x3a93: 0x00c0, 0x3a94: 0x00c0, 0x3a95: 0x00c0, 0x3a96: 0x00c0, 0x3a97: 0x00c0, - 0x3a98: 0x00c0, 0x3a99: 0x00c0, 0x3a9a: 0x00c0, 0x3a9b: 0x00c0, 0x3a9c: 0x00c0, 0x3a9d: 0x00c0, - 0x3a9e: 0x00c0, 0x3a9f: 0x00c0, 0x3aa0: 0x00c0, 0x3aa1: 0x00c0, 0x3aa2: 0x00c0, 0x3aa3: 0x00c0, - 0x3aa4: 0x00c0, 0x3aa5: 0x00c0, 0x3aa6: 0x00c0, 0x3aa7: 0x00c0, 0x3aa8: 0x00c0, 0x3aa9: 0x00c0, - 0x3aaa: 0x00c0, 0x3aab: 0x00c0, 0x3aac: 0x00c0, 0x3aad: 0x00c0, 0x3aae: 0x00c0, 0x3aaf: 0x00c3, - 0x3ab0: 0x00c3, 0x3ab1: 0x00c3, 0x3ab2: 0x00c0, 0x3ab3: 0x00c0, 0x3ab4: 0x00c3, 0x3ab5: 0x00c5, - 0x3ab6: 0x00c3, 0x3ab7: 0x00c3, 0x3ab8: 0x0080, 0x3ab9: 0x0080, 0x3aba: 0x0080, 0x3abb: 0x0080, - 0x3abc: 0x0080, 0x3abd: 0x0080, 0x3abe: 0x00c3, - // Block 0xeb, offset 0x3ac0 - 0x3ac0: 0x00c0, 0x3ac1: 0x00c0, 0x3ac2: 0x00c0, 0x3ac3: 0x00c0, 0x3ac4: 0x00c0, 0x3ac5: 0x00c0, - 0x3ac6: 0x00c0, 0x3ac8: 0x00c0, 0x3aca: 0x00c0, 0x3acb: 0x00c0, - 0x3acc: 0x00c0, 0x3acd: 0x00c0, 0x3acf: 0x00c0, 0x3ad0: 0x00c0, 0x3ad1: 0x00c0, - 0x3ad2: 0x00c0, 0x3ad3: 0x00c0, 0x3ad4: 0x00c0, 0x3ad5: 0x00c0, 0x3ad6: 0x00c0, 0x3ad7: 0x00c0, - 0x3ad8: 0x00c0, 0x3ad9: 0x00c0, 0x3ada: 0x00c0, 0x3adb: 0x00c0, 0x3adc: 0x00c0, 0x3add: 0x00c0, - 0x3adf: 0x00c0, 0x3ae0: 0x00c0, 0x3ae1: 0x00c0, 0x3ae2: 0x00c0, 0x3ae3: 0x00c0, - 0x3ae4: 0x00c0, 0x3ae5: 0x00c0, 0x3ae6: 0x00c0, 0x3ae7: 0x00c0, 0x3ae8: 0x00c0, 0x3ae9: 0x0080, - 0x3af0: 0x00c0, 0x3af1: 0x00c0, 0x3af2: 0x00c0, 0x3af3: 0x00c0, 0x3af4: 0x00c0, 0x3af5: 0x00c0, - 0x3af6: 0x00c0, 0x3af7: 0x00c0, 0x3af8: 0x00c0, 0x3af9: 0x00c0, 0x3afa: 0x00c0, 0x3afb: 0x00c0, - 0x3afc: 0x00c0, 0x3afd: 0x00c0, 0x3afe: 0x00c0, 0x3aff: 0x00c0, - // Block 0xec, offset 0x3b00 - 0x3b00: 0x00c0, 0x3b01: 0x00c0, 0x3b02: 0x00c0, 0x3b03: 0x00c0, 0x3b04: 0x00c0, 0x3b05: 0x00c0, - 0x3b06: 0x00c0, 0x3b07: 0x00c0, 0x3b08: 0x00c0, 0x3b09: 0x00c0, 0x3b0a: 0x00c0, 0x3b0b: 0x00c0, - 0x3b0c: 0x00c0, 0x3b0d: 0x00c0, 0x3b0e: 0x00c0, 0x3b0f: 0x00c0, 0x3b10: 0x00c0, 0x3b11: 0x00c0, - 0x3b12: 0x00c0, 0x3b13: 0x00c0, 0x3b14: 0x00c0, 0x3b15: 0x00c0, 0x3b16: 0x00c0, 0x3b17: 0x00c0, - 0x3b18: 0x00c0, 0x3b19: 0x00c0, 0x3b1a: 0x00c0, 0x3b1b: 0x00c0, 0x3b1c: 0x00c0, 0x3b1d: 0x00c0, - 0x3b1e: 0x00c0, 0x3b1f: 0x00c3, 0x3b20: 0x00c0, 0x3b21: 0x00c0, 0x3b22: 0x00c0, 0x3b23: 0x00c3, - 0x3b24: 0x00c3, 0x3b25: 0x00c3, 0x3b26: 0x00c3, 0x3b27: 0x00c3, 0x3b28: 0x00c3, 0x3b29: 0x00c3, - 0x3b2a: 0x00c6, - 0x3b30: 0x00c0, 0x3b31: 0x00c0, 0x3b32: 0x00c0, 0x3b33: 0x00c0, 0x3b34: 0x00c0, 0x3b35: 0x00c0, - 0x3b36: 0x00c0, 0x3b37: 0x00c0, 0x3b38: 0x00c0, 0x3b39: 0x00c0, - // Block 0xed, offset 0x3b40 - 0x3b40: 0x00c3, 0x3b41: 0x00c3, 0x3b42: 0x00c0, 0x3b43: 0x00c0, 0x3b45: 0x00c0, - 0x3b46: 0x00c0, 0x3b47: 0x00c0, 0x3b48: 0x00c0, 0x3b49: 0x00c0, 0x3b4a: 0x00c0, 0x3b4b: 0x00c0, - 0x3b4c: 0x00c0, 0x3b4f: 0x00c0, 0x3b50: 0x00c0, - 0x3b53: 0x00c0, 0x3b54: 0x00c0, 0x3b55: 0x00c0, 0x3b56: 0x00c0, 0x3b57: 0x00c0, - 0x3b58: 0x00c0, 0x3b59: 0x00c0, 0x3b5a: 0x00c0, 0x3b5b: 0x00c0, 0x3b5c: 0x00c0, 0x3b5d: 0x00c0, - 0x3b5e: 0x00c0, 0x3b5f: 0x00c0, 0x3b60: 0x00c0, 0x3b61: 0x00c0, 0x3b62: 0x00c0, 0x3b63: 0x00c0, - 0x3b64: 0x00c0, 0x3b65: 0x00c0, 0x3b66: 0x00c0, 0x3b67: 0x00c0, 0x3b68: 0x00c0, - 0x3b6a: 0x00c0, 0x3b6b: 0x00c0, 0x3b6c: 0x00c0, 0x3b6d: 0x00c0, 0x3b6e: 0x00c0, 0x3b6f: 0x00c0, - 0x3b70: 0x00c0, 0x3b72: 0x00c0, 0x3b73: 0x00c0, 0x3b75: 0x00c0, - 0x3b76: 0x00c0, 0x3b77: 0x00c0, 0x3b78: 0x00c0, 0x3b79: 0x00c0, - 0x3b7c: 0x00c3, 0x3b7d: 0x00c0, 0x3b7e: 0x00c0, 0x3b7f: 0x00c0, - // Block 0xee, offset 0x3b80 - 0x3b80: 0x00c3, 0x3b81: 0x00c0, 0x3b82: 0x00c0, 0x3b83: 0x00c0, 0x3b84: 0x00c0, - 0x3b87: 0x00c0, 0x3b88: 0x00c0, 0x3b8b: 0x00c0, - 0x3b8c: 0x00c0, 0x3b8d: 0x00c5, 0x3b90: 0x00c0, - 0x3b97: 0x00c0, - 0x3b9d: 0x00c0, - 0x3b9e: 0x00c0, 0x3b9f: 0x00c0, 0x3ba0: 0x00c0, 0x3ba1: 0x00c0, 0x3ba2: 0x00c0, 0x3ba3: 0x00c0, - 0x3ba6: 0x00c3, 0x3ba7: 0x00c3, 0x3ba8: 0x00c3, 0x3ba9: 0x00c3, - 0x3baa: 0x00c3, 0x3bab: 0x00c3, 0x3bac: 0x00c3, - 0x3bb0: 0x00c3, 0x3bb1: 0x00c3, 0x3bb2: 0x00c3, 0x3bb3: 0x00c3, 0x3bb4: 0x00c3, - // Block 0xef, offset 0x3bc0 - 0x3bc0: 0x00c0, 0x3bc1: 0x00c0, 0x3bc2: 0x00c0, 0x3bc3: 0x00c0, 0x3bc4: 0x00c0, 0x3bc5: 0x00c0, - 0x3bc6: 0x00c0, 0x3bc7: 0x00c0, 0x3bc8: 0x00c0, 0x3bc9: 0x00c0, 0x3bca: 0x00c0, 0x3bcb: 0x00c0, - 0x3bcc: 0x00c0, 0x3bcd: 0x00c0, 0x3bce: 0x00c0, 0x3bcf: 0x00c0, 0x3bd0: 0x00c0, 0x3bd1: 0x00c0, - 0x3bd2: 0x00c0, 0x3bd3: 0x00c0, 0x3bd4: 0x00c0, 0x3bd5: 0x00c0, 0x3bd6: 0x00c0, 0x3bd7: 0x00c0, - 0x3bd8: 0x00c0, 0x3bd9: 0x00c0, 0x3bda: 0x00c0, 0x3bdb: 0x00c0, 0x3bdc: 0x00c0, 0x3bdd: 0x00c0, - 0x3bde: 0x00c0, 0x3bdf: 0x00c0, 0x3be0: 0x00c0, 0x3be1: 0x00c0, 0x3be2: 0x00c0, 0x3be3: 0x00c0, - 0x3be4: 0x00c0, 0x3be5: 0x00c0, 0x3be6: 0x00c0, 0x3be7: 0x00c0, 0x3be8: 0x00c0, 0x3be9: 0x00c0, - 0x3bea: 0x00c0, 0x3beb: 0x00c0, 0x3bec: 0x00c0, 0x3bed: 0x00c0, 0x3bee: 0x00c0, 0x3bef: 0x00c0, - 0x3bf0: 0x00c0, 0x3bf1: 0x00c0, 0x3bf2: 0x00c0, 0x3bf3: 0x00c0, 0x3bf4: 0x00c0, 0x3bf5: 0x00c0, - 0x3bf6: 0x00c0, 0x3bf7: 0x00c0, 0x3bf8: 0x00c3, 0x3bf9: 0x00c3, 0x3bfa: 0x00c3, 0x3bfb: 0x00c3, - 0x3bfc: 0x00c3, 0x3bfd: 0x00c3, 0x3bfe: 0x00c3, 0x3bff: 0x00c3, - // Block 0xf0, offset 0x3c00 - 0x3c00: 0x00c0, 0x3c01: 0x00c0, 0x3c02: 0x00c6, 0x3c03: 0x00c3, 0x3c04: 0x00c3, 0x3c05: 0x00c0, - 0x3c06: 0x00c3, 0x3c07: 0x00c0, 0x3c08: 0x00c0, 0x3c09: 0x00c0, 0x3c0a: 0x00c0, 0x3c0b: 0x0080, - 0x3c0c: 0x0080, 0x3c0d: 0x0080, 0x3c0e: 0x0080, 0x3c0f: 0x0080, 0x3c10: 0x00c0, 0x3c11: 0x00c0, - 0x3c12: 0x00c0, 0x3c13: 0x00c0, 0x3c14: 0x00c0, 0x3c15: 0x00c0, 0x3c16: 0x00c0, 0x3c17: 0x00c0, - 0x3c18: 0x00c0, 0x3c19: 0x00c0, 0x3c1b: 0x0080, 0x3c1d: 0x0080, - // Block 0xf1, offset 0x3c40 - 0x3c40: 0x00c0, 0x3c41: 0x00c0, 0x3c42: 0x00c0, 0x3c43: 0x00c0, 0x3c44: 0x00c0, 0x3c45: 0x00c0, - 0x3c46: 0x00c0, 0x3c47: 0x00c0, 0x3c48: 0x00c0, 0x3c49: 0x00c0, 0x3c4a: 0x00c0, 0x3c4b: 0x00c0, - 0x3c4c: 0x00c0, 0x3c4d: 0x00c0, 0x3c4e: 0x00c0, 0x3c4f: 0x00c0, 0x3c50: 0x00c0, 0x3c51: 0x00c0, - 0x3c52: 0x00c0, 0x3c53: 0x00c0, 0x3c54: 0x00c0, 0x3c55: 0x00c0, 0x3c56: 0x00c0, 0x3c57: 0x00c0, - 0x3c58: 0x00c0, 0x3c59: 0x00c0, 0x3c5a: 0x00c0, 0x3c5b: 0x00c0, 0x3c5c: 0x00c0, 0x3c5d: 0x00c0, - 0x3c5e: 0x00c0, 0x3c5f: 0x00c0, 0x3c60: 0x00c0, 0x3c61: 0x00c0, 0x3c62: 0x00c0, 0x3c63: 0x00c0, - 0x3c64: 0x00c0, 0x3c65: 0x00c0, 0x3c66: 0x00c0, 0x3c67: 0x00c0, 0x3c68: 0x00c0, 0x3c69: 0x00c0, - 0x3c6a: 0x00c0, 0x3c6b: 0x00c0, 0x3c6c: 0x00c0, 0x3c6d: 0x00c0, 0x3c6e: 0x00c0, 0x3c6f: 0x00c0, - 0x3c70: 0x00c0, 0x3c71: 0x00c0, 0x3c72: 0x00c0, 0x3c73: 0x00c3, 0x3c74: 0x00c3, 0x3c75: 0x00c3, - 0x3c76: 0x00c3, 0x3c77: 0x00c3, 0x3c78: 0x00c3, 0x3c79: 0x00c0, 0x3c7a: 0x00c3, 0x3c7b: 0x00c0, - 0x3c7c: 0x00c0, 0x3c7d: 0x00c0, 0x3c7e: 0x00c0, 0x3c7f: 0x00c3, - // Block 0xf2, offset 0x3c80 - 0x3c80: 0x00c3, 0x3c81: 0x00c0, 0x3c82: 0x00c6, 0x3c83: 0x00c3, 0x3c84: 0x00c0, 0x3c85: 0x00c0, - 0x3c86: 0x0080, 0x3c87: 0x00c0, - 0x3c90: 0x00c0, 0x3c91: 0x00c0, - 0x3c92: 0x00c0, 0x3c93: 0x00c0, 0x3c94: 0x00c0, 0x3c95: 0x00c0, 0x3c96: 0x00c0, 0x3c97: 0x00c0, - 0x3c98: 0x00c0, 0x3c99: 0x00c0, - // Block 0xf3, offset 0x3cc0 - 0x3cc0: 0x00c0, 0x3cc1: 0x00c0, 0x3cc2: 0x00c0, 0x3cc3: 0x00c0, 0x3cc4: 0x00c0, 0x3cc5: 0x00c0, - 0x3cc6: 0x00c0, 0x3cc7: 0x00c0, 0x3cc8: 0x00c0, 0x3cc9: 0x00c0, 0x3cca: 0x00c0, 0x3ccb: 0x00c0, - 0x3ccc: 0x00c0, 0x3ccd: 0x00c0, 0x3cce: 0x00c0, 0x3ccf: 0x00c0, 0x3cd0: 0x00c0, 0x3cd1: 0x00c0, - 0x3cd2: 0x00c0, 0x3cd3: 0x00c0, 0x3cd4: 0x00c0, 0x3cd5: 0x00c0, 0x3cd6: 0x00c0, 0x3cd7: 0x00c0, - 0x3cd8: 0x00c0, 0x3cd9: 0x00c0, 0x3cda: 0x00c0, 0x3cdb: 0x00c0, 0x3cdc: 0x00c0, 0x3cdd: 0x00c0, - 0x3cde: 0x00c0, 0x3cdf: 0x00c0, 0x3ce0: 0x00c0, 0x3ce1: 0x00c0, 0x3ce2: 0x00c0, 0x3ce3: 0x00c0, - 0x3ce4: 0x00c0, 0x3ce5: 0x00c0, 0x3ce6: 0x00c0, 0x3ce7: 0x00c0, 0x3ce8: 0x00c0, 0x3ce9: 0x00c0, - 0x3cea: 0x00c0, 0x3ceb: 0x00c0, 0x3cec: 0x00c0, 0x3ced: 0x00c0, 0x3cee: 0x00c0, 0x3cef: 0x00c0, - 0x3cf0: 0x00c0, 0x3cf1: 0x00c0, 0x3cf2: 0x00c3, 0x3cf3: 0x00c3, 0x3cf4: 0x00c3, 0x3cf5: 0x00c3, - 0x3cf8: 0x00c0, 0x3cf9: 0x00c0, 0x3cfa: 0x00c0, 0x3cfb: 0x00c0, - 0x3cfc: 0x00c3, 0x3cfd: 0x00c3, 0x3cfe: 0x00c0, 0x3cff: 0x00c6, - // Block 0xf4, offset 0x3d00 - 0x3d00: 0x00c3, 0x3d01: 0x0080, 0x3d02: 0x0080, 0x3d03: 0x0080, 0x3d04: 0x0080, 0x3d05: 0x0080, - 0x3d06: 0x0080, 0x3d07: 0x0080, 0x3d08: 0x0080, 0x3d09: 0x0080, 0x3d0a: 0x0080, 0x3d0b: 0x0080, - 0x3d0c: 0x0080, 0x3d0d: 0x0080, 0x3d0e: 0x0080, 0x3d0f: 0x0080, 0x3d10: 0x0080, 0x3d11: 0x0080, - 0x3d12: 0x0080, 0x3d13: 0x0080, 0x3d14: 0x0080, 0x3d15: 0x0080, 0x3d16: 0x0080, 0x3d17: 0x0080, - 0x3d18: 0x00c0, 0x3d19: 0x00c0, 0x3d1a: 0x00c0, 0x3d1b: 0x00c0, 0x3d1c: 0x00c3, 0x3d1d: 0x00c3, - // Block 0xf5, offset 0x3d40 - 0x3d40: 0x00c0, 0x3d41: 0x00c0, 0x3d42: 0x00c0, 0x3d43: 0x00c0, 0x3d44: 0x00c0, 0x3d45: 0x00c0, - 0x3d46: 0x00c0, 0x3d47: 0x00c0, 0x3d48: 0x00c0, 0x3d49: 0x00c0, 0x3d4a: 0x00c0, 0x3d4b: 0x00c0, - 0x3d4c: 0x00c0, 0x3d4d: 0x00c0, 0x3d4e: 0x00c0, 0x3d4f: 0x00c0, 0x3d50: 0x00c0, 0x3d51: 0x00c0, - 0x3d52: 0x00c0, 0x3d53: 0x00c0, 0x3d54: 0x00c0, 0x3d55: 0x00c0, 0x3d56: 0x00c0, 0x3d57: 0x00c0, - 0x3d58: 0x00c0, 0x3d59: 0x00c0, 0x3d5a: 0x00c0, 0x3d5b: 0x00c0, 0x3d5c: 0x00c0, 0x3d5d: 0x00c0, - 0x3d5e: 0x00c0, 0x3d5f: 0x00c0, 0x3d60: 0x00c0, 0x3d61: 0x00c0, 0x3d62: 0x00c0, 0x3d63: 0x00c0, - 0x3d64: 0x00c0, 0x3d65: 0x00c0, 0x3d66: 0x00c0, 0x3d67: 0x00c0, 0x3d68: 0x00c0, 0x3d69: 0x00c0, - 0x3d6a: 0x00c0, 0x3d6b: 0x00c0, 0x3d6c: 0x00c0, 0x3d6d: 0x00c0, 0x3d6e: 0x00c0, 0x3d6f: 0x00c0, - 0x3d70: 0x00c0, 0x3d71: 0x00c0, 0x3d72: 0x00c0, 0x3d73: 0x00c3, 0x3d74: 0x00c3, 0x3d75: 0x00c3, - 0x3d76: 0x00c3, 0x3d77: 0x00c3, 0x3d78: 0x00c3, 0x3d79: 0x00c3, 0x3d7a: 0x00c3, 0x3d7b: 0x00c0, - 0x3d7c: 0x00c0, 0x3d7d: 0x00c3, 0x3d7e: 0x00c0, 0x3d7f: 0x00c6, - // Block 0xf6, offset 0x3d80 - 0x3d80: 0x00c3, 0x3d81: 0x0080, 0x3d82: 0x0080, 0x3d83: 0x0080, 0x3d84: 0x00c0, - 0x3d90: 0x00c0, 0x3d91: 0x00c0, - 0x3d92: 0x00c0, 0x3d93: 0x00c0, 0x3d94: 0x00c0, 0x3d95: 0x00c0, 0x3d96: 0x00c0, 0x3d97: 0x00c0, - 0x3d98: 0x00c0, 0x3d99: 0x00c0, - 0x3da0: 0x0080, 0x3da1: 0x0080, 0x3da2: 0x0080, 0x3da3: 0x0080, - 0x3da4: 0x0080, 0x3da5: 0x0080, 0x3da6: 0x0080, 0x3da7: 0x0080, 0x3da8: 0x0080, 0x3da9: 0x0080, - 0x3daa: 0x0080, 0x3dab: 0x0080, 0x3dac: 0x0080, - // Block 0xf7, offset 0x3dc0 - 0x3dc0: 0x00c0, 0x3dc1: 0x00c0, 0x3dc2: 0x00c0, 0x3dc3: 0x00c0, 0x3dc4: 0x00c0, 0x3dc5: 0x00c0, - 0x3dc6: 0x00c0, 0x3dc7: 0x00c0, 0x3dc8: 0x00c0, 0x3dc9: 0x00c0, 0x3dca: 0x00c0, 0x3dcb: 0x00c0, - 0x3dcc: 0x00c0, 0x3dcd: 0x00c0, 0x3dce: 0x00c0, 0x3dcf: 0x00c0, 0x3dd0: 0x00c0, 0x3dd1: 0x00c0, - 0x3dd2: 0x00c0, 0x3dd3: 0x00c0, 0x3dd4: 0x00c0, 0x3dd5: 0x00c0, 0x3dd6: 0x00c0, 0x3dd7: 0x00c0, - 0x3dd8: 0x00c0, 0x3dd9: 0x00c0, 0x3dda: 0x00c0, 0x3ddb: 0x00c0, 0x3ddc: 0x00c0, 0x3ddd: 0x00c0, - 0x3dde: 0x00c0, 0x3ddf: 0x00c0, 0x3de0: 0x00c0, 0x3de1: 0x00c0, 0x3de2: 0x00c0, 0x3de3: 0x00c0, - 0x3de4: 0x00c0, 0x3de5: 0x00c0, 0x3de6: 0x00c0, 0x3de7: 0x00c0, 0x3de8: 0x00c0, 0x3de9: 0x00c0, - 0x3dea: 0x00c0, 0x3deb: 0x00c3, 0x3dec: 0x00c0, 0x3ded: 0x00c3, 0x3dee: 0x00c0, 0x3def: 0x00c0, - 0x3df0: 0x00c3, 0x3df1: 0x00c3, 0x3df2: 0x00c3, 0x3df3: 0x00c3, 0x3df4: 0x00c3, 0x3df5: 0x00c3, - 0x3df6: 0x00c5, 0x3df7: 0x00c3, - // Block 0xf8, offset 0x3e00 - 0x3e00: 0x00c0, 0x3e01: 0x00c0, 0x3e02: 0x00c0, 0x3e03: 0x00c0, 0x3e04: 0x00c0, 0x3e05: 0x00c0, - 0x3e06: 0x00c0, 0x3e07: 0x00c0, 0x3e08: 0x00c0, 0x3e09: 0x00c0, - // Block 0xf9, offset 0x3e40 - 0x3e40: 0x00c0, 0x3e41: 0x00c0, 0x3e42: 0x00c0, 0x3e43: 0x00c0, 0x3e44: 0x00c0, 0x3e45: 0x00c0, - 0x3e46: 0x00c0, 0x3e47: 0x00c0, 0x3e48: 0x00c0, 0x3e49: 0x00c0, 0x3e4a: 0x00c0, 0x3e4b: 0x00c0, - 0x3e4c: 0x00c0, 0x3e4d: 0x00c0, 0x3e4e: 0x00c0, 0x3e4f: 0x00c0, 0x3e50: 0x00c0, 0x3e51: 0x00c0, - 0x3e52: 0x00c0, 0x3e53: 0x00c0, 0x3e54: 0x00c0, 0x3e55: 0x00c0, 0x3e56: 0x00c0, 0x3e57: 0x00c0, - 0x3e58: 0x00c0, 0x3e59: 0x00c0, 0x3e5d: 0x00c3, - 0x3e5e: 0x00c3, 0x3e5f: 0x00c3, 0x3e60: 0x00c0, 0x3e61: 0x00c0, 0x3e62: 0x00c3, 0x3e63: 0x00c3, - 0x3e64: 0x00c3, 0x3e65: 0x00c3, 0x3e66: 0x00c0, 0x3e67: 0x00c3, 0x3e68: 0x00c3, 0x3e69: 0x00c3, - 0x3e6a: 0x00c3, 0x3e6b: 0x00c6, - 0x3e70: 0x00c0, 0x3e71: 0x00c0, 0x3e72: 0x00c0, 0x3e73: 0x00c0, 0x3e74: 0x00c0, 0x3e75: 0x00c0, - 0x3e76: 0x00c0, 0x3e77: 0x00c0, 0x3e78: 0x00c0, 0x3e79: 0x00c0, 0x3e7a: 0x0080, 0x3e7b: 0x0080, - 0x3e7c: 0x0080, 0x3e7d: 0x0080, 0x3e7e: 0x0080, 0x3e7f: 0x0080, - // Block 0xfa, offset 0x3e80 - 0x3ea0: 0x00c0, 0x3ea1: 0x00c0, 0x3ea2: 0x00c0, 0x3ea3: 0x00c0, - 0x3ea4: 0x00c0, 0x3ea5: 0x00c0, 0x3ea6: 0x00c0, 0x3ea7: 0x00c0, 0x3ea8: 0x00c0, 0x3ea9: 0x00c0, - 0x3eaa: 0x00c0, 0x3eab: 0x00c0, 0x3eac: 0x00c0, 0x3ead: 0x00c0, 0x3eae: 0x00c0, 0x3eaf: 0x00c0, - 0x3eb0: 0x00c0, 0x3eb1: 0x00c0, 0x3eb2: 0x00c0, 0x3eb3: 0x00c0, 0x3eb4: 0x00c0, 0x3eb5: 0x00c0, - 0x3eb6: 0x00c0, 0x3eb7: 0x00c0, 0x3eb8: 0x00c0, 0x3eb9: 0x00c0, 0x3eba: 0x00c0, 0x3ebb: 0x00c0, - 0x3ebc: 0x00c0, 0x3ebd: 0x00c0, 0x3ebe: 0x00c0, 0x3ebf: 0x00c0, - // Block 0xfb, offset 0x3ec0 - 0x3ec0: 0x00c0, 0x3ec1: 0x00c0, 0x3ec2: 0x00c0, 0x3ec3: 0x00c0, 0x3ec4: 0x00c0, 0x3ec5: 0x00c0, - 0x3ec6: 0x00c0, 0x3ec7: 0x00c0, 0x3ec8: 0x00c0, 0x3ec9: 0x00c0, 0x3eca: 0x00c0, 0x3ecb: 0x00c0, - 0x3ecc: 0x00c0, 0x3ecd: 0x00c0, 0x3ece: 0x00c0, 0x3ecf: 0x00c0, 0x3ed0: 0x00c0, 0x3ed1: 0x00c0, - 0x3ed2: 0x00c0, 0x3ed3: 0x00c0, 0x3ed4: 0x00c0, 0x3ed5: 0x00c0, 0x3ed6: 0x00c0, 0x3ed7: 0x00c0, - 0x3ed8: 0x00c0, 0x3ed9: 0x00c0, 0x3eda: 0x00c0, 0x3edb: 0x00c0, 0x3edc: 0x00c0, 0x3edd: 0x00c0, - 0x3ede: 0x00c0, 0x3edf: 0x00c0, 0x3ee0: 0x00c0, 0x3ee1: 0x00c0, 0x3ee2: 0x00c0, 0x3ee3: 0x00c0, - 0x3ee4: 0x00c0, 0x3ee5: 0x00c0, 0x3ee6: 0x00c0, 0x3ee7: 0x00c0, 0x3ee8: 0x00c0, 0x3ee9: 0x00c0, - 0x3eea: 0x0080, 0x3eeb: 0x0080, 0x3eec: 0x0080, 0x3eed: 0x0080, 0x3eee: 0x0080, 0x3eef: 0x0080, - 0x3ef0: 0x0080, 0x3ef1: 0x0080, 0x3ef2: 0x0080, - 0x3eff: 0x00c0, - // Block 0xfc, offset 0x3f00 - 0x3f00: 0x00c0, 0x3f01: 0x00c0, 0x3f02: 0x00c0, 0x3f03: 0x00c0, 0x3f04: 0x00c0, 0x3f05: 0x00c0, - 0x3f06: 0x00c0, 0x3f07: 0x00c0, 0x3f08: 0x00c0, 0x3f09: 0x00c0, 0x3f0a: 0x00c0, 0x3f0b: 0x00c0, - 0x3f0c: 0x00c0, 0x3f0d: 0x00c0, 0x3f0e: 0x00c0, 0x3f0f: 0x00c0, 0x3f10: 0x00c0, 0x3f11: 0x00c0, - 0x3f12: 0x00c0, 0x3f13: 0x00c0, 0x3f14: 0x00c0, 0x3f15: 0x00c0, 0x3f16: 0x00c0, 0x3f17: 0x00c0, - 0x3f18: 0x00c0, 0x3f19: 0x00c0, 0x3f1a: 0x00c0, 0x3f1b: 0x00c0, 0x3f1c: 0x00c0, 0x3f1d: 0x00c0, - 0x3f1e: 0x00c0, 0x3f1f: 0x00c0, 0x3f20: 0x00c0, 0x3f21: 0x00c0, 0x3f22: 0x00c0, 0x3f23: 0x00c0, - 0x3f24: 0x00c0, 0x3f25: 0x00c0, 0x3f26: 0x00c0, 0x3f27: 0x00c0, 0x3f28: 0x00c0, 0x3f29: 0x00c0, - 0x3f2a: 0x00c0, 0x3f2b: 0x00c0, 0x3f2c: 0x00c0, 0x3f2d: 0x00c0, 0x3f2e: 0x00c0, 0x3f2f: 0x00c0, - 0x3f30: 0x00c0, 0x3f31: 0x00c0, 0x3f32: 0x00c0, 0x3f33: 0x00c0, 0x3f34: 0x00c0, 0x3f35: 0x00c0, - 0x3f36: 0x00c0, 0x3f37: 0x00c0, 0x3f38: 0x00c0, - // Block 0xfd, offset 0x3f40 - 0x3f40: 0x00c0, 0x3f41: 0x00c0, 0x3f42: 0x00c0, 0x3f43: 0x00c0, 0x3f44: 0x00c0, 0x3f45: 0x00c0, - 0x3f46: 0x00c0, 0x3f47: 0x00c0, 0x3f48: 0x00c0, 0x3f4a: 0x00c0, 0x3f4b: 0x00c0, - 0x3f4c: 0x00c0, 0x3f4d: 0x00c0, 0x3f4e: 0x00c0, 0x3f4f: 0x00c0, 0x3f50: 0x00c0, 0x3f51: 0x00c0, - 0x3f52: 0x00c0, 0x3f53: 0x00c0, 0x3f54: 0x00c0, 0x3f55: 0x00c0, 0x3f56: 0x00c0, 0x3f57: 0x00c0, - 0x3f58: 0x00c0, 0x3f59: 0x00c0, 0x3f5a: 0x00c0, 0x3f5b: 0x00c0, 0x3f5c: 0x00c0, 0x3f5d: 0x00c0, - 0x3f5e: 0x00c0, 0x3f5f: 0x00c0, 0x3f60: 0x00c0, 0x3f61: 0x00c0, 0x3f62: 0x00c0, 0x3f63: 0x00c0, - 0x3f64: 0x00c0, 0x3f65: 0x00c0, 0x3f66: 0x00c0, 0x3f67: 0x00c0, 0x3f68: 0x00c0, 0x3f69: 0x00c0, - 0x3f6a: 0x00c0, 0x3f6b: 0x00c0, 0x3f6c: 0x00c0, 0x3f6d: 0x00c0, 0x3f6e: 0x00c0, 0x3f6f: 0x00c0, - 0x3f70: 0x00c3, 0x3f71: 0x00c3, 0x3f72: 0x00c3, 0x3f73: 0x00c3, 0x3f74: 0x00c3, 0x3f75: 0x00c3, - 0x3f76: 0x00c3, 0x3f78: 0x00c3, 0x3f79: 0x00c3, 0x3f7a: 0x00c3, 0x3f7b: 0x00c3, - 0x3f7c: 0x00c3, 0x3f7d: 0x00c3, 0x3f7e: 0x00c0, 0x3f7f: 0x00c6, - // Block 0xfe, offset 0x3f80 - 0x3f80: 0x00c0, 0x3f81: 0x0080, 0x3f82: 0x0080, 0x3f83: 0x0080, 0x3f84: 0x0080, 0x3f85: 0x0080, - 0x3f90: 0x00c0, 0x3f91: 0x00c0, - 0x3f92: 0x00c0, 0x3f93: 0x00c0, 0x3f94: 0x00c0, 0x3f95: 0x00c0, 0x3f96: 0x00c0, 0x3f97: 0x00c0, - 0x3f98: 0x00c0, 0x3f99: 0x00c0, 0x3f9a: 0x0080, 0x3f9b: 0x0080, 0x3f9c: 0x0080, 0x3f9d: 0x0080, - 0x3f9e: 0x0080, 0x3f9f: 0x0080, 0x3fa0: 0x0080, 0x3fa1: 0x0080, 0x3fa2: 0x0080, 0x3fa3: 0x0080, - 0x3fa4: 0x0080, 0x3fa5: 0x0080, 0x3fa6: 0x0080, 0x3fa7: 0x0080, 0x3fa8: 0x0080, 0x3fa9: 0x0080, - 0x3faa: 0x0080, 0x3fab: 0x0080, 0x3fac: 0x0080, - 0x3fb0: 0x0080, 0x3fb1: 0x0080, 0x3fb2: 0x00c0, 0x3fb3: 0x00c0, 0x3fb4: 0x00c0, 0x3fb5: 0x00c0, - 0x3fb6: 0x00c0, 0x3fb7: 0x00c0, 0x3fb8: 0x00c0, 0x3fb9: 0x00c0, 0x3fba: 0x00c0, 0x3fbb: 0x00c0, - 0x3fbc: 0x00c0, 0x3fbd: 0x00c0, 0x3fbe: 0x00c0, 0x3fbf: 0x00c0, - // Block 0xff, offset 0x3fc0 - 0x3fc0: 0x00c0, 0x3fc1: 0x00c0, 0x3fc2: 0x00c0, 0x3fc3: 0x00c0, 0x3fc4: 0x00c0, 0x3fc5: 0x00c0, - 0x3fc6: 0x00c0, 0x3fc7: 0x00c0, 0x3fc8: 0x00c0, 0x3fc9: 0x00c0, 0x3fca: 0x00c0, 0x3fcb: 0x00c0, - 0x3fcc: 0x00c0, 0x3fcd: 0x00c0, 0x3fce: 0x00c0, 0x3fcf: 0x00c0, - 0x3fd2: 0x00c3, 0x3fd3: 0x00c3, 0x3fd4: 0x00c3, 0x3fd5: 0x00c3, 0x3fd6: 0x00c3, 0x3fd7: 0x00c3, - 0x3fd8: 0x00c3, 0x3fd9: 0x00c3, 0x3fda: 0x00c3, 0x3fdb: 0x00c3, 0x3fdc: 0x00c3, 0x3fdd: 0x00c3, - 0x3fde: 0x00c3, 0x3fdf: 0x00c3, 0x3fe0: 0x00c3, 0x3fe1: 0x00c3, 0x3fe2: 0x00c3, 0x3fe3: 0x00c3, - 0x3fe4: 0x00c3, 0x3fe5: 0x00c3, 0x3fe6: 0x00c3, 0x3fe7: 0x00c3, 0x3fe9: 0x00c0, - 0x3fea: 0x00c3, 0x3feb: 0x00c3, 0x3fec: 0x00c3, 0x3fed: 0x00c3, 0x3fee: 0x00c3, 0x3fef: 0x00c3, - 0x3ff0: 0x00c3, 0x3ff1: 0x00c0, 0x3ff2: 0x00c3, 0x3ff3: 0x00c3, 0x3ff4: 0x00c0, 0x3ff5: 0x00c3, - 0x3ff6: 0x00c3, - // Block 0x100, offset 0x4000 - 0x4000: 0x00c0, 0x4001: 0x00c0, 0x4002: 0x00c0, 0x4003: 0x00c0, 0x4004: 0x00c0, 0x4005: 0x00c0, - 0x4006: 0x00c0, 0x4007: 0x00c0, 0x4008: 0x00c0, 0x4009: 0x00c0, 0x400a: 0x00c0, 0x400b: 0x00c0, - 0x400c: 0x00c0, 0x400d: 0x00c0, 0x400e: 0x00c0, 0x400f: 0x00c0, 0x4010: 0x00c0, 0x4011: 0x00c0, - 0x4012: 0x00c0, 0x4013: 0x00c0, 0x4014: 0x00c0, 0x4015: 0x00c0, 0x4016: 0x00c0, 0x4017: 0x00c0, - 0x4018: 0x00c0, 0x4019: 0x00c0, - // Block 0x101, offset 0x4040 - 0x4040: 0x0080, 0x4041: 0x0080, 0x4042: 0x0080, 0x4043: 0x0080, 0x4044: 0x0080, 0x4045: 0x0080, - 0x4046: 0x0080, 0x4047: 0x0080, 0x4048: 0x0080, 0x4049: 0x0080, 0x404a: 0x0080, 0x404b: 0x0080, - 0x404c: 0x0080, 0x404d: 0x0080, 0x404e: 0x0080, 0x404f: 0x0080, 0x4050: 0x0080, 0x4051: 0x0080, - 0x4052: 0x0080, 0x4053: 0x0080, 0x4054: 0x0080, 0x4055: 0x0080, 0x4056: 0x0080, 0x4057: 0x0080, - 0x4058: 0x0080, 0x4059: 0x0080, 0x405a: 0x0080, 0x405b: 0x0080, 0x405c: 0x0080, 0x405d: 0x0080, - 0x405e: 0x0080, 0x405f: 0x0080, 0x4060: 0x0080, 0x4061: 0x0080, 0x4062: 0x0080, 0x4063: 0x0080, - 0x4064: 0x0080, 0x4065: 0x0080, 0x4066: 0x0080, 0x4067: 0x0080, 0x4068: 0x0080, 0x4069: 0x0080, - 0x406a: 0x0080, 0x406b: 0x0080, 0x406c: 0x0080, 0x406d: 0x0080, 0x406e: 0x0080, - 0x4070: 0x0080, 0x4071: 0x0080, 0x4072: 0x0080, 0x4073: 0x0080, 0x4074: 0x0080, - // Block 0x102, offset 0x4080 - 0x4080: 0x00c0, 0x4081: 0x00c0, 0x4082: 0x00c0, 0x4083: 0x00c0, - // Block 0x103, offset 0x40c0 - 0x40c0: 0x00c0, 0x40c1: 0x00c0, 0x40c2: 0x00c0, 0x40c3: 0x00c0, 0x40c4: 0x00c0, 0x40c5: 0x00c0, - 0x40c6: 0x00c0, 0x40c7: 0x00c0, 0x40c8: 0x00c0, 0x40c9: 0x00c0, 0x40ca: 0x00c0, 0x40cb: 0x00c0, - 0x40cc: 0x00c0, 0x40cd: 0x00c0, 0x40ce: 0x00c0, 0x40cf: 0x00c0, 0x40d0: 0x00c0, 0x40d1: 0x00c0, - 0x40d2: 0x00c0, 0x40d3: 0x00c0, 0x40d4: 0x00c0, 0x40d5: 0x00c0, 0x40d6: 0x00c0, 0x40d7: 0x00c0, - 0x40d8: 0x00c0, 0x40d9: 0x00c0, 0x40da: 0x00c0, 0x40db: 0x00c0, 0x40dc: 0x00c0, 0x40dd: 0x00c0, - 0x40de: 0x00c0, 0x40df: 0x00c0, 0x40e0: 0x00c0, 0x40e1: 0x00c0, 0x40e2: 0x00c0, 0x40e3: 0x00c0, - 0x40e4: 0x00c0, 0x40e5: 0x00c0, 0x40e6: 0x00c0, 0x40e7: 0x00c0, 0x40e8: 0x00c0, 0x40e9: 0x00c0, - 0x40ea: 0x00c0, 0x40eb: 0x00c0, 0x40ec: 0x00c0, 0x40ed: 0x00c0, 0x40ee: 0x00c0, - // Block 0x104, offset 0x4100 - 0x4100: 0x00c0, 0x4101: 0x00c0, 0x4102: 0x00c0, 0x4103: 0x00c0, 0x4104: 0x00c0, 0x4105: 0x00c0, - 0x4106: 0x00c0, - // Block 0x105, offset 0x4140 - 0x4140: 0x00c0, 0x4141: 0x00c0, 0x4142: 0x00c0, 0x4143: 0x00c0, 0x4144: 0x00c0, 0x4145: 0x00c0, - 0x4146: 0x00c0, 0x4147: 0x00c0, 0x4148: 0x00c0, 0x4149: 0x00c0, 0x414a: 0x00c0, 0x414b: 0x00c0, - 0x414c: 0x00c0, 0x414d: 0x00c0, 0x414e: 0x00c0, 0x414f: 0x00c0, 0x4150: 0x00c0, 0x4151: 0x00c0, - 0x4152: 0x00c0, 0x4153: 0x00c0, 0x4154: 0x00c0, 0x4155: 0x00c0, 0x4156: 0x00c0, 0x4157: 0x00c0, - 0x4158: 0x00c0, 0x4159: 0x00c0, 0x415a: 0x00c0, 0x415b: 0x00c0, 0x415c: 0x00c0, 0x415d: 0x00c0, - 0x415e: 0x00c0, 0x4160: 0x00c0, 0x4161: 0x00c0, 0x4162: 0x00c0, 0x4163: 0x00c0, - 0x4164: 0x00c0, 0x4165: 0x00c0, 0x4166: 0x00c0, 0x4167: 0x00c0, 0x4168: 0x00c0, 0x4169: 0x00c0, - 0x416e: 0x0080, 0x416f: 0x0080, - // Block 0x106, offset 0x4180 - 0x4190: 0x00c0, 0x4191: 0x00c0, - 0x4192: 0x00c0, 0x4193: 0x00c0, 0x4194: 0x00c0, 0x4195: 0x00c0, 0x4196: 0x00c0, 0x4197: 0x00c0, - 0x4198: 0x00c0, 0x4199: 0x00c0, 0x419a: 0x00c0, 0x419b: 0x00c0, 0x419c: 0x00c0, 0x419d: 0x00c0, - 0x419e: 0x00c0, 0x419f: 0x00c0, 0x41a0: 0x00c0, 0x41a1: 0x00c0, 0x41a2: 0x00c0, 0x41a3: 0x00c0, - 0x41a4: 0x00c0, 0x41a5: 0x00c0, 0x41a6: 0x00c0, 0x41a7: 0x00c0, 0x41a8: 0x00c0, 0x41a9: 0x00c0, - 0x41aa: 0x00c0, 0x41ab: 0x00c0, 0x41ac: 0x00c0, 0x41ad: 0x00c0, - 0x41b0: 0x00c3, 0x41b1: 0x00c3, 0x41b2: 0x00c3, 0x41b3: 0x00c3, 0x41b4: 0x00c3, 0x41b5: 0x0080, - // Block 0x107, offset 0x41c0 - 0x41c0: 0x00c0, 0x41c1: 0x00c0, 0x41c2: 0x00c0, 0x41c3: 0x00c0, 0x41c4: 0x00c0, 0x41c5: 0x00c0, - 0x41c6: 0x00c0, 0x41c7: 0x00c0, 0x41c8: 0x00c0, 0x41c9: 0x00c0, 0x41ca: 0x00c0, 0x41cb: 0x00c0, - 0x41cc: 0x00c0, 0x41cd: 0x00c0, 0x41ce: 0x00c0, 0x41cf: 0x00c0, 0x41d0: 0x00c0, 0x41d1: 0x00c0, - 0x41d2: 0x00c0, 0x41d3: 0x00c0, 0x41d4: 0x00c0, 0x41d5: 0x00c0, 0x41d6: 0x00c0, 0x41d7: 0x00c0, - 0x41d8: 0x00c0, 0x41d9: 0x00c0, 0x41da: 0x00c0, 0x41db: 0x00c0, 0x41dc: 0x00c0, 0x41dd: 0x00c0, - 0x41de: 0x00c0, 0x41df: 0x00c0, 0x41e0: 0x00c0, 0x41e1: 0x00c0, 0x41e2: 0x00c0, 0x41e3: 0x00c0, - 0x41e4: 0x00c0, 0x41e5: 0x00c0, 0x41e6: 0x00c0, 0x41e7: 0x00c0, 0x41e8: 0x00c0, 0x41e9: 0x00c0, - 0x41ea: 0x00c0, 0x41eb: 0x00c0, 0x41ec: 0x00c0, 0x41ed: 0x00c0, 0x41ee: 0x00c0, 0x41ef: 0x00c0, - 0x41f0: 0x00c3, 0x41f1: 0x00c3, 0x41f2: 0x00c3, 0x41f3: 0x00c3, 0x41f4: 0x00c3, 0x41f5: 0x00c3, - 0x41f6: 0x00c3, 0x41f7: 0x0080, 0x41f8: 0x0080, 0x41f9: 0x0080, 0x41fa: 0x0080, 0x41fb: 0x0080, - 0x41fc: 0x0080, 0x41fd: 0x0080, 0x41fe: 0x0080, 0x41ff: 0x0080, - // Block 0x108, offset 0x4200 - 0x4200: 0x00c0, 0x4201: 0x00c0, 0x4202: 0x00c0, 0x4203: 0x00c0, 0x4204: 0x0080, 0x4205: 0x0080, - 0x4210: 0x00c0, 0x4211: 0x00c0, - 0x4212: 0x00c0, 0x4213: 0x00c0, 0x4214: 0x00c0, 0x4215: 0x00c0, 0x4216: 0x00c0, 0x4217: 0x00c0, - 0x4218: 0x00c0, 0x4219: 0x00c0, 0x421b: 0x0080, 0x421c: 0x0080, 0x421d: 0x0080, - 0x421e: 0x0080, 0x421f: 0x0080, 0x4220: 0x0080, 0x4221: 0x0080, 0x4223: 0x00c0, - 0x4224: 0x00c0, 0x4225: 0x00c0, 0x4226: 0x00c0, 0x4227: 0x00c0, 0x4228: 0x00c0, 0x4229: 0x00c0, - 0x422a: 0x00c0, 0x422b: 0x00c0, 0x422c: 0x00c0, 0x422d: 0x00c0, 0x422e: 0x00c0, 0x422f: 0x00c0, - 0x4230: 0x00c0, 0x4231: 0x00c0, 0x4232: 0x00c0, 0x4233: 0x00c0, 0x4234: 0x00c0, 0x4235: 0x00c0, - 0x4236: 0x00c0, 0x4237: 0x00c0, - 0x423d: 0x00c0, 0x423e: 0x00c0, 0x423f: 0x00c0, - // Block 0x109, offset 0x4240 - 0x4240: 0x00c0, 0x4241: 0x00c0, 0x4242: 0x00c0, 0x4243: 0x00c0, 0x4244: 0x00c0, 0x4245: 0x00c0, - 0x4246: 0x00c0, 0x4247: 0x00c0, 0x4248: 0x00c0, 0x4249: 0x00c0, 0x424a: 0x00c0, 0x424b: 0x00c0, - 0x424c: 0x00c0, 0x424d: 0x00c0, 0x424e: 0x00c0, 0x424f: 0x00c0, - // Block 0x10a, offset 0x4280 - 0x4280: 0x00c0, 0x4281: 0x00c0, 0x4282: 0x00c0, 0x4283: 0x00c0, 0x4284: 0x00c0, - 0x4290: 0x00c0, 0x4291: 0x00c0, - 0x4292: 0x00c0, 0x4293: 0x00c0, 0x4294: 0x00c0, 0x4295: 0x00c0, 0x4296: 0x00c0, 0x4297: 0x00c0, - 0x4298: 0x00c0, 0x4299: 0x00c0, 0x429a: 0x00c0, 0x429b: 0x00c0, 0x429c: 0x00c0, 0x429d: 0x00c0, - 0x429e: 0x00c0, 0x429f: 0x00c0, 0x42a0: 0x00c0, 0x42a1: 0x00c0, 0x42a2: 0x00c0, 0x42a3: 0x00c0, - 0x42a4: 0x00c0, 0x42a5: 0x00c0, 0x42a6: 0x00c0, 0x42a7: 0x00c0, 0x42a8: 0x00c0, 0x42a9: 0x00c0, - 0x42aa: 0x00c0, 0x42ab: 0x00c0, 0x42ac: 0x00c0, 0x42ad: 0x00c0, 0x42ae: 0x00c0, 0x42af: 0x00c0, - 0x42b0: 0x00c0, 0x42b1: 0x00c0, 0x42b2: 0x00c0, 0x42b3: 0x00c0, 0x42b4: 0x00c0, 0x42b5: 0x00c0, - 0x42b6: 0x00c0, 0x42b7: 0x00c0, 0x42b8: 0x00c0, 0x42b9: 0x00c0, 0x42ba: 0x00c0, 0x42bb: 0x00c0, - 0x42bc: 0x00c0, 0x42bd: 0x00c0, 0x42be: 0x00c0, - // Block 0x10b, offset 0x42c0 - 0x42cf: 0x00c3, 0x42d0: 0x00c3, 0x42d1: 0x00c3, - 0x42d2: 0x00c3, 0x42d3: 0x00c0, 0x42d4: 0x00c0, 0x42d5: 0x00c0, 0x42d6: 0x00c0, 0x42d7: 0x00c0, - 0x42d8: 0x00c0, 0x42d9: 0x00c0, 0x42da: 0x00c0, 0x42db: 0x00c0, 0x42dc: 0x00c0, 0x42dd: 0x00c0, - 0x42de: 0x00c0, 0x42df: 0x00c0, - // Block 0x10c, offset 0x4300 - 0x4320: 0x00c0, - // Block 0x10d, offset 0x4340 - 0x4340: 0x00c0, 0x4341: 0x00c0, 0x4342: 0x00c0, 0x4343: 0x00c0, 0x4344: 0x00c0, 0x4345: 0x00c0, - 0x4346: 0x00c0, 0x4347: 0x00c0, 0x4348: 0x00c0, 0x4349: 0x00c0, 0x434a: 0x00c0, 0x434b: 0x00c0, - 0x434c: 0x00c0, 0x434d: 0x00c0, 0x434e: 0x00c0, 0x434f: 0x00c0, 0x4350: 0x00c0, 0x4351: 0x00c0, - 0x4352: 0x00c0, 0x4353: 0x00c0, 0x4354: 0x00c0, 0x4355: 0x00c0, 0x4356: 0x00c0, 0x4357: 0x00c0, - 0x4358: 0x00c0, 0x4359: 0x00c0, 0x435a: 0x00c0, 0x435b: 0x00c0, 0x435c: 0x00c0, 0x435d: 0x00c0, - 0x435e: 0x00c0, 0x435f: 0x00c0, 0x4360: 0x00c0, 0x4361: 0x00c0, 0x4362: 0x00c0, 0x4363: 0x00c0, - 0x4364: 0x00c0, 0x4365: 0x00c0, 0x4366: 0x00c0, 0x4367: 0x00c0, 0x4368: 0x00c0, 0x4369: 0x00c0, - 0x436a: 0x00c0, 0x436b: 0x00c0, 0x436c: 0x00c0, - // Block 0x10e, offset 0x4380 - 0x4380: 0x00cc, 0x4381: 0x00cc, - // Block 0x10f, offset 0x43c0 - 0x43c0: 0x00c0, 0x43c1: 0x00c0, 0x43c2: 0x00c0, 0x43c3: 0x00c0, 0x43c4: 0x00c0, 0x43c5: 0x00c0, - 0x43c6: 0x00c0, 0x43c7: 0x00c0, 0x43c8: 0x00c0, 0x43c9: 0x00c0, 0x43ca: 0x00c0, 0x43cb: 0x00c0, - 0x43cc: 0x00c0, 0x43cd: 0x00c0, 0x43ce: 0x00c0, 0x43cf: 0x00c0, 0x43d0: 0x00c0, 0x43d1: 0x00c0, - 0x43d2: 0x00c0, 0x43d3: 0x00c0, 0x43d4: 0x00c0, 0x43d5: 0x00c0, 0x43d6: 0x00c0, 0x43d7: 0x00c0, - 0x43d8: 0x00c0, 0x43d9: 0x00c0, 0x43da: 0x00c0, 0x43db: 0x00c0, 0x43dc: 0x00c0, 0x43dd: 0x00c0, - 0x43de: 0x00c0, 0x43df: 0x00c0, 0x43e0: 0x00c0, 0x43e1: 0x00c0, 0x43e2: 0x00c0, 0x43e3: 0x00c0, - 0x43e4: 0x00c0, 0x43e5: 0x00c0, 0x43e6: 0x00c0, 0x43e7: 0x00c0, 0x43e8: 0x00c0, 0x43e9: 0x00c0, - 0x43ea: 0x00c0, - 0x43f0: 0x00c0, 0x43f1: 0x00c0, 0x43f2: 0x00c0, 0x43f3: 0x00c0, 0x43f4: 0x00c0, 0x43f5: 0x00c0, - 0x43f6: 0x00c0, 0x43f7: 0x00c0, 0x43f8: 0x00c0, 0x43f9: 0x00c0, 0x43fa: 0x00c0, 0x43fb: 0x00c0, - 0x43fc: 0x00c0, - // Block 0x110, offset 0x4400 - 0x4400: 0x00c0, 0x4401: 0x00c0, 0x4402: 0x00c0, 0x4403: 0x00c0, 0x4404: 0x00c0, 0x4405: 0x00c0, - 0x4406: 0x00c0, 0x4407: 0x00c0, 0x4408: 0x00c0, - 0x4410: 0x00c0, 0x4411: 0x00c0, - 0x4412: 0x00c0, 0x4413: 0x00c0, 0x4414: 0x00c0, 0x4415: 0x00c0, 0x4416: 0x00c0, 0x4417: 0x00c0, - 0x4418: 0x00c0, 0x4419: 0x00c0, 0x441c: 0x0080, 0x441d: 0x00c3, - 0x441e: 0x00c3, 0x441f: 0x0080, 0x4420: 0x0040, 0x4421: 0x0040, 0x4422: 0x0040, 0x4423: 0x0040, - // Block 0x111, offset 0x4440 - 0x4440: 0x0080, 0x4441: 0x0080, 0x4442: 0x0080, 0x4443: 0x0080, 0x4444: 0x0080, 0x4445: 0x0080, - 0x4446: 0x0080, 0x4447: 0x0080, 0x4448: 0x0080, 0x4449: 0x0080, 0x444a: 0x0080, 0x444b: 0x0080, - 0x444c: 0x0080, 0x444d: 0x0080, 0x444e: 0x0080, 0x444f: 0x0080, 0x4450: 0x0080, 0x4451: 0x0080, - 0x4452: 0x0080, 0x4453: 0x0080, 0x4454: 0x0080, 0x4455: 0x0080, 0x4456: 0x0080, 0x4457: 0x0080, - 0x4458: 0x0080, 0x4459: 0x0080, 0x445a: 0x0080, 0x445b: 0x0080, 0x445c: 0x0080, 0x445d: 0x0080, - 0x445e: 0x0080, 0x445f: 0x0080, 0x4460: 0x0080, 0x4461: 0x0080, 0x4462: 0x0080, 0x4463: 0x0080, - 0x4464: 0x0080, 0x4465: 0x0080, 0x4466: 0x0080, 0x4467: 0x0080, 0x4468: 0x0080, 0x4469: 0x0080, - 0x446a: 0x0080, 0x446b: 0x0080, 0x446c: 0x0080, 0x446d: 0x0080, 0x446e: 0x0080, 0x446f: 0x0080, - 0x4470: 0x0080, 0x4471: 0x0080, 0x4472: 0x0080, 0x4473: 0x0080, 0x4474: 0x0080, 0x4475: 0x0080, - // Block 0x112, offset 0x4480 - 0x4480: 0x0080, 0x4481: 0x0080, 0x4482: 0x0080, 0x4483: 0x0080, 0x4484: 0x0080, 0x4485: 0x0080, - 0x4486: 0x0080, 0x4487: 0x0080, 0x4488: 0x0080, 0x4489: 0x0080, 0x448a: 0x0080, 0x448b: 0x0080, - 0x448c: 0x0080, 0x448d: 0x0080, 0x448e: 0x0080, 0x448f: 0x0080, 0x4490: 0x0080, 0x4491: 0x0080, - 0x4492: 0x0080, 0x4493: 0x0080, 0x4494: 0x0080, 0x4495: 0x0080, 0x4496: 0x0080, 0x4497: 0x0080, - 0x4498: 0x0080, 0x4499: 0x0080, 0x449a: 0x0080, 0x449b: 0x0080, 0x449c: 0x0080, 0x449d: 0x0080, - 0x449e: 0x0080, 0x449f: 0x0080, 0x44a0: 0x0080, 0x44a1: 0x0080, 0x44a2: 0x0080, 0x44a3: 0x0080, - 0x44a4: 0x0080, 0x44a5: 0x0080, 0x44a6: 0x0080, 0x44a9: 0x0080, - 0x44aa: 0x0080, 0x44ab: 0x0080, 0x44ac: 0x0080, 0x44ad: 0x0080, 0x44ae: 0x0080, 0x44af: 0x0080, - 0x44b0: 0x0080, 0x44b1: 0x0080, 0x44b2: 0x0080, 0x44b3: 0x0080, 0x44b4: 0x0080, 0x44b5: 0x0080, - 0x44b6: 0x0080, 0x44b7: 0x0080, 0x44b8: 0x0080, 0x44b9: 0x0080, 0x44ba: 0x0080, 0x44bb: 0x0080, - 0x44bc: 0x0080, 0x44bd: 0x0080, 0x44be: 0x0080, 0x44bf: 0x0080, - // Block 0x113, offset 0x44c0 - 0x44c0: 0x0080, 0x44c1: 0x0080, 0x44c2: 0x0080, 0x44c3: 0x0080, 0x44c4: 0x0080, 0x44c5: 0x0080, - 0x44c6: 0x0080, 0x44c7: 0x0080, 0x44c8: 0x0080, 0x44c9: 0x0080, 0x44ca: 0x0080, 0x44cb: 0x0080, - 0x44cc: 0x0080, 0x44cd: 0x0080, 0x44ce: 0x0080, 0x44cf: 0x0080, 0x44d0: 0x0080, 0x44d1: 0x0080, - 0x44d2: 0x0080, 0x44d3: 0x0080, 0x44d4: 0x0080, 0x44d5: 0x0080, 0x44d6: 0x0080, 0x44d7: 0x0080, - 0x44d8: 0x0080, 0x44d9: 0x0080, 0x44da: 0x0080, 0x44db: 0x0080, 0x44dc: 0x0080, 0x44dd: 0x0080, - 0x44de: 0x0080, 0x44df: 0x0080, 0x44e0: 0x0080, 0x44e1: 0x0080, 0x44e2: 0x0080, 0x44e3: 0x0080, - 0x44e4: 0x0080, 0x44e5: 0x00c0, 0x44e6: 0x00c0, 0x44e7: 0x00c3, 0x44e8: 0x00c3, 0x44e9: 0x00c3, - 0x44ea: 0x0080, 0x44eb: 0x0080, 0x44ec: 0x0080, 0x44ed: 0x00c0, 0x44ee: 0x00c0, 0x44ef: 0x00c0, - 0x44f0: 0x00c0, 0x44f1: 0x00c0, 0x44f2: 0x00c0, 0x44f3: 0x0040, 0x44f4: 0x0040, 0x44f5: 0x0040, - 0x44f6: 0x0040, 0x44f7: 0x0040, 0x44f8: 0x0040, 0x44f9: 0x0040, 0x44fa: 0x0040, 0x44fb: 0x00c3, - 0x44fc: 0x00c3, 0x44fd: 0x00c3, 0x44fe: 0x00c3, 0x44ff: 0x00c3, - // Block 0x114, offset 0x4500 - 0x4500: 0x00c3, 0x4501: 0x00c3, 0x4502: 0x00c3, 0x4503: 0x0080, 0x4504: 0x0080, 0x4505: 0x00c3, - 0x4506: 0x00c3, 0x4507: 0x00c3, 0x4508: 0x00c3, 0x4509: 0x00c3, 0x450a: 0x00c3, 0x450b: 0x00c3, - 0x450c: 0x0080, 0x450d: 0x0080, 0x450e: 0x0080, 0x450f: 0x0080, 0x4510: 0x0080, 0x4511: 0x0080, - 0x4512: 0x0080, 0x4513: 0x0080, 0x4514: 0x0080, 0x4515: 0x0080, 0x4516: 0x0080, 0x4517: 0x0080, - 0x4518: 0x0080, 0x4519: 0x0080, 0x451a: 0x0080, 0x451b: 0x0080, 0x451c: 0x0080, 0x451d: 0x0080, - 0x451e: 0x0080, 0x451f: 0x0080, 0x4520: 0x0080, 0x4521: 0x0080, 0x4522: 0x0080, 0x4523: 0x0080, - 0x4524: 0x0080, 0x4525: 0x0080, 0x4526: 0x0080, 0x4527: 0x0080, 0x4528: 0x0080, 0x4529: 0x0080, - 0x452a: 0x00c3, 0x452b: 0x00c3, 0x452c: 0x00c3, 0x452d: 0x00c3, 0x452e: 0x0080, 0x452f: 0x0080, - 0x4530: 0x0080, 0x4531: 0x0080, 0x4532: 0x0080, 0x4533: 0x0080, 0x4534: 0x0080, 0x4535: 0x0080, - 0x4536: 0x0080, 0x4537: 0x0080, 0x4538: 0x0080, 0x4539: 0x0080, 0x453a: 0x0080, 0x453b: 0x0080, - 0x453c: 0x0080, 0x453d: 0x0080, 0x453e: 0x0080, 0x453f: 0x0080, - // Block 0x115, offset 0x4540 - 0x4540: 0x0080, 0x4541: 0x0080, 0x4542: 0x0080, 0x4543: 0x0080, 0x4544: 0x0080, 0x4545: 0x0080, - 0x4546: 0x0080, 0x4547: 0x0080, 0x4548: 0x0080, 0x4549: 0x0080, 0x454a: 0x0080, 0x454b: 0x0080, - 0x454c: 0x0080, 0x454d: 0x0080, 0x454e: 0x0080, 0x454f: 0x0080, 0x4550: 0x0080, 0x4551: 0x0080, - 0x4552: 0x0080, 0x4553: 0x0080, 0x4554: 0x0080, 0x4555: 0x0080, 0x4556: 0x0080, 0x4557: 0x0080, - 0x4558: 0x0080, 0x4559: 0x0080, 0x455a: 0x0080, 0x455b: 0x0080, 0x455c: 0x0080, 0x455d: 0x0080, - 0x455e: 0x0080, 0x455f: 0x0080, 0x4560: 0x0080, 0x4561: 0x0080, 0x4562: 0x0080, 0x4563: 0x0080, - 0x4564: 0x0080, 0x4565: 0x0080, 0x4566: 0x0080, 0x4567: 0x0080, 0x4568: 0x0080, - // Block 0x116, offset 0x4580 - 0x4580: 0x0088, 0x4581: 0x0088, 0x4582: 0x00c9, 0x4583: 0x00c9, 0x4584: 0x00c9, 0x4585: 0x0088, - // Block 0x117, offset 0x45c0 - 0x45c0: 0x0080, 0x45c1: 0x0080, 0x45c2: 0x0080, 0x45c3: 0x0080, 0x45c4: 0x0080, 0x45c5: 0x0080, - 0x45c6: 0x0080, 0x45c7: 0x0080, 0x45c8: 0x0080, 0x45c9: 0x0080, 0x45ca: 0x0080, 0x45cb: 0x0080, - 0x45cc: 0x0080, 0x45cd: 0x0080, 0x45ce: 0x0080, 0x45cf: 0x0080, 0x45d0: 0x0080, 0x45d1: 0x0080, - 0x45d2: 0x0080, 0x45d3: 0x0080, 0x45d4: 0x0080, 0x45d5: 0x0080, 0x45d6: 0x0080, - 0x45e0: 0x0080, 0x45e1: 0x0080, 0x45e2: 0x0080, 0x45e3: 0x0080, - 0x45e4: 0x0080, 0x45e5: 0x0080, 0x45e6: 0x0080, 0x45e7: 0x0080, 0x45e8: 0x0080, 0x45e9: 0x0080, - 0x45ea: 0x0080, 0x45eb: 0x0080, 0x45ec: 0x0080, 0x45ed: 0x0080, 0x45ee: 0x0080, 0x45ef: 0x0080, - 0x45f0: 0x0080, 0x45f1: 0x0080, - // Block 0x118, offset 0x4600 - 0x4600: 0x0080, 0x4601: 0x0080, 0x4602: 0x0080, 0x4603: 0x0080, 0x4604: 0x0080, 0x4605: 0x0080, - 0x4606: 0x0080, 0x4607: 0x0080, 0x4608: 0x0080, 0x4609: 0x0080, 0x460a: 0x0080, 0x460b: 0x0080, - 0x460c: 0x0080, 0x460d: 0x0080, 0x460e: 0x0080, 0x460f: 0x0080, 0x4610: 0x0080, 0x4611: 0x0080, - 0x4612: 0x0080, 0x4613: 0x0080, 0x4614: 0x0080, 0x4616: 0x0080, 0x4617: 0x0080, - 0x4618: 0x0080, 0x4619: 0x0080, 0x461a: 0x0080, 0x461b: 0x0080, 0x461c: 0x0080, 0x461d: 0x0080, - 0x461e: 0x0080, 0x461f: 0x0080, 0x4620: 0x0080, 0x4621: 0x0080, 0x4622: 0x0080, 0x4623: 0x0080, - 0x4624: 0x0080, 0x4625: 0x0080, 0x4626: 0x0080, 0x4627: 0x0080, 0x4628: 0x0080, 0x4629: 0x0080, - 0x462a: 0x0080, 0x462b: 0x0080, 0x462c: 0x0080, 0x462d: 0x0080, 0x462e: 0x0080, 0x462f: 0x0080, - 0x4630: 0x0080, 0x4631: 0x0080, 0x4632: 0x0080, 0x4633: 0x0080, 0x4634: 0x0080, 0x4635: 0x0080, - 0x4636: 0x0080, 0x4637: 0x0080, 0x4638: 0x0080, 0x4639: 0x0080, 0x463a: 0x0080, 0x463b: 0x0080, - 0x463c: 0x0080, 0x463d: 0x0080, 0x463e: 0x0080, 0x463f: 0x0080, - // Block 0x119, offset 0x4640 - 0x4640: 0x0080, 0x4641: 0x0080, 0x4642: 0x0080, 0x4643: 0x0080, 0x4644: 0x0080, 0x4645: 0x0080, - 0x4646: 0x0080, 0x4647: 0x0080, 0x4648: 0x0080, 0x4649: 0x0080, 0x464a: 0x0080, 0x464b: 0x0080, - 0x464c: 0x0080, 0x464d: 0x0080, 0x464e: 0x0080, 0x464f: 0x0080, 0x4650: 0x0080, 0x4651: 0x0080, - 0x4652: 0x0080, 0x4653: 0x0080, 0x4654: 0x0080, 0x4655: 0x0080, 0x4656: 0x0080, 0x4657: 0x0080, - 0x4658: 0x0080, 0x4659: 0x0080, 0x465a: 0x0080, 0x465b: 0x0080, 0x465c: 0x0080, - 0x465e: 0x0080, 0x465f: 0x0080, 0x4662: 0x0080, - 0x4665: 0x0080, 0x4666: 0x0080, 0x4669: 0x0080, - 0x466a: 0x0080, 0x466b: 0x0080, 0x466c: 0x0080, 0x466e: 0x0080, 0x466f: 0x0080, - 0x4670: 0x0080, 0x4671: 0x0080, 0x4672: 0x0080, 0x4673: 0x0080, 0x4674: 0x0080, 0x4675: 0x0080, - 0x4676: 0x0080, 0x4677: 0x0080, 0x4678: 0x0080, 0x4679: 0x0080, 0x467b: 0x0080, - 0x467d: 0x0080, 0x467e: 0x0080, 0x467f: 0x0080, - // Block 0x11a, offset 0x4680 - 0x4680: 0x0080, 0x4681: 0x0080, 0x4682: 0x0080, 0x4683: 0x0080, 0x4685: 0x0080, - 0x4686: 0x0080, 0x4687: 0x0080, 0x4688: 0x0080, 0x4689: 0x0080, 0x468a: 0x0080, 0x468b: 0x0080, - 0x468c: 0x0080, 0x468d: 0x0080, 0x468e: 0x0080, 0x468f: 0x0080, 0x4690: 0x0080, 0x4691: 0x0080, - 0x4692: 0x0080, 0x4693: 0x0080, 0x4694: 0x0080, 0x4695: 0x0080, 0x4696: 0x0080, 0x4697: 0x0080, - 0x4698: 0x0080, 0x4699: 0x0080, 0x469a: 0x0080, 0x469b: 0x0080, 0x469c: 0x0080, 0x469d: 0x0080, - 0x469e: 0x0080, 0x469f: 0x0080, 0x46a0: 0x0080, 0x46a1: 0x0080, 0x46a2: 0x0080, 0x46a3: 0x0080, - 0x46a4: 0x0080, 0x46a5: 0x0080, 0x46a6: 0x0080, 0x46a7: 0x0080, 0x46a8: 0x0080, 0x46a9: 0x0080, - 0x46aa: 0x0080, 0x46ab: 0x0080, 0x46ac: 0x0080, 0x46ad: 0x0080, 0x46ae: 0x0080, 0x46af: 0x0080, - 0x46b0: 0x0080, 0x46b1: 0x0080, 0x46b2: 0x0080, 0x46b3: 0x0080, 0x46b4: 0x0080, 0x46b5: 0x0080, - 0x46b6: 0x0080, 0x46b7: 0x0080, 0x46b8: 0x0080, 0x46b9: 0x0080, 0x46ba: 0x0080, 0x46bb: 0x0080, - 0x46bc: 0x0080, 0x46bd: 0x0080, 0x46be: 0x0080, 0x46bf: 0x0080, - // Block 0x11b, offset 0x46c0 - 0x46c0: 0x0080, 0x46c1: 0x0080, 0x46c2: 0x0080, 0x46c3: 0x0080, 0x46c4: 0x0080, 0x46c5: 0x0080, - 0x46c7: 0x0080, 0x46c8: 0x0080, 0x46c9: 0x0080, 0x46ca: 0x0080, - 0x46cd: 0x0080, 0x46ce: 0x0080, 0x46cf: 0x0080, 0x46d0: 0x0080, 0x46d1: 0x0080, - 0x46d2: 0x0080, 0x46d3: 0x0080, 0x46d4: 0x0080, 0x46d6: 0x0080, 0x46d7: 0x0080, - 0x46d8: 0x0080, 0x46d9: 0x0080, 0x46da: 0x0080, 0x46db: 0x0080, 0x46dc: 0x0080, - 0x46de: 0x0080, 0x46df: 0x0080, 0x46e0: 0x0080, 0x46e1: 0x0080, 0x46e2: 0x0080, 0x46e3: 0x0080, - 0x46e4: 0x0080, 0x46e5: 0x0080, 0x46e6: 0x0080, 0x46e7: 0x0080, 0x46e8: 0x0080, 0x46e9: 0x0080, - 0x46ea: 0x0080, 0x46eb: 0x0080, 0x46ec: 0x0080, 0x46ed: 0x0080, 0x46ee: 0x0080, 0x46ef: 0x0080, - 0x46f0: 0x0080, 0x46f1: 0x0080, 0x46f2: 0x0080, 0x46f3: 0x0080, 0x46f4: 0x0080, 0x46f5: 0x0080, - 0x46f6: 0x0080, 0x46f7: 0x0080, 0x46f8: 0x0080, 0x46f9: 0x0080, 0x46fb: 0x0080, - 0x46fc: 0x0080, 0x46fd: 0x0080, 0x46fe: 0x0080, - // Block 0x11c, offset 0x4700 - 0x4700: 0x0080, 0x4701: 0x0080, 0x4702: 0x0080, 0x4703: 0x0080, 0x4704: 0x0080, - 0x4706: 0x0080, 0x470a: 0x0080, 0x470b: 0x0080, - 0x470c: 0x0080, 0x470d: 0x0080, 0x470e: 0x0080, 0x470f: 0x0080, 0x4710: 0x0080, - 0x4712: 0x0080, 0x4713: 0x0080, 0x4714: 0x0080, 0x4715: 0x0080, 0x4716: 0x0080, 0x4717: 0x0080, - 0x4718: 0x0080, 0x4719: 0x0080, 0x471a: 0x0080, 0x471b: 0x0080, 0x471c: 0x0080, 0x471d: 0x0080, - 0x471e: 0x0080, 0x471f: 0x0080, 0x4720: 0x0080, 0x4721: 0x0080, 0x4722: 0x0080, 0x4723: 0x0080, - 0x4724: 0x0080, 0x4725: 0x0080, 0x4726: 0x0080, 0x4727: 0x0080, 0x4728: 0x0080, 0x4729: 0x0080, - 0x472a: 0x0080, 0x472b: 0x0080, 0x472c: 0x0080, 0x472d: 0x0080, 0x472e: 0x0080, 0x472f: 0x0080, - 0x4730: 0x0080, 0x4731: 0x0080, 0x4732: 0x0080, 0x4733: 0x0080, 0x4734: 0x0080, 0x4735: 0x0080, - 0x4736: 0x0080, 0x4737: 0x0080, 0x4738: 0x0080, 0x4739: 0x0080, 0x473a: 0x0080, 0x473b: 0x0080, - 0x473c: 0x0080, 0x473d: 0x0080, 0x473e: 0x0080, 0x473f: 0x0080, - // Block 0x11d, offset 0x4740 - 0x4740: 0x0080, 0x4741: 0x0080, 0x4742: 0x0080, 0x4743: 0x0080, 0x4744: 0x0080, 0x4745: 0x0080, - 0x4746: 0x0080, 0x4747: 0x0080, 0x4748: 0x0080, 0x4749: 0x0080, 0x474a: 0x0080, 0x474b: 0x0080, - 0x474c: 0x0080, 0x474d: 0x0080, 0x474e: 0x0080, 0x474f: 0x0080, 0x4750: 0x0080, 0x4751: 0x0080, - 0x4752: 0x0080, 0x4753: 0x0080, 0x4754: 0x0080, 0x4755: 0x0080, 0x4756: 0x0080, 0x4757: 0x0080, - 0x4758: 0x0080, 0x4759: 0x0080, 0x475a: 0x0080, 0x475b: 0x0080, 0x475c: 0x0080, 0x475d: 0x0080, - 0x475e: 0x0080, 0x475f: 0x0080, 0x4760: 0x0080, 0x4761: 0x0080, 0x4762: 0x0080, 0x4763: 0x0080, - 0x4764: 0x0080, 0x4765: 0x0080, 0x4768: 0x0080, 0x4769: 0x0080, - 0x476a: 0x0080, 0x476b: 0x0080, 0x476c: 0x0080, 0x476d: 0x0080, 0x476e: 0x0080, 0x476f: 0x0080, - 0x4770: 0x0080, 0x4771: 0x0080, 0x4772: 0x0080, 0x4773: 0x0080, 0x4774: 0x0080, 0x4775: 0x0080, - 0x4776: 0x0080, 0x4777: 0x0080, 0x4778: 0x0080, 0x4779: 0x0080, 0x477a: 0x0080, 0x477b: 0x0080, - 0x477c: 0x0080, 0x477d: 0x0080, 0x477e: 0x0080, 0x477f: 0x0080, - // Block 0x11e, offset 0x4780 - 0x4780: 0x0080, 0x4781: 0x0080, 0x4782: 0x0080, 0x4783: 0x0080, 0x4784: 0x0080, 0x4785: 0x0080, - 0x4786: 0x0080, 0x4787: 0x0080, 0x4788: 0x0080, 0x4789: 0x0080, 0x478a: 0x0080, 0x478b: 0x0080, - 0x478e: 0x0080, 0x478f: 0x0080, 0x4790: 0x0080, 0x4791: 0x0080, - 0x4792: 0x0080, 0x4793: 0x0080, 0x4794: 0x0080, 0x4795: 0x0080, 0x4796: 0x0080, 0x4797: 0x0080, - 0x4798: 0x0080, 0x4799: 0x0080, 0x479a: 0x0080, 0x479b: 0x0080, 0x479c: 0x0080, 0x479d: 0x0080, - 0x479e: 0x0080, 0x479f: 0x0080, 0x47a0: 0x0080, 0x47a1: 0x0080, 0x47a2: 0x0080, 0x47a3: 0x0080, - 0x47a4: 0x0080, 0x47a5: 0x0080, 0x47a6: 0x0080, 0x47a7: 0x0080, 0x47a8: 0x0080, 0x47a9: 0x0080, - 0x47aa: 0x0080, 0x47ab: 0x0080, 0x47ac: 0x0080, 0x47ad: 0x0080, 0x47ae: 0x0080, 0x47af: 0x0080, - 0x47b0: 0x0080, 0x47b1: 0x0080, 0x47b2: 0x0080, 0x47b3: 0x0080, 0x47b4: 0x0080, 0x47b5: 0x0080, - 0x47b6: 0x0080, 0x47b7: 0x0080, 0x47b8: 0x0080, 0x47b9: 0x0080, 0x47ba: 0x0080, 0x47bb: 0x0080, - 0x47bc: 0x0080, 0x47bd: 0x0080, 0x47be: 0x0080, 0x47bf: 0x0080, - // Block 0x11f, offset 0x47c0 - 0x47c0: 0x00c3, 0x47c1: 0x00c3, 0x47c2: 0x00c3, 0x47c3: 0x00c3, 0x47c4: 0x00c3, 0x47c5: 0x00c3, - 0x47c6: 0x00c3, 0x47c7: 0x00c3, 0x47c8: 0x00c3, 0x47c9: 0x00c3, 0x47ca: 0x00c3, 0x47cb: 0x00c3, - 0x47cc: 0x00c3, 0x47cd: 0x00c3, 0x47ce: 0x00c3, 0x47cf: 0x00c3, 0x47d0: 0x00c3, 0x47d1: 0x00c3, - 0x47d2: 0x00c3, 0x47d3: 0x00c3, 0x47d4: 0x00c3, 0x47d5: 0x00c3, 0x47d6: 0x00c3, 0x47d7: 0x00c3, - 0x47d8: 0x00c3, 0x47d9: 0x00c3, 0x47da: 0x00c3, 0x47db: 0x00c3, 0x47dc: 0x00c3, 0x47dd: 0x00c3, - 0x47de: 0x00c3, 0x47df: 0x00c3, 0x47e0: 0x00c3, 0x47e1: 0x00c3, 0x47e2: 0x00c3, 0x47e3: 0x00c3, - 0x47e4: 0x00c3, 0x47e5: 0x00c3, 0x47e6: 0x00c3, 0x47e7: 0x00c3, 0x47e8: 0x00c3, 0x47e9: 0x00c3, - 0x47ea: 0x00c3, 0x47eb: 0x00c3, 0x47ec: 0x00c3, 0x47ed: 0x00c3, 0x47ee: 0x00c3, 0x47ef: 0x00c3, - 0x47f0: 0x00c3, 0x47f1: 0x00c3, 0x47f2: 0x00c3, 0x47f3: 0x00c3, 0x47f4: 0x00c3, 0x47f5: 0x00c3, - 0x47f6: 0x00c3, 0x47f7: 0x0080, 0x47f8: 0x0080, 0x47f9: 0x0080, 0x47fa: 0x0080, 0x47fb: 0x00c3, - 0x47fc: 0x00c3, 0x47fd: 0x00c3, 0x47fe: 0x00c3, 0x47ff: 0x00c3, - // Block 0x120, offset 0x4800 - 0x4800: 0x00c3, 0x4801: 0x00c3, 0x4802: 0x00c3, 0x4803: 0x00c3, 0x4804: 0x00c3, 0x4805: 0x00c3, - 0x4806: 0x00c3, 0x4807: 0x00c3, 0x4808: 0x00c3, 0x4809: 0x00c3, 0x480a: 0x00c3, 0x480b: 0x00c3, - 0x480c: 0x00c3, 0x480d: 0x00c3, 0x480e: 0x00c3, 0x480f: 0x00c3, 0x4810: 0x00c3, 0x4811: 0x00c3, - 0x4812: 0x00c3, 0x4813: 0x00c3, 0x4814: 0x00c3, 0x4815: 0x00c3, 0x4816: 0x00c3, 0x4817: 0x00c3, - 0x4818: 0x00c3, 0x4819: 0x00c3, 0x481a: 0x00c3, 0x481b: 0x00c3, 0x481c: 0x00c3, 0x481d: 0x00c3, - 0x481e: 0x00c3, 0x481f: 0x00c3, 0x4820: 0x00c3, 0x4821: 0x00c3, 0x4822: 0x00c3, 0x4823: 0x00c3, - 0x4824: 0x00c3, 0x4825: 0x00c3, 0x4826: 0x00c3, 0x4827: 0x00c3, 0x4828: 0x00c3, 0x4829: 0x00c3, - 0x482a: 0x00c3, 0x482b: 0x00c3, 0x482c: 0x00c3, 0x482d: 0x0080, 0x482e: 0x0080, 0x482f: 0x0080, - 0x4830: 0x0080, 0x4831: 0x0080, 0x4832: 0x0080, 0x4833: 0x0080, 0x4834: 0x0080, 0x4835: 0x00c3, - 0x4836: 0x0080, 0x4837: 0x0080, 0x4838: 0x0080, 0x4839: 0x0080, 0x483a: 0x0080, 0x483b: 0x0080, - 0x483c: 0x0080, 0x483d: 0x0080, 0x483e: 0x0080, 0x483f: 0x0080, - // Block 0x121, offset 0x4840 - 0x4840: 0x0080, 0x4841: 0x0080, 0x4842: 0x0080, 0x4843: 0x0080, 0x4844: 0x00c3, 0x4845: 0x0080, - 0x4846: 0x0080, 0x4847: 0x0080, 0x4848: 0x0080, 0x4849: 0x0080, 0x484a: 0x0080, 0x484b: 0x0080, - 0x485b: 0x00c3, 0x485c: 0x00c3, 0x485d: 0x00c3, - 0x485e: 0x00c3, 0x485f: 0x00c3, 0x4861: 0x00c3, 0x4862: 0x00c3, 0x4863: 0x00c3, - 0x4864: 0x00c3, 0x4865: 0x00c3, 0x4866: 0x00c3, 0x4867: 0x00c3, 0x4868: 0x00c3, 0x4869: 0x00c3, - 0x486a: 0x00c3, 0x486b: 0x00c3, 0x486c: 0x00c3, 0x486d: 0x00c3, 0x486e: 0x00c3, 0x486f: 0x00c3, - // Block 0x122, offset 0x4880 - 0x4880: 0x00c3, 0x4881: 0x00c3, 0x4882: 0x00c3, 0x4883: 0x00c3, 0x4884: 0x00c3, 0x4885: 0x00c3, - 0x4886: 0x00c3, 0x4888: 0x00c3, 0x4889: 0x00c3, 0x488a: 0x00c3, 0x488b: 0x00c3, - 0x488c: 0x00c3, 0x488d: 0x00c3, 0x488e: 0x00c3, 0x488f: 0x00c3, 0x4890: 0x00c3, 0x4891: 0x00c3, - 0x4892: 0x00c3, 0x4893: 0x00c3, 0x4894: 0x00c3, 0x4895: 0x00c3, 0x4896: 0x00c3, 0x4897: 0x00c3, - 0x4898: 0x00c3, 0x489b: 0x00c3, 0x489c: 0x00c3, 0x489d: 0x00c3, - 0x489e: 0x00c3, 0x489f: 0x00c3, 0x48a0: 0x00c3, 0x48a1: 0x00c3, 0x48a3: 0x00c3, - 0x48a4: 0x00c3, 0x48a6: 0x00c3, 0x48a7: 0x00c3, 0x48a8: 0x00c3, 0x48a9: 0x00c3, - 0x48aa: 0x00c3, - // Block 0x123, offset 0x48c0 - 0x48c0: 0x00c0, 0x48c1: 0x00c0, 0x48c2: 0x00c0, 0x48c3: 0x00c0, 0x48c4: 0x00c0, - 0x48c7: 0x0080, 0x48c8: 0x0080, 0x48c9: 0x0080, 0x48ca: 0x0080, 0x48cb: 0x0080, - 0x48cc: 0x0080, 0x48cd: 0x0080, 0x48ce: 0x0080, 0x48cf: 0x0080, 0x48d0: 0x00c3, 0x48d1: 0x00c3, - 0x48d2: 0x00c3, 0x48d3: 0x00c3, 0x48d4: 0x00c3, 0x48d5: 0x00c3, 0x48d6: 0x00c3, - // Block 0x124, offset 0x4900 - 0x4900: 0x00c2, 0x4901: 0x00c2, 0x4902: 0x00c2, 0x4903: 0x00c2, 0x4904: 0x00c2, 0x4905: 0x00c2, - 0x4906: 0x00c2, 0x4907: 0x00c2, 0x4908: 0x00c2, 0x4909: 0x00c2, 0x490a: 0x00c2, 0x490b: 0x00c2, - 0x490c: 0x00c2, 0x490d: 0x00c2, 0x490e: 0x00c2, 0x490f: 0x00c2, 0x4910: 0x00c2, 0x4911: 0x00c2, - 0x4912: 0x00c2, 0x4913: 0x00c2, 0x4914: 0x00c2, 0x4915: 0x00c2, 0x4916: 0x00c2, 0x4917: 0x00c2, - 0x4918: 0x00c2, 0x4919: 0x00c2, 0x491a: 0x00c2, 0x491b: 0x00c2, 0x491c: 0x00c2, 0x491d: 0x00c2, - 0x491e: 0x00c2, 0x491f: 0x00c2, 0x4920: 0x00c2, 0x4921: 0x00c2, 0x4922: 0x00c2, 0x4923: 0x00c2, - 0x4924: 0x00c2, 0x4925: 0x00c2, 0x4926: 0x00c2, 0x4927: 0x00c2, 0x4928: 0x00c2, 0x4929: 0x00c2, - 0x492a: 0x00c2, 0x492b: 0x00c2, 0x492c: 0x00c2, 0x492d: 0x00c2, 0x492e: 0x00c2, 0x492f: 0x00c2, - 0x4930: 0x00c2, 0x4931: 0x00c2, 0x4932: 0x00c2, 0x4933: 0x00c2, 0x4934: 0x00c2, 0x4935: 0x00c2, - 0x4936: 0x00c2, 0x4937: 0x00c2, 0x4938: 0x00c2, 0x4939: 0x00c2, 0x493a: 0x00c2, 0x493b: 0x00c2, - 0x493c: 0x00c2, 0x493d: 0x00c2, 0x493e: 0x00c2, 0x493f: 0x00c2, - // Block 0x125, offset 0x4940 - 0x4940: 0x00c2, 0x4941: 0x00c2, 0x4942: 0x00c2, 0x4943: 0x00c2, 0x4944: 0x00c3, 0x4945: 0x00c3, - 0x4946: 0x00c3, 0x4947: 0x00c3, 0x4948: 0x00c3, 0x4949: 0x00c3, 0x494a: 0x00c3, - 0x4950: 0x00c0, 0x4951: 0x00c0, - 0x4952: 0x00c0, 0x4953: 0x00c0, 0x4954: 0x00c0, 0x4955: 0x00c0, 0x4956: 0x00c0, 0x4957: 0x00c0, - 0x4958: 0x00c0, 0x4959: 0x00c0, - 0x495e: 0x0080, 0x495f: 0x0080, - // Block 0x126, offset 0x4980 - 0x4980: 0x0080, 0x4981: 0x0080, 0x4982: 0x0080, 0x4983: 0x0080, 0x4985: 0x0080, - 0x4986: 0x0080, 0x4987: 0x0080, 0x4988: 0x0080, 0x4989: 0x0080, 0x498a: 0x0080, 0x498b: 0x0080, - 0x498c: 0x0080, 0x498d: 0x0080, 0x498e: 0x0080, 0x498f: 0x0080, 0x4990: 0x0080, 0x4991: 0x0080, - 0x4992: 0x0080, 0x4993: 0x0080, 0x4994: 0x0080, 0x4995: 0x0080, 0x4996: 0x0080, 0x4997: 0x0080, - 0x4998: 0x0080, 0x4999: 0x0080, 0x499a: 0x0080, 0x499b: 0x0080, 0x499c: 0x0080, 0x499d: 0x0080, - 0x499e: 0x0080, 0x499f: 0x0080, 0x49a1: 0x0080, 0x49a2: 0x0080, - 0x49a4: 0x0080, 0x49a7: 0x0080, 0x49a9: 0x0080, - 0x49aa: 0x0080, 0x49ab: 0x0080, 0x49ac: 0x0080, 0x49ad: 0x0080, 0x49ae: 0x0080, 0x49af: 0x0080, - 0x49b0: 0x0080, 0x49b1: 0x0080, 0x49b2: 0x0080, 0x49b4: 0x0080, 0x49b5: 0x0080, - 0x49b6: 0x0080, 0x49b7: 0x0080, 0x49b9: 0x0080, 0x49bb: 0x0080, - // Block 0x127, offset 0x49c0 - 0x49c2: 0x0080, - 0x49c7: 0x0080, 0x49c9: 0x0080, 0x49cb: 0x0080, - 0x49cd: 0x0080, 0x49ce: 0x0080, 0x49cf: 0x0080, 0x49d1: 0x0080, - 0x49d2: 0x0080, 0x49d4: 0x0080, 0x49d7: 0x0080, - 0x49d9: 0x0080, 0x49db: 0x0080, 0x49dd: 0x0080, - 0x49df: 0x0080, 0x49e1: 0x0080, 0x49e2: 0x0080, - 0x49e4: 0x0080, 0x49e7: 0x0080, 0x49e8: 0x0080, 0x49e9: 0x0080, - 0x49ea: 0x0080, 0x49ec: 0x0080, 0x49ed: 0x0080, 0x49ee: 0x0080, 0x49ef: 0x0080, - 0x49f0: 0x0080, 0x49f1: 0x0080, 0x49f2: 0x0080, 0x49f4: 0x0080, 0x49f5: 0x0080, - 0x49f6: 0x0080, 0x49f7: 0x0080, 0x49f9: 0x0080, 0x49fa: 0x0080, 0x49fb: 0x0080, - 0x49fc: 0x0080, 0x49fe: 0x0080, - // Block 0x128, offset 0x4a00 - 0x4a00: 0x0080, 0x4a01: 0x0080, 0x4a02: 0x0080, 0x4a03: 0x0080, 0x4a04: 0x0080, 0x4a05: 0x0080, - 0x4a06: 0x0080, 0x4a07: 0x0080, 0x4a08: 0x0080, 0x4a09: 0x0080, 0x4a0b: 0x0080, - 0x4a0c: 0x0080, 0x4a0d: 0x0080, 0x4a0e: 0x0080, 0x4a0f: 0x0080, 0x4a10: 0x0080, 0x4a11: 0x0080, - 0x4a12: 0x0080, 0x4a13: 0x0080, 0x4a14: 0x0080, 0x4a15: 0x0080, 0x4a16: 0x0080, 0x4a17: 0x0080, - 0x4a18: 0x0080, 0x4a19: 0x0080, 0x4a1a: 0x0080, 0x4a1b: 0x0080, - 0x4a21: 0x0080, 0x4a22: 0x0080, 0x4a23: 0x0080, - 0x4a25: 0x0080, 0x4a26: 0x0080, 0x4a27: 0x0080, 0x4a28: 0x0080, 0x4a29: 0x0080, - 0x4a2b: 0x0080, 0x4a2c: 0x0080, 0x4a2d: 0x0080, 0x4a2e: 0x0080, 0x4a2f: 0x0080, - 0x4a30: 0x0080, 0x4a31: 0x0080, 0x4a32: 0x0080, 0x4a33: 0x0080, 0x4a34: 0x0080, 0x4a35: 0x0080, - 0x4a36: 0x0080, 0x4a37: 0x0080, 0x4a38: 0x0080, 0x4a39: 0x0080, 0x4a3a: 0x0080, 0x4a3b: 0x0080, - // Block 0x129, offset 0x4a40 - 0x4a70: 0x0080, 0x4a71: 0x0080, - // Block 0x12a, offset 0x4a80 - 0x4a80: 0x0080, 0x4a81: 0x0080, 0x4a82: 0x0080, 0x4a83: 0x0080, 0x4a84: 0x0080, 0x4a85: 0x0080, - 0x4a86: 0x0080, 0x4a87: 0x0080, 0x4a88: 0x0080, 0x4a89: 0x0080, 0x4a8a: 0x0080, 0x4a8b: 0x0080, - 0x4a8c: 0x0080, 0x4a8d: 0x0080, 0x4a8e: 0x0080, 0x4a8f: 0x0080, 0x4a90: 0x0080, 0x4a91: 0x0080, - 0x4a92: 0x0080, 0x4a93: 0x0080, 0x4a94: 0x0080, 0x4a95: 0x0080, 0x4a96: 0x0080, 0x4a97: 0x0080, - 0x4a98: 0x0080, 0x4a99: 0x0080, 0x4a9a: 0x0080, 0x4a9b: 0x0080, 0x4a9c: 0x0080, 0x4a9d: 0x0080, - 0x4a9e: 0x0080, 0x4a9f: 0x0080, 0x4aa0: 0x0080, 0x4aa1: 0x0080, 0x4aa2: 0x0080, 0x4aa3: 0x0080, - 0x4aa4: 0x0080, 0x4aa5: 0x0080, 0x4aa6: 0x0080, 0x4aa7: 0x0080, 0x4aa8: 0x0080, 0x4aa9: 0x0080, - 0x4aaa: 0x0080, 0x4aab: 0x0080, - 0x4ab0: 0x0080, 0x4ab1: 0x0080, 0x4ab2: 0x0080, 0x4ab3: 0x0080, 0x4ab4: 0x0080, 0x4ab5: 0x0080, - 0x4ab6: 0x0080, 0x4ab7: 0x0080, 0x4ab8: 0x0080, 0x4ab9: 0x0080, 0x4aba: 0x0080, 0x4abb: 0x0080, - 0x4abc: 0x0080, 0x4abd: 0x0080, 0x4abe: 0x0080, 0x4abf: 0x0080, - // Block 0x12b, offset 0x4ac0 - 0x4ac0: 0x0080, 0x4ac1: 0x0080, 0x4ac2: 0x0080, 0x4ac3: 0x0080, 0x4ac4: 0x0080, 0x4ac5: 0x0080, - 0x4ac6: 0x0080, 0x4ac7: 0x0080, 0x4ac8: 0x0080, 0x4ac9: 0x0080, 0x4aca: 0x0080, 0x4acb: 0x0080, - 0x4acc: 0x0080, 0x4acd: 0x0080, 0x4ace: 0x0080, 0x4acf: 0x0080, 0x4ad0: 0x0080, 0x4ad1: 0x0080, - 0x4ad2: 0x0080, 0x4ad3: 0x0080, - 0x4ae0: 0x0080, 0x4ae1: 0x0080, 0x4ae2: 0x0080, 0x4ae3: 0x0080, - 0x4ae4: 0x0080, 0x4ae5: 0x0080, 0x4ae6: 0x0080, 0x4ae7: 0x0080, 0x4ae8: 0x0080, 0x4ae9: 0x0080, - 0x4aea: 0x0080, 0x4aeb: 0x0080, 0x4aec: 0x0080, 0x4aed: 0x0080, 0x4aee: 0x0080, - 0x4af1: 0x0080, 0x4af2: 0x0080, 0x4af3: 0x0080, 0x4af4: 0x0080, 0x4af5: 0x0080, - 0x4af6: 0x0080, 0x4af7: 0x0080, 0x4af8: 0x0080, 0x4af9: 0x0080, 0x4afa: 0x0080, 0x4afb: 0x0080, - 0x4afc: 0x0080, 0x4afd: 0x0080, 0x4afe: 0x0080, 0x4aff: 0x0080, - // Block 0x12c, offset 0x4b00 - 0x4b01: 0x0080, 0x4b02: 0x0080, 0x4b03: 0x0080, 0x4b04: 0x0080, 0x4b05: 0x0080, - 0x4b06: 0x0080, 0x4b07: 0x0080, 0x4b08: 0x0080, 0x4b09: 0x0080, 0x4b0a: 0x0080, 0x4b0b: 0x0080, - 0x4b0c: 0x0080, 0x4b0d: 0x0080, 0x4b0e: 0x0080, 0x4b0f: 0x0080, 0x4b11: 0x0080, - 0x4b12: 0x0080, 0x4b13: 0x0080, 0x4b14: 0x0080, 0x4b15: 0x0080, 0x4b16: 0x0080, 0x4b17: 0x0080, - 0x4b18: 0x0080, 0x4b19: 0x0080, 0x4b1a: 0x0080, 0x4b1b: 0x0080, 0x4b1c: 0x0080, 0x4b1d: 0x0080, - 0x4b1e: 0x0080, 0x4b1f: 0x0080, 0x4b20: 0x0080, 0x4b21: 0x0080, 0x4b22: 0x0080, 0x4b23: 0x0080, - 0x4b24: 0x0080, 0x4b25: 0x0080, 0x4b26: 0x0080, 0x4b27: 0x0080, 0x4b28: 0x0080, 0x4b29: 0x0080, - 0x4b2a: 0x0080, 0x4b2b: 0x0080, 0x4b2c: 0x0080, 0x4b2d: 0x0080, 0x4b2e: 0x0080, 0x4b2f: 0x0080, - 0x4b30: 0x0080, 0x4b31: 0x0080, 0x4b32: 0x0080, 0x4b33: 0x0080, 0x4b34: 0x0080, 0x4b35: 0x0080, - // Block 0x12d, offset 0x4b40 - 0x4b40: 0x0080, 0x4b41: 0x0080, 0x4b42: 0x0080, 0x4b43: 0x0080, 0x4b44: 0x0080, 0x4b45: 0x0080, - 0x4b46: 0x0080, 0x4b47: 0x0080, 0x4b48: 0x0080, 0x4b49: 0x0080, 0x4b4a: 0x0080, 0x4b4b: 0x0080, - 0x4b4c: 0x0080, 0x4b50: 0x0080, 0x4b51: 0x0080, - 0x4b52: 0x0080, 0x4b53: 0x0080, 0x4b54: 0x0080, 0x4b55: 0x0080, 0x4b56: 0x0080, 0x4b57: 0x0080, - 0x4b58: 0x0080, 0x4b59: 0x0080, 0x4b5a: 0x0080, 0x4b5b: 0x0080, 0x4b5c: 0x0080, 0x4b5d: 0x0080, - 0x4b5e: 0x0080, 0x4b5f: 0x0080, 0x4b60: 0x0080, 0x4b61: 0x0080, 0x4b62: 0x0080, 0x4b63: 0x0080, - 0x4b64: 0x0080, 0x4b65: 0x0080, 0x4b66: 0x0080, 0x4b67: 0x0080, 0x4b68: 0x0080, 0x4b69: 0x0080, - 0x4b6a: 0x0080, 0x4b6b: 0x0080, 0x4b6c: 0x0080, 0x4b6d: 0x0080, 0x4b6e: 0x0080, - 0x4b70: 0x0080, 0x4b71: 0x0080, 0x4b72: 0x0080, 0x4b73: 0x0080, 0x4b74: 0x0080, 0x4b75: 0x0080, - 0x4b76: 0x0080, 0x4b77: 0x0080, 0x4b78: 0x0080, 0x4b79: 0x0080, 0x4b7a: 0x0080, 0x4b7b: 0x0080, - 0x4b7c: 0x0080, 0x4b7d: 0x0080, 0x4b7e: 0x0080, 0x4b7f: 0x0080, - // Block 0x12e, offset 0x4b80 - 0x4b80: 0x0080, 0x4b81: 0x0080, 0x4b82: 0x0080, 0x4b83: 0x0080, 0x4b84: 0x0080, 0x4b85: 0x0080, - 0x4b86: 0x0080, 0x4b87: 0x0080, 0x4b88: 0x0080, 0x4b89: 0x0080, 0x4b8a: 0x0080, 0x4b8b: 0x0080, - 0x4b8c: 0x0080, 0x4b8d: 0x0080, 0x4b8e: 0x0080, 0x4b8f: 0x0080, 0x4b90: 0x0080, 0x4b91: 0x0080, - 0x4b92: 0x0080, 0x4b93: 0x0080, 0x4b94: 0x0080, 0x4b95: 0x0080, 0x4b96: 0x0080, 0x4b97: 0x0080, - 0x4b98: 0x0080, 0x4b99: 0x0080, 0x4b9a: 0x0080, 0x4b9b: 0x0080, 0x4b9c: 0x0080, 0x4b9d: 0x0080, - 0x4b9e: 0x0080, 0x4b9f: 0x0080, 0x4ba0: 0x0080, 0x4ba1: 0x0080, 0x4ba2: 0x0080, 0x4ba3: 0x0080, - 0x4ba4: 0x0080, 0x4ba5: 0x0080, 0x4ba6: 0x0080, 0x4ba7: 0x0080, 0x4ba8: 0x0080, 0x4ba9: 0x0080, - 0x4baa: 0x0080, 0x4bab: 0x0080, 0x4bac: 0x0080, - // Block 0x12f, offset 0x4bc0 - 0x4be6: 0x0080, 0x4be7: 0x0080, 0x4be8: 0x0080, 0x4be9: 0x0080, - 0x4bea: 0x0080, 0x4beb: 0x0080, 0x4bec: 0x0080, 0x4bed: 0x0080, 0x4bee: 0x0080, 0x4bef: 0x0080, - 0x4bf0: 0x0080, 0x4bf1: 0x0080, 0x4bf2: 0x0080, 0x4bf3: 0x0080, 0x4bf4: 0x0080, 0x4bf5: 0x0080, - 0x4bf6: 0x0080, 0x4bf7: 0x0080, 0x4bf8: 0x0080, 0x4bf9: 0x0080, 0x4bfa: 0x0080, 0x4bfb: 0x0080, - 0x4bfc: 0x0080, 0x4bfd: 0x0080, 0x4bfe: 0x0080, 0x4bff: 0x0080, - // Block 0x130, offset 0x4c00 - 0x4c00: 0x008c, 0x4c01: 0x0080, 0x4c02: 0x0080, - 0x4c10: 0x0080, 0x4c11: 0x0080, - 0x4c12: 0x0080, 0x4c13: 0x0080, 0x4c14: 0x0080, 0x4c15: 0x0080, 0x4c16: 0x0080, 0x4c17: 0x0080, - 0x4c18: 0x0080, 0x4c19: 0x0080, 0x4c1a: 0x0080, 0x4c1b: 0x0080, 0x4c1c: 0x0080, 0x4c1d: 0x0080, - 0x4c1e: 0x0080, 0x4c1f: 0x0080, 0x4c20: 0x0080, 0x4c21: 0x0080, 0x4c22: 0x0080, 0x4c23: 0x0080, - 0x4c24: 0x0080, 0x4c25: 0x0080, 0x4c26: 0x0080, 0x4c27: 0x0080, 0x4c28: 0x0080, 0x4c29: 0x0080, - 0x4c2a: 0x0080, 0x4c2b: 0x0080, 0x4c2c: 0x0080, 0x4c2d: 0x0080, 0x4c2e: 0x0080, 0x4c2f: 0x0080, - 0x4c30: 0x0080, 0x4c31: 0x0080, 0x4c32: 0x0080, 0x4c33: 0x0080, 0x4c34: 0x0080, 0x4c35: 0x0080, - 0x4c36: 0x0080, 0x4c37: 0x0080, 0x4c38: 0x0080, 0x4c39: 0x0080, 0x4c3a: 0x0080, 0x4c3b: 0x0080, - // Block 0x131, offset 0x4c40 - 0x4c40: 0x0080, 0x4c41: 0x0080, 0x4c42: 0x0080, 0x4c43: 0x0080, 0x4c44: 0x0080, 0x4c45: 0x0080, - 0x4c46: 0x0080, 0x4c47: 0x0080, 0x4c48: 0x0080, - 0x4c50: 0x0080, 0x4c51: 0x0080, - // Block 0x132, offset 0x4c80 - 0x4c80: 0x0080, 0x4c81: 0x0080, 0x4c82: 0x0080, 0x4c83: 0x0080, 0x4c84: 0x0080, 0x4c85: 0x0080, - 0x4c86: 0x0080, 0x4c87: 0x0080, 0x4c88: 0x0080, 0x4c89: 0x0080, 0x4c8a: 0x0080, 0x4c8b: 0x0080, - 0x4c8c: 0x0080, 0x4c8d: 0x0080, 0x4c8e: 0x0080, 0x4c8f: 0x0080, 0x4c90: 0x0080, 0x4c91: 0x0080, - 0x4c92: 0x0080, - 0x4ca0: 0x0080, 0x4ca1: 0x0080, 0x4ca2: 0x0080, 0x4ca3: 0x0080, - 0x4ca4: 0x0080, 0x4ca5: 0x0080, 0x4ca6: 0x0080, 0x4ca7: 0x0080, 0x4ca8: 0x0080, 0x4ca9: 0x0080, - 0x4caa: 0x0080, 0x4cab: 0x0080, 0x4cac: 0x0080, - 0x4cb0: 0x0080, 0x4cb1: 0x0080, 0x4cb2: 0x0080, 0x4cb3: 0x0080, 0x4cb4: 0x0080, 0x4cb5: 0x0080, - 0x4cb6: 0x0080, - // Block 0x133, offset 0x4cc0 - 0x4cc0: 0x0080, 0x4cc1: 0x0080, 0x4cc2: 0x0080, 0x4cc3: 0x0080, 0x4cc4: 0x0080, 0x4cc5: 0x0080, - 0x4cc6: 0x0080, 0x4cc7: 0x0080, 0x4cc8: 0x0080, 0x4cc9: 0x0080, 0x4cca: 0x0080, 0x4ccb: 0x0080, - 0x4ccc: 0x0080, 0x4ccd: 0x0080, 0x4cce: 0x0080, 0x4ccf: 0x0080, 0x4cd0: 0x0080, 0x4cd1: 0x0080, - 0x4cd2: 0x0080, 0x4cd3: 0x0080, 0x4cd4: 0x0080, 0x4cd5: 0x0080, 0x4cd6: 0x0080, 0x4cd7: 0x0080, - 0x4cd8: 0x0080, 0x4cd9: 0x0080, 0x4cda: 0x0080, 0x4cdb: 0x0080, 0x4cdc: 0x0080, 0x4cdd: 0x0080, - 0x4cde: 0x0080, 0x4cdf: 0x0080, 0x4ce0: 0x0080, 0x4ce1: 0x0080, 0x4ce2: 0x0080, 0x4ce3: 0x0080, - 0x4ce4: 0x0080, 0x4ce5: 0x0080, 0x4ce6: 0x0080, 0x4ce7: 0x0080, 0x4ce8: 0x0080, 0x4ce9: 0x0080, - 0x4cea: 0x0080, 0x4ceb: 0x0080, 0x4cec: 0x0080, 0x4ced: 0x0080, 0x4cee: 0x0080, 0x4cef: 0x0080, - 0x4cf0: 0x0080, 0x4cf1: 0x0080, 0x4cf2: 0x0080, 0x4cf3: 0x0080, - // Block 0x134, offset 0x4d00 - 0x4d00: 0x0080, 0x4d01: 0x0080, 0x4d02: 0x0080, 0x4d03: 0x0080, 0x4d04: 0x0080, 0x4d05: 0x0080, - 0x4d06: 0x0080, 0x4d07: 0x0080, 0x4d08: 0x0080, 0x4d09: 0x0080, 0x4d0a: 0x0080, 0x4d0b: 0x0080, - 0x4d0c: 0x0080, 0x4d0d: 0x0080, 0x4d0e: 0x0080, 0x4d0f: 0x0080, 0x4d10: 0x0080, 0x4d11: 0x0080, - 0x4d12: 0x0080, 0x4d13: 0x0080, 0x4d14: 0x0080, - // Block 0x135, offset 0x4d40 - 0x4d40: 0x0080, 0x4d41: 0x0080, 0x4d42: 0x0080, 0x4d43: 0x0080, 0x4d44: 0x0080, 0x4d45: 0x0080, - 0x4d46: 0x0080, 0x4d47: 0x0080, 0x4d48: 0x0080, 0x4d49: 0x0080, 0x4d4a: 0x0080, 0x4d4b: 0x0080, - 0x4d50: 0x0080, 0x4d51: 0x0080, - 0x4d52: 0x0080, 0x4d53: 0x0080, 0x4d54: 0x0080, 0x4d55: 0x0080, 0x4d56: 0x0080, 0x4d57: 0x0080, - 0x4d58: 0x0080, 0x4d59: 0x0080, 0x4d5a: 0x0080, 0x4d5b: 0x0080, 0x4d5c: 0x0080, 0x4d5d: 0x0080, - 0x4d5e: 0x0080, 0x4d5f: 0x0080, 0x4d60: 0x0080, 0x4d61: 0x0080, 0x4d62: 0x0080, 0x4d63: 0x0080, - 0x4d64: 0x0080, 0x4d65: 0x0080, 0x4d66: 0x0080, 0x4d67: 0x0080, 0x4d68: 0x0080, 0x4d69: 0x0080, - 0x4d6a: 0x0080, 0x4d6b: 0x0080, 0x4d6c: 0x0080, 0x4d6d: 0x0080, 0x4d6e: 0x0080, 0x4d6f: 0x0080, - 0x4d70: 0x0080, 0x4d71: 0x0080, 0x4d72: 0x0080, 0x4d73: 0x0080, 0x4d74: 0x0080, 0x4d75: 0x0080, - 0x4d76: 0x0080, 0x4d77: 0x0080, 0x4d78: 0x0080, 0x4d79: 0x0080, 0x4d7a: 0x0080, 0x4d7b: 0x0080, - 0x4d7c: 0x0080, 0x4d7d: 0x0080, 0x4d7e: 0x0080, 0x4d7f: 0x0080, - // Block 0x136, offset 0x4d80 - 0x4d80: 0x0080, 0x4d81: 0x0080, 0x4d82: 0x0080, 0x4d83: 0x0080, 0x4d84: 0x0080, 0x4d85: 0x0080, - 0x4d86: 0x0080, 0x4d87: 0x0080, - 0x4d90: 0x0080, 0x4d91: 0x0080, - 0x4d92: 0x0080, 0x4d93: 0x0080, 0x4d94: 0x0080, 0x4d95: 0x0080, 0x4d96: 0x0080, 0x4d97: 0x0080, - 0x4d98: 0x0080, 0x4d99: 0x0080, - 0x4da0: 0x0080, 0x4da1: 0x0080, 0x4da2: 0x0080, 0x4da3: 0x0080, - 0x4da4: 0x0080, 0x4da5: 0x0080, 0x4da6: 0x0080, 0x4da7: 0x0080, 0x4da8: 0x0080, 0x4da9: 0x0080, - 0x4daa: 0x0080, 0x4dab: 0x0080, 0x4dac: 0x0080, 0x4dad: 0x0080, 0x4dae: 0x0080, 0x4daf: 0x0080, - 0x4db0: 0x0080, 0x4db1: 0x0080, 0x4db2: 0x0080, 0x4db3: 0x0080, 0x4db4: 0x0080, 0x4db5: 0x0080, - 0x4db6: 0x0080, 0x4db7: 0x0080, 0x4db8: 0x0080, 0x4db9: 0x0080, 0x4dba: 0x0080, 0x4dbb: 0x0080, - 0x4dbc: 0x0080, 0x4dbd: 0x0080, 0x4dbe: 0x0080, 0x4dbf: 0x0080, - // Block 0x137, offset 0x4dc0 - 0x4dc0: 0x0080, 0x4dc1: 0x0080, 0x4dc2: 0x0080, 0x4dc3: 0x0080, 0x4dc4: 0x0080, 0x4dc5: 0x0080, - 0x4dc6: 0x0080, 0x4dc7: 0x0080, - 0x4dd0: 0x0080, 0x4dd1: 0x0080, - 0x4dd2: 0x0080, 0x4dd3: 0x0080, 0x4dd4: 0x0080, 0x4dd5: 0x0080, 0x4dd6: 0x0080, 0x4dd7: 0x0080, - 0x4dd8: 0x0080, 0x4dd9: 0x0080, 0x4dda: 0x0080, 0x4ddb: 0x0080, 0x4ddc: 0x0080, 0x4ddd: 0x0080, - 0x4dde: 0x0080, 0x4ddf: 0x0080, 0x4de0: 0x0080, 0x4de1: 0x0080, 0x4de2: 0x0080, 0x4de3: 0x0080, - 0x4de4: 0x0080, 0x4de5: 0x0080, 0x4de6: 0x0080, 0x4de7: 0x0080, 0x4de8: 0x0080, 0x4de9: 0x0080, - 0x4dea: 0x0080, 0x4deb: 0x0080, 0x4dec: 0x0080, 0x4ded: 0x0080, - // Block 0x138, offset 0x4e00 - 0x4e10: 0x0080, 0x4e11: 0x0080, - 0x4e12: 0x0080, 0x4e13: 0x0080, 0x4e14: 0x0080, 0x4e15: 0x0080, 0x4e16: 0x0080, 0x4e17: 0x0080, - 0x4e18: 0x0080, 0x4e19: 0x0080, 0x4e1a: 0x0080, 0x4e1b: 0x0080, 0x4e1c: 0x0080, 0x4e1d: 0x0080, - 0x4e1e: 0x0080, 0x4e20: 0x0080, 0x4e21: 0x0080, 0x4e22: 0x0080, 0x4e23: 0x0080, - 0x4e24: 0x0080, 0x4e25: 0x0080, 0x4e26: 0x0080, 0x4e27: 0x0080, - 0x4e30: 0x0080, 0x4e33: 0x0080, 0x4e34: 0x0080, 0x4e35: 0x0080, - 0x4e36: 0x0080, 0x4e37: 0x0080, 0x4e38: 0x0080, 0x4e39: 0x0080, 0x4e3a: 0x0080, 0x4e3b: 0x0080, - 0x4e3c: 0x0080, 0x4e3d: 0x0080, 0x4e3e: 0x0080, - // Block 0x139, offset 0x4e40 - 0x4e40: 0x0080, 0x4e41: 0x0080, 0x4e42: 0x0080, 0x4e43: 0x0080, 0x4e44: 0x0080, 0x4e45: 0x0080, - 0x4e46: 0x0080, 0x4e47: 0x0080, 0x4e48: 0x0080, 0x4e49: 0x0080, 0x4e4a: 0x0080, 0x4e4b: 0x0080, - 0x4e50: 0x0080, 0x4e51: 0x0080, - 0x4e52: 0x0080, 0x4e53: 0x0080, 0x4e54: 0x0080, 0x4e55: 0x0080, 0x4e56: 0x0080, 0x4e57: 0x0080, - 0x4e58: 0x0080, 0x4e59: 0x0080, 0x4e5a: 0x0080, 0x4e5b: 0x0080, 0x4e5c: 0x0080, 0x4e5d: 0x0080, - 0x4e5e: 0x0080, - // Block 0x13a, offset 0x4e80 - 0x4e80: 0x0080, 0x4e81: 0x0080, 0x4e82: 0x0080, 0x4e83: 0x0080, 0x4e84: 0x0080, 0x4e85: 0x0080, - 0x4e86: 0x0080, 0x4e87: 0x0080, 0x4e88: 0x0080, 0x4e89: 0x0080, 0x4e8a: 0x0080, 0x4e8b: 0x0080, - 0x4e8c: 0x0080, 0x4e8d: 0x0080, 0x4e8e: 0x0080, 0x4e8f: 0x0080, 0x4e90: 0x0080, 0x4e91: 0x0080, - // Block 0x13b, offset 0x4ec0 - 0x4ec0: 0x0080, - // Block 0x13c, offset 0x4f00 - 0x4f00: 0x00cc, 0x4f01: 0x00cc, 0x4f02: 0x00cc, 0x4f03: 0x00cc, 0x4f04: 0x00cc, 0x4f05: 0x00cc, - 0x4f06: 0x00cc, 0x4f07: 0x00cc, 0x4f08: 0x00cc, 0x4f09: 0x00cc, 0x4f0a: 0x00cc, 0x4f0b: 0x00cc, - 0x4f0c: 0x00cc, 0x4f0d: 0x00cc, 0x4f0e: 0x00cc, 0x4f0f: 0x00cc, 0x4f10: 0x00cc, 0x4f11: 0x00cc, - 0x4f12: 0x00cc, 0x4f13: 0x00cc, 0x4f14: 0x00cc, 0x4f15: 0x00cc, 0x4f16: 0x00cc, - // Block 0x13d, offset 0x4f40 - 0x4f40: 0x00cc, 0x4f41: 0x00cc, 0x4f42: 0x00cc, 0x4f43: 0x00cc, 0x4f44: 0x00cc, 0x4f45: 0x00cc, - 0x4f46: 0x00cc, 0x4f47: 0x00cc, 0x4f48: 0x00cc, 0x4f49: 0x00cc, 0x4f4a: 0x00cc, 0x4f4b: 0x00cc, - 0x4f4c: 0x00cc, 0x4f4d: 0x00cc, 0x4f4e: 0x00cc, 0x4f4f: 0x00cc, 0x4f50: 0x00cc, 0x4f51: 0x00cc, - 0x4f52: 0x00cc, 0x4f53: 0x00cc, 0x4f54: 0x00cc, 0x4f55: 0x00cc, 0x4f56: 0x00cc, 0x4f57: 0x00cc, - 0x4f58: 0x00cc, 0x4f59: 0x00cc, 0x4f5a: 0x00cc, 0x4f5b: 0x00cc, 0x4f5c: 0x00cc, 0x4f5d: 0x00cc, - 0x4f5e: 0x00cc, 0x4f5f: 0x00cc, 0x4f60: 0x00cc, 0x4f61: 0x00cc, 0x4f62: 0x00cc, 0x4f63: 0x00cc, - 0x4f64: 0x00cc, 0x4f65: 0x00cc, 0x4f66: 0x00cc, 0x4f67: 0x00cc, 0x4f68: 0x00cc, 0x4f69: 0x00cc, - 0x4f6a: 0x00cc, 0x4f6b: 0x00cc, 0x4f6c: 0x00cc, 0x4f6d: 0x00cc, 0x4f6e: 0x00cc, 0x4f6f: 0x00cc, - 0x4f70: 0x00cc, 0x4f71: 0x00cc, 0x4f72: 0x00cc, 0x4f73: 0x00cc, 0x4f74: 0x00cc, - // Block 0x13e, offset 0x4f80 - 0x4f80: 0x00cc, 0x4f81: 0x00cc, 0x4f82: 0x00cc, 0x4f83: 0x00cc, 0x4f84: 0x00cc, 0x4f85: 0x00cc, - 0x4f86: 0x00cc, 0x4f87: 0x00cc, 0x4f88: 0x00cc, 0x4f89: 0x00cc, 0x4f8a: 0x00cc, 0x4f8b: 0x00cc, - 0x4f8c: 0x00cc, 0x4f8d: 0x00cc, 0x4f8e: 0x00cc, 0x4f8f: 0x00cc, 0x4f90: 0x00cc, 0x4f91: 0x00cc, - 0x4f92: 0x00cc, 0x4f93: 0x00cc, 0x4f94: 0x00cc, 0x4f95: 0x00cc, 0x4f96: 0x00cc, 0x4f97: 0x00cc, - 0x4f98: 0x00cc, 0x4f99: 0x00cc, 0x4f9a: 0x00cc, 0x4f9b: 0x00cc, 0x4f9c: 0x00cc, 0x4f9d: 0x00cc, - 0x4fa0: 0x00cc, 0x4fa1: 0x00cc, 0x4fa2: 0x00cc, 0x4fa3: 0x00cc, - 0x4fa4: 0x00cc, 0x4fa5: 0x00cc, 0x4fa6: 0x00cc, 0x4fa7: 0x00cc, 0x4fa8: 0x00cc, 0x4fa9: 0x00cc, - 0x4faa: 0x00cc, 0x4fab: 0x00cc, 0x4fac: 0x00cc, 0x4fad: 0x00cc, 0x4fae: 0x00cc, 0x4faf: 0x00cc, - 0x4fb0: 0x00cc, 0x4fb1: 0x00cc, 0x4fb2: 0x00cc, 0x4fb3: 0x00cc, 0x4fb4: 0x00cc, 0x4fb5: 0x00cc, - 0x4fb6: 0x00cc, 0x4fb7: 0x00cc, 0x4fb8: 0x00cc, 0x4fb9: 0x00cc, 0x4fba: 0x00cc, 0x4fbb: 0x00cc, - 0x4fbc: 0x00cc, 0x4fbd: 0x00cc, 0x4fbe: 0x00cc, 0x4fbf: 0x00cc, - // Block 0x13f, offset 0x4fc0 - 0x4fc0: 0x00cc, 0x4fc1: 0x00cc, 0x4fc2: 0x00cc, 0x4fc3: 0x00cc, 0x4fc4: 0x00cc, 0x4fc5: 0x00cc, - 0x4fc6: 0x00cc, 0x4fc7: 0x00cc, 0x4fc8: 0x00cc, 0x4fc9: 0x00cc, 0x4fca: 0x00cc, 0x4fcb: 0x00cc, - 0x4fcc: 0x00cc, 0x4fcd: 0x00cc, 0x4fce: 0x00cc, 0x4fcf: 0x00cc, 0x4fd0: 0x00cc, 0x4fd1: 0x00cc, - 0x4fd2: 0x00cc, 0x4fd3: 0x00cc, 0x4fd4: 0x00cc, 0x4fd5: 0x00cc, 0x4fd6: 0x00cc, 0x4fd7: 0x00cc, - 0x4fd8: 0x00cc, 0x4fd9: 0x00cc, 0x4fda: 0x00cc, 0x4fdb: 0x00cc, 0x4fdc: 0x00cc, 0x4fdd: 0x00cc, - 0x4fde: 0x00cc, 0x4fdf: 0x00cc, 0x4fe0: 0x00cc, 0x4fe1: 0x00cc, - // Block 0x140, offset 0x5000 - 0x5000: 0x008c, 0x5001: 0x008c, 0x5002: 0x008c, 0x5003: 0x008c, 0x5004: 0x008c, 0x5005: 0x008c, - 0x5006: 0x008c, 0x5007: 0x008c, 0x5008: 0x008c, 0x5009: 0x008c, 0x500a: 0x008c, 0x500b: 0x008c, - 0x500c: 0x008c, 0x500d: 0x008c, 0x500e: 0x008c, 0x500f: 0x008c, 0x5010: 0x008c, 0x5011: 0x008c, - 0x5012: 0x008c, 0x5013: 0x008c, 0x5014: 0x008c, 0x5015: 0x008c, 0x5016: 0x008c, 0x5017: 0x008c, - 0x5018: 0x008c, 0x5019: 0x008c, 0x501a: 0x008c, 0x501b: 0x008c, 0x501c: 0x008c, 0x501d: 0x008c, - // Block 0x141, offset 0x5040 - 0x5041: 0x0040, - 0x5060: 0x0040, 0x5061: 0x0040, 0x5062: 0x0040, 0x5063: 0x0040, - 0x5064: 0x0040, 0x5065: 0x0040, 0x5066: 0x0040, 0x5067: 0x0040, 0x5068: 0x0040, 0x5069: 0x0040, - 0x506a: 0x0040, 0x506b: 0x0040, 0x506c: 0x0040, 0x506d: 0x0040, 0x506e: 0x0040, 0x506f: 0x0040, - 0x5070: 0x0040, 0x5071: 0x0040, 0x5072: 0x0040, 0x5073: 0x0040, 0x5074: 0x0040, 0x5075: 0x0040, - 0x5076: 0x0040, 0x5077: 0x0040, 0x5078: 0x0040, 0x5079: 0x0040, 0x507a: 0x0040, 0x507b: 0x0040, - 0x507c: 0x0040, 0x507d: 0x0040, 0x507e: 0x0040, 0x507f: 0x0040, - // Block 0x142, offset 0x5080 - 0x5080: 0x0040, 0x5081: 0x0040, 0x5082: 0x0040, 0x5083: 0x0040, 0x5084: 0x0040, 0x5085: 0x0040, - 0x5086: 0x0040, 0x5087: 0x0040, 0x5088: 0x0040, 0x5089: 0x0040, 0x508a: 0x0040, 0x508b: 0x0040, - 0x508c: 0x0040, 0x508d: 0x0040, 0x508e: 0x0040, 0x508f: 0x0040, 0x5090: 0x0040, 0x5091: 0x0040, - 0x5092: 0x0040, 0x5093: 0x0040, 0x5094: 0x0040, 0x5095: 0x0040, 0x5096: 0x0040, 0x5097: 0x0040, - 0x5098: 0x0040, 0x5099: 0x0040, 0x509a: 0x0040, 0x509b: 0x0040, 0x509c: 0x0040, 0x509d: 0x0040, - 0x509e: 0x0040, 0x509f: 0x0040, 0x50a0: 0x0040, 0x50a1: 0x0040, 0x50a2: 0x0040, 0x50a3: 0x0040, - 0x50a4: 0x0040, 0x50a5: 0x0040, 0x50a6: 0x0040, 0x50a7: 0x0040, 0x50a8: 0x0040, 0x50a9: 0x0040, - 0x50aa: 0x0040, 0x50ab: 0x0040, 0x50ac: 0x0040, 0x50ad: 0x0040, 0x50ae: 0x0040, 0x50af: 0x0040, - // Block 0x143, offset 0x50c0 - 0x50c0: 0x0040, 0x50c1: 0x0040, 0x50c2: 0x0040, 0x50c3: 0x0040, 0x50c4: 0x0040, 0x50c5: 0x0040, - 0x50c6: 0x0040, 0x50c7: 0x0040, 0x50c8: 0x0040, 0x50c9: 0x0040, 0x50ca: 0x0040, 0x50cb: 0x0040, - 0x50cc: 0x0040, 0x50cd: 0x0040, 0x50ce: 0x0040, 0x50cf: 0x0040, 0x50d0: 0x0040, 0x50d1: 0x0040, - 0x50d2: 0x0040, 0x50d3: 0x0040, 0x50d4: 0x0040, 0x50d5: 0x0040, 0x50d6: 0x0040, 0x50d7: 0x0040, - 0x50d8: 0x0040, 0x50d9: 0x0040, 0x50da: 0x0040, 0x50db: 0x0040, 0x50dc: 0x0040, 0x50dd: 0x0040, - 0x50de: 0x0040, 0x50df: 0x0040, 0x50e0: 0x0040, 0x50e1: 0x0040, 0x50e2: 0x0040, 0x50e3: 0x0040, - 0x50e4: 0x0040, 0x50e5: 0x0040, 0x50e6: 0x0040, 0x50e7: 0x0040, 0x50e8: 0x0040, 0x50e9: 0x0040, - 0x50ea: 0x0040, 0x50eb: 0x0040, 0x50ec: 0x0040, 0x50ed: 0x0040, 0x50ee: 0x0040, 0x50ef: 0x0040, - 0x50f0: 0x0040, 0x50f1: 0x0040, 0x50f2: 0x0040, 0x50f3: 0x0040, 0x50f4: 0x0040, 0x50f5: 0x0040, - 0x50f6: 0x0040, 0x50f7: 0x0040, 0x50f8: 0x0040, 0x50f9: 0x0040, 0x50fa: 0x0040, 0x50fb: 0x0040, - 0x50fc: 0x0040, 0x50fd: 0x0040, -} - -// derivedPropertiesIndex: 36 blocks, 2304 entries, 4608 bytes -// Block 0 is the zero block. -var derivedPropertiesIndex = [2304]uint16{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc6: 0x05, 0xc7: 0x06, - 0xc8: 0x05, 0xc9: 0x05, 0xca: 0x07, 0xcb: 0x08, 0xcc: 0x09, 0xcd: 0x0a, 0xce: 0x0b, 0xcf: 0x0c, - 0xd0: 0x05, 0xd1: 0x05, 0xd2: 0x0d, 0xd3: 0x05, 0xd4: 0x0e, 0xd5: 0x0f, 0xd6: 0x10, 0xd7: 0x11, - 0xd8: 0x12, 0xd9: 0x13, 0xda: 0x14, 0xdb: 0x15, 0xdc: 0x16, 0xdd: 0x17, 0xde: 0x18, 0xdf: 0x19, - 0xe0: 0x02, 0xe1: 0x03, 0xe2: 0x04, 0xe3: 0x05, 0xe4: 0x06, 0xe5: 0x07, 0xe6: 0x07, 0xe7: 0x07, - 0xe8: 0x07, 0xe9: 0x08, 0xea: 0x09, 0xeb: 0x0a, 0xec: 0x0a, 0xed: 0x0b, 0xee: 0x0c, 0xef: 0x0d, - 0xf0: 0x1d, 0xf3: 0x20, 0xf4: 0x21, - // Block 0x4, offset 0x100 - 0x120: 0x1a, 0x121: 0x1b, 0x122: 0x1c, 0x123: 0x1d, 0x124: 0x1e, 0x125: 0x1f, 0x126: 0x20, 0x127: 0x21, - 0x128: 0x22, 0x129: 0x23, 0x12a: 0x24, 0x12b: 0x25, 0x12c: 0x26, 0x12d: 0x27, 0x12e: 0x28, 0x12f: 0x29, - 0x130: 0x2a, 0x131: 0x2b, 0x132: 0x2c, 0x133: 0x2d, 0x134: 0x2e, 0x135: 0x2f, 0x136: 0x30, 0x137: 0x31, - 0x138: 0x32, 0x139: 0x33, 0x13a: 0x34, 0x13b: 0x35, 0x13c: 0x36, 0x13d: 0x37, 0x13e: 0x38, 0x13f: 0x39, - // Block 0x5, offset 0x140 - 0x140: 0x3a, 0x141: 0x3b, 0x142: 0x3c, 0x143: 0x3d, 0x144: 0x3e, 0x145: 0x3e, 0x146: 0x3e, 0x147: 0x3e, - 0x148: 0x05, 0x149: 0x3f, 0x14a: 0x40, 0x14b: 0x41, 0x14c: 0x42, 0x14d: 0x43, 0x14e: 0x44, 0x14f: 0x45, - 0x150: 0x46, 0x151: 0x05, 0x152: 0x05, 0x153: 0x05, 0x154: 0x05, 0x155: 0x05, 0x156: 0x05, 0x157: 0x05, - 0x158: 0x05, 0x159: 0x47, 0x15a: 0x48, 0x15b: 0x49, 0x15c: 0x4a, 0x15d: 0x4b, 0x15e: 0x4c, 0x15f: 0x4d, - 0x160: 0x4e, 0x161: 0x4f, 0x162: 0x50, 0x163: 0x51, 0x164: 0x52, 0x165: 0x53, 0x166: 0x54, 0x167: 0x55, - 0x168: 0x56, 0x169: 0x57, 0x16a: 0x58, 0x16c: 0x59, 0x16d: 0x5a, 0x16e: 0x5b, 0x16f: 0x5c, - 0x170: 0x5d, 0x171: 0x5e, 0x172: 0x5f, 0x173: 0x60, 0x174: 0x61, 0x175: 0x62, 0x176: 0x63, 0x177: 0x64, - 0x178: 0x05, 0x179: 0x05, 0x17a: 0x65, 0x17b: 0x05, 0x17c: 0x66, 0x17d: 0x67, 0x17e: 0x68, 0x17f: 0x69, - // Block 0x6, offset 0x180 - 0x180: 0x6a, 0x181: 0x6b, 0x182: 0x6c, 0x183: 0x6d, 0x184: 0x6e, 0x185: 0x6f, 0x186: 0x70, 0x187: 0x71, - 0x188: 0x71, 0x189: 0x71, 0x18a: 0x71, 0x18b: 0x71, 0x18c: 0x71, 0x18d: 0x71, 0x18e: 0x71, 0x18f: 0x72, - 0x190: 0x73, 0x191: 0x74, 0x192: 0x71, 0x193: 0x71, 0x194: 0x71, 0x195: 0x71, 0x196: 0x71, 0x197: 0x71, - 0x198: 0x71, 0x199: 0x71, 0x19a: 0x71, 0x19b: 0x71, 0x19c: 0x71, 0x19d: 0x71, 0x19e: 0x71, 0x19f: 0x71, - 0x1a0: 0x71, 0x1a1: 0x71, 0x1a2: 0x71, 0x1a3: 0x71, 0x1a4: 0x71, 0x1a5: 0x71, 0x1a6: 0x71, 0x1a7: 0x71, - 0x1a8: 0x71, 0x1a9: 0x71, 0x1aa: 0x71, 0x1ab: 0x71, 0x1ac: 0x71, 0x1ad: 0x75, 0x1ae: 0x76, 0x1af: 0x77, - 0x1b0: 0x78, 0x1b1: 0x79, 0x1b2: 0x05, 0x1b3: 0x7a, 0x1b4: 0x7b, 0x1b5: 0x7c, 0x1b6: 0x7d, 0x1b7: 0x7e, - 0x1b8: 0x7f, 0x1b9: 0x80, 0x1ba: 0x81, 0x1bb: 0x82, 0x1bc: 0x83, 0x1bd: 0x83, 0x1be: 0x83, 0x1bf: 0x84, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x85, 0x1c1: 0x86, 0x1c2: 0x87, 0x1c3: 0x88, 0x1c4: 0x89, 0x1c5: 0x8a, 0x1c6: 0x8b, 0x1c7: 0x8c, - 0x1c8: 0x8d, 0x1c9: 0x71, 0x1ca: 0x71, 0x1cb: 0x8e, 0x1cc: 0x83, 0x1cd: 0x8f, 0x1ce: 0x71, 0x1cf: 0x71, - 0x1d0: 0x90, 0x1d1: 0x90, 0x1d2: 0x90, 0x1d3: 0x90, 0x1d4: 0x90, 0x1d5: 0x90, 0x1d6: 0x90, 0x1d7: 0x90, - 0x1d8: 0x90, 0x1d9: 0x90, 0x1da: 0x90, 0x1db: 0x90, 0x1dc: 0x90, 0x1dd: 0x90, 0x1de: 0x90, 0x1df: 0x90, - 0x1e0: 0x90, 0x1e1: 0x90, 0x1e2: 0x90, 0x1e3: 0x90, 0x1e4: 0x90, 0x1e5: 0x90, 0x1e6: 0x90, 0x1e7: 0x90, - 0x1e8: 0x90, 0x1e9: 0x90, 0x1ea: 0x90, 0x1eb: 0x90, 0x1ec: 0x90, 0x1ed: 0x90, 0x1ee: 0x90, 0x1ef: 0x90, - 0x1f0: 0x90, 0x1f1: 0x90, 0x1f2: 0x90, 0x1f3: 0x90, 0x1f4: 0x90, 0x1f5: 0x90, 0x1f6: 0x90, 0x1f7: 0x90, - 0x1f8: 0x90, 0x1f9: 0x90, 0x1fa: 0x90, 0x1fb: 0x90, 0x1fc: 0x90, 0x1fd: 0x90, 0x1fe: 0x90, 0x1ff: 0x90, - // Block 0x8, offset 0x200 - 0x200: 0x90, 0x201: 0x90, 0x202: 0x90, 0x203: 0x90, 0x204: 0x90, 0x205: 0x90, 0x206: 0x90, 0x207: 0x90, - 0x208: 0x90, 0x209: 0x90, 0x20a: 0x90, 0x20b: 0x90, 0x20c: 0x90, 0x20d: 0x90, 0x20e: 0x90, 0x20f: 0x90, - 0x210: 0x90, 0x211: 0x90, 0x212: 0x90, 0x213: 0x90, 0x214: 0x90, 0x215: 0x90, 0x216: 0x90, 0x217: 0x90, - 0x218: 0x90, 0x219: 0x90, 0x21a: 0x90, 0x21b: 0x90, 0x21c: 0x90, 0x21d: 0x90, 0x21e: 0x90, 0x21f: 0x90, - 0x220: 0x90, 0x221: 0x90, 0x222: 0x90, 0x223: 0x90, 0x224: 0x90, 0x225: 0x90, 0x226: 0x90, 0x227: 0x90, - 0x228: 0x90, 0x229: 0x90, 0x22a: 0x90, 0x22b: 0x90, 0x22c: 0x90, 0x22d: 0x90, 0x22e: 0x90, 0x22f: 0x90, - 0x230: 0x90, 0x231: 0x90, 0x232: 0x90, 0x233: 0x90, 0x234: 0x90, 0x235: 0x90, 0x236: 0x91, 0x237: 0x71, - 0x238: 0x90, 0x239: 0x90, 0x23a: 0x90, 0x23b: 0x90, 0x23c: 0x90, 0x23d: 0x90, 0x23e: 0x90, 0x23f: 0x90, - // Block 0x9, offset 0x240 - 0x240: 0x90, 0x241: 0x90, 0x242: 0x90, 0x243: 0x90, 0x244: 0x90, 0x245: 0x90, 0x246: 0x90, 0x247: 0x90, - 0x248: 0x90, 0x249: 0x90, 0x24a: 0x90, 0x24b: 0x90, 0x24c: 0x90, 0x24d: 0x90, 0x24e: 0x90, 0x24f: 0x90, - 0x250: 0x90, 0x251: 0x90, 0x252: 0x90, 0x253: 0x90, 0x254: 0x90, 0x255: 0x90, 0x256: 0x90, 0x257: 0x90, - 0x258: 0x90, 0x259: 0x90, 0x25a: 0x90, 0x25b: 0x90, 0x25c: 0x90, 0x25d: 0x90, 0x25e: 0x90, 0x25f: 0x90, - 0x260: 0x90, 0x261: 0x90, 0x262: 0x90, 0x263: 0x90, 0x264: 0x90, 0x265: 0x90, 0x266: 0x90, 0x267: 0x90, - 0x268: 0x90, 0x269: 0x90, 0x26a: 0x90, 0x26b: 0x90, 0x26c: 0x90, 0x26d: 0x90, 0x26e: 0x90, 0x26f: 0x90, - 0x270: 0x90, 0x271: 0x90, 0x272: 0x90, 0x273: 0x90, 0x274: 0x90, 0x275: 0x90, 0x276: 0x90, 0x277: 0x90, - 0x278: 0x90, 0x279: 0x90, 0x27a: 0x90, 0x27b: 0x90, 0x27c: 0x90, 0x27d: 0x90, 0x27e: 0x90, 0x27f: 0x90, - // Block 0xa, offset 0x280 - 0x280: 0x90, 0x281: 0x90, 0x282: 0x90, 0x283: 0x90, 0x284: 0x90, 0x285: 0x90, 0x286: 0x90, 0x287: 0x90, - 0x288: 0x90, 0x289: 0x90, 0x28a: 0x90, 0x28b: 0x90, 0x28c: 0x90, 0x28d: 0x90, 0x28e: 0x90, 0x28f: 0x90, - 0x290: 0x90, 0x291: 0x90, 0x292: 0x90, 0x293: 0x90, 0x294: 0x90, 0x295: 0x90, 0x296: 0x90, 0x297: 0x90, - 0x298: 0x90, 0x299: 0x90, 0x29a: 0x90, 0x29b: 0x90, 0x29c: 0x90, 0x29d: 0x90, 0x29e: 0x90, 0x29f: 0x90, - 0x2a0: 0x90, 0x2a1: 0x90, 0x2a2: 0x90, 0x2a3: 0x90, 0x2a4: 0x90, 0x2a5: 0x90, 0x2a6: 0x90, 0x2a7: 0x90, - 0x2a8: 0x90, 0x2a9: 0x90, 0x2aa: 0x90, 0x2ab: 0x90, 0x2ac: 0x90, 0x2ad: 0x90, 0x2ae: 0x90, 0x2af: 0x90, - 0x2b0: 0x90, 0x2b1: 0x90, 0x2b2: 0x90, 0x2b3: 0x90, 0x2b4: 0x90, 0x2b5: 0x90, 0x2b6: 0x90, 0x2b7: 0x90, - 0x2b8: 0x90, 0x2b9: 0x90, 0x2ba: 0x90, 0x2bb: 0x90, 0x2bc: 0x90, 0x2bd: 0x90, 0x2be: 0x90, 0x2bf: 0x92, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x05, 0x2c1: 0x05, 0x2c2: 0x05, 0x2c3: 0x05, 0x2c4: 0x05, 0x2c5: 0x05, 0x2c6: 0x05, 0x2c7: 0x05, - 0x2c8: 0x05, 0x2c9: 0x05, 0x2ca: 0x05, 0x2cb: 0x05, 0x2cc: 0x05, 0x2cd: 0x05, 0x2ce: 0x05, 0x2cf: 0x05, - 0x2d0: 0x05, 0x2d1: 0x05, 0x2d2: 0x93, 0x2d3: 0x94, 0x2d4: 0x05, 0x2d5: 0x05, 0x2d6: 0x05, 0x2d7: 0x05, - 0x2d8: 0x95, 0x2d9: 0x96, 0x2da: 0x97, 0x2db: 0x98, 0x2dc: 0x99, 0x2dd: 0x9a, 0x2de: 0x9b, 0x2df: 0x9c, - 0x2e0: 0x9d, 0x2e1: 0x9e, 0x2e2: 0x05, 0x2e3: 0x9f, 0x2e4: 0xa0, 0x2e5: 0xa1, 0x2e6: 0xa2, 0x2e7: 0xa3, - 0x2e8: 0xa4, 0x2e9: 0xa5, 0x2ea: 0xa6, 0x2eb: 0xa7, 0x2ec: 0xa8, 0x2ed: 0xa9, 0x2ee: 0x05, 0x2ef: 0xaa, - 0x2f0: 0x05, 0x2f1: 0x05, 0x2f2: 0x05, 0x2f3: 0x05, 0x2f4: 0x05, 0x2f5: 0x05, 0x2f6: 0x05, 0x2f7: 0x05, - 0x2f8: 0x05, 0x2f9: 0x05, 0x2fa: 0x05, 0x2fb: 0x05, 0x2fc: 0x05, 0x2fd: 0x05, 0x2fe: 0x05, 0x2ff: 0x05, - // Block 0xc, offset 0x300 - 0x300: 0x05, 0x301: 0x05, 0x302: 0x05, 0x303: 0x05, 0x304: 0x05, 0x305: 0x05, 0x306: 0x05, 0x307: 0x05, - 0x308: 0x05, 0x309: 0x05, 0x30a: 0x05, 0x30b: 0x05, 0x30c: 0x05, 0x30d: 0x05, 0x30e: 0x05, 0x30f: 0x05, - 0x310: 0x05, 0x311: 0x05, 0x312: 0x05, 0x313: 0x05, 0x314: 0x05, 0x315: 0x05, 0x316: 0x05, 0x317: 0x05, - 0x318: 0x05, 0x319: 0x05, 0x31a: 0x05, 0x31b: 0x05, 0x31c: 0x05, 0x31d: 0x05, 0x31e: 0x05, 0x31f: 0x05, - 0x320: 0x05, 0x321: 0x05, 0x322: 0x05, 0x323: 0x05, 0x324: 0x05, 0x325: 0x05, 0x326: 0x05, 0x327: 0x05, - 0x328: 0x05, 0x329: 0x05, 0x32a: 0x05, 0x32b: 0x05, 0x32c: 0x05, 0x32d: 0x05, 0x32e: 0x05, 0x32f: 0x05, - 0x330: 0x05, 0x331: 0x05, 0x332: 0x05, 0x333: 0x05, 0x334: 0x05, 0x335: 0x05, 0x336: 0x05, 0x337: 0x05, - 0x338: 0x05, 0x339: 0x05, 0x33a: 0x05, 0x33b: 0x05, 0x33c: 0x05, 0x33d: 0x05, 0x33e: 0x05, 0x33f: 0x05, - // Block 0xd, offset 0x340 - 0x340: 0x05, 0x341: 0x05, 0x342: 0x05, 0x343: 0x05, 0x344: 0x05, 0x345: 0x05, 0x346: 0x05, 0x347: 0x05, - 0x348: 0x05, 0x349: 0x05, 0x34a: 0x05, 0x34b: 0x05, 0x34c: 0x05, 0x34d: 0x05, 0x34e: 0x05, 0x34f: 0x05, - 0x350: 0x05, 0x351: 0x05, 0x352: 0x05, 0x353: 0x05, 0x354: 0x05, 0x355: 0x05, 0x356: 0x05, 0x357: 0x05, - 0x358: 0x05, 0x359: 0x05, 0x35a: 0x05, 0x35b: 0x05, 0x35c: 0x05, 0x35d: 0x05, 0x35e: 0xab, 0x35f: 0xac, - // Block 0xe, offset 0x380 - 0x380: 0x3e, 0x381: 0x3e, 0x382: 0x3e, 0x383: 0x3e, 0x384: 0x3e, 0x385: 0x3e, 0x386: 0x3e, 0x387: 0x3e, - 0x388: 0x3e, 0x389: 0x3e, 0x38a: 0x3e, 0x38b: 0x3e, 0x38c: 0x3e, 0x38d: 0x3e, 0x38e: 0x3e, 0x38f: 0x3e, - 0x390: 0x3e, 0x391: 0x3e, 0x392: 0x3e, 0x393: 0x3e, 0x394: 0x3e, 0x395: 0x3e, 0x396: 0x3e, 0x397: 0x3e, - 0x398: 0x3e, 0x399: 0x3e, 0x39a: 0x3e, 0x39b: 0x3e, 0x39c: 0x3e, 0x39d: 0x3e, 0x39e: 0x3e, 0x39f: 0x3e, - 0x3a0: 0x3e, 0x3a1: 0x3e, 0x3a2: 0x3e, 0x3a3: 0x3e, 0x3a4: 0x3e, 0x3a5: 0x3e, 0x3a6: 0x3e, 0x3a7: 0x3e, - 0x3a8: 0x3e, 0x3a9: 0x3e, 0x3aa: 0x3e, 0x3ab: 0x3e, 0x3ac: 0x3e, 0x3ad: 0x3e, 0x3ae: 0x3e, 0x3af: 0x3e, - 0x3b0: 0x3e, 0x3b1: 0x3e, 0x3b2: 0x3e, 0x3b3: 0x3e, 0x3b4: 0x3e, 0x3b5: 0x3e, 0x3b6: 0x3e, 0x3b7: 0x3e, - 0x3b8: 0x3e, 0x3b9: 0x3e, 0x3ba: 0x3e, 0x3bb: 0x3e, 0x3bc: 0x3e, 0x3bd: 0x3e, 0x3be: 0x3e, 0x3bf: 0x3e, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x3e, 0x3c1: 0x3e, 0x3c2: 0x3e, 0x3c3: 0x3e, 0x3c4: 0x3e, 0x3c5: 0x3e, 0x3c6: 0x3e, 0x3c7: 0x3e, - 0x3c8: 0x3e, 0x3c9: 0x3e, 0x3ca: 0x3e, 0x3cb: 0x3e, 0x3cc: 0x3e, 0x3cd: 0x3e, 0x3ce: 0x3e, 0x3cf: 0x3e, - 0x3d0: 0x3e, 0x3d1: 0x3e, 0x3d2: 0x3e, 0x3d3: 0x3e, 0x3d4: 0x3e, 0x3d5: 0x3e, 0x3d6: 0x3e, 0x3d7: 0x3e, - 0x3d8: 0x3e, 0x3d9: 0x3e, 0x3da: 0x3e, 0x3db: 0x3e, 0x3dc: 0x3e, 0x3dd: 0x3e, 0x3de: 0x3e, 0x3df: 0x3e, - 0x3e0: 0x3e, 0x3e1: 0x3e, 0x3e2: 0x3e, 0x3e3: 0x3e, 0x3e4: 0x83, 0x3e5: 0x83, 0x3e6: 0x83, 0x3e7: 0x83, - 0x3e8: 0xad, 0x3e9: 0xae, 0x3ea: 0x83, 0x3eb: 0xaf, 0x3ec: 0xb0, 0x3ed: 0xb1, 0x3ee: 0x71, 0x3ef: 0xb2, - 0x3f0: 0x71, 0x3f1: 0x71, 0x3f2: 0x71, 0x3f3: 0x71, 0x3f4: 0x71, 0x3f5: 0xb3, 0x3f6: 0xb4, 0x3f7: 0xb5, - 0x3f8: 0xb6, 0x3f9: 0xb7, 0x3fa: 0x71, 0x3fb: 0xb8, 0x3fc: 0xb9, 0x3fd: 0xba, 0x3fe: 0xbb, 0x3ff: 0xbc, - // Block 0x10, offset 0x400 - 0x400: 0xbd, 0x401: 0xbe, 0x402: 0x05, 0x403: 0xbf, 0x404: 0xc0, 0x405: 0xc1, 0x406: 0xc2, 0x407: 0xc3, - 0x40a: 0xc4, 0x40b: 0xc5, 0x40c: 0xc6, 0x40d: 0xc7, 0x40e: 0xc8, 0x40f: 0xc9, - 0x410: 0x05, 0x411: 0x05, 0x412: 0xca, 0x413: 0xcb, 0x414: 0xcc, 0x415: 0xcd, - 0x418: 0x05, 0x419: 0x05, 0x41a: 0x05, 0x41b: 0x05, 0x41c: 0xce, 0x41d: 0xcf, - 0x420: 0xd0, 0x421: 0xd1, 0x422: 0xd2, 0x423: 0xd3, 0x424: 0xd4, 0x426: 0xd5, 0x427: 0xb4, - 0x428: 0xd6, 0x429: 0xd7, 0x42a: 0xd8, 0x42b: 0xd9, 0x42c: 0xda, 0x42d: 0xdb, 0x42e: 0xdc, - 0x430: 0x05, 0x431: 0x5f, 0x432: 0xdd, 0x433: 0xde, - 0x439: 0xdf, - // Block 0x11, offset 0x440 - 0x440: 0xe0, 0x441: 0xe1, 0x442: 0xe2, 0x443: 0xe3, 0x444: 0xe4, 0x445: 0xe5, 0x446: 0xe6, 0x447: 0xe7, - 0x448: 0xe8, 0x44a: 0xe9, 0x44b: 0xea, 0x44c: 0xeb, 0x44d: 0xec, - 0x450: 0xed, 0x451: 0xee, 0x452: 0xef, 0x453: 0xf0, 0x456: 0xf1, 0x457: 0xf2, - 0x458: 0xf3, 0x459: 0xf4, 0x45a: 0xf5, 0x45b: 0xf6, 0x45c: 0xf7, - 0x462: 0xf8, 0x463: 0xf9, - 0x46b: 0xfa, - 0x470: 0xfb, 0x471: 0xfc, 0x472: 0xfd, - // Block 0x12, offset 0x480 - 0x480: 0x05, 0x481: 0x05, 0x482: 0x05, 0x483: 0x05, 0x484: 0x05, 0x485: 0x05, 0x486: 0x05, 0x487: 0x05, - 0x488: 0x05, 0x489: 0x05, 0x48a: 0x05, 0x48b: 0x05, 0x48c: 0x05, 0x48d: 0x05, 0x48e: 0xfe, - 0x490: 0x71, 0x491: 0xff, 0x492: 0x05, 0x493: 0x05, 0x494: 0x05, 0x495: 0x100, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x05, 0x4c1: 0x05, 0x4c2: 0x05, 0x4c3: 0x05, 0x4c4: 0x05, 0x4c5: 0x05, 0x4c6: 0x05, 0x4c7: 0x05, - 0x4c8: 0x05, 0x4c9: 0x05, 0x4ca: 0x05, 0x4cb: 0x05, 0x4cc: 0x05, 0x4cd: 0x05, 0x4ce: 0x05, 0x4cf: 0x05, - 0x4d0: 0x101, - // Block 0x14, offset 0x500 - 0x510: 0x05, 0x511: 0x05, 0x512: 0x05, 0x513: 0x05, 0x514: 0x05, 0x515: 0x05, 0x516: 0x05, 0x517: 0x05, - 0x518: 0x05, 0x519: 0x102, - // Block 0x15, offset 0x540 - 0x560: 0x05, 0x561: 0x05, 0x562: 0x05, 0x563: 0x05, 0x564: 0x05, 0x565: 0x05, 0x566: 0x05, 0x567: 0x05, - 0x568: 0xfa, 0x569: 0x103, 0x56b: 0x104, 0x56c: 0x105, 0x56d: 0x106, 0x56e: 0x107, - 0x57c: 0x05, 0x57d: 0x108, 0x57e: 0x109, 0x57f: 0x10a, - // Block 0x16, offset 0x580 - 0x580: 0x05, 0x581: 0x05, 0x582: 0x05, 0x583: 0x05, 0x584: 0x05, 0x585: 0x05, 0x586: 0x05, 0x587: 0x05, - 0x588: 0x05, 0x589: 0x05, 0x58a: 0x05, 0x58b: 0x05, 0x58c: 0x05, 0x58d: 0x05, 0x58e: 0x05, 0x58f: 0x05, - 0x590: 0x05, 0x591: 0x05, 0x592: 0x05, 0x593: 0x05, 0x594: 0x05, 0x595: 0x05, 0x596: 0x05, 0x597: 0x05, - 0x598: 0x05, 0x599: 0x05, 0x59a: 0x05, 0x59b: 0x05, 0x59c: 0x05, 0x59d: 0x05, 0x59e: 0x05, 0x59f: 0x10b, - 0x5a0: 0x05, 0x5a1: 0x05, 0x5a2: 0x05, 0x5a3: 0x05, 0x5a4: 0x05, 0x5a5: 0x05, 0x5a6: 0x05, 0x5a7: 0x05, - 0x5a8: 0x05, 0x5a9: 0x05, 0x5aa: 0x05, 0x5ab: 0xdd, - // Block 0x17, offset 0x5c0 - 0x5c0: 0x10c, - 0x5f0: 0x05, 0x5f1: 0x10d, 0x5f2: 0x10e, - // Block 0x18, offset 0x600 - 0x600: 0x71, 0x601: 0x71, 0x602: 0x71, 0x603: 0x10f, 0x604: 0x110, 0x605: 0x111, 0x606: 0x112, 0x607: 0x113, - 0x608: 0xc1, 0x609: 0x114, 0x60c: 0x71, 0x60d: 0x115, - 0x610: 0x71, 0x611: 0x116, 0x612: 0x117, 0x613: 0x118, 0x614: 0x119, 0x615: 0x11a, 0x616: 0x71, 0x617: 0x71, - 0x618: 0x71, 0x619: 0x71, 0x61a: 0x11b, 0x61b: 0x71, 0x61c: 0x71, 0x61d: 0x71, 0x61e: 0x71, 0x61f: 0x11c, - 0x620: 0x71, 0x621: 0x71, 0x622: 0x71, 0x623: 0x71, 0x624: 0x71, 0x625: 0x71, 0x626: 0x71, 0x627: 0x71, - 0x628: 0x11d, 0x629: 0x11e, 0x62a: 0x11f, - // Block 0x19, offset 0x640 - 0x640: 0x120, - 0x660: 0x05, 0x661: 0x05, 0x662: 0x05, 0x663: 0x121, 0x664: 0x122, 0x665: 0x123, - 0x678: 0x124, 0x679: 0x125, 0x67a: 0x126, 0x67b: 0x127, - // Block 0x1a, offset 0x680 - 0x680: 0x128, 0x681: 0x71, 0x682: 0x129, 0x683: 0x12a, 0x684: 0x12b, 0x685: 0x128, 0x686: 0x12c, 0x687: 0x12d, - 0x688: 0x12e, 0x689: 0x12f, 0x68c: 0x71, 0x68d: 0x71, 0x68e: 0x71, 0x68f: 0x71, - 0x690: 0x71, 0x691: 0x71, 0x692: 0x71, 0x693: 0x71, 0x694: 0x71, 0x695: 0x71, 0x696: 0x71, 0x697: 0x71, - 0x698: 0x71, 0x699: 0x71, 0x69a: 0x71, 0x69b: 0x130, 0x69c: 0x71, 0x69d: 0x131, 0x69e: 0x71, 0x69f: 0x132, - 0x6a0: 0x133, 0x6a1: 0x134, 0x6a2: 0x135, 0x6a4: 0x136, 0x6a5: 0x137, 0x6a6: 0x138, 0x6a7: 0x139, - // Block 0x1b, offset 0x6c0 - 0x6c0: 0x90, 0x6c1: 0x90, 0x6c2: 0x90, 0x6c3: 0x90, 0x6c4: 0x90, 0x6c5: 0x90, 0x6c6: 0x90, 0x6c7: 0x90, - 0x6c8: 0x90, 0x6c9: 0x90, 0x6ca: 0x90, 0x6cb: 0x90, 0x6cc: 0x90, 0x6cd: 0x90, 0x6ce: 0x90, 0x6cf: 0x90, - 0x6d0: 0x90, 0x6d1: 0x90, 0x6d2: 0x90, 0x6d3: 0x90, 0x6d4: 0x90, 0x6d5: 0x90, 0x6d6: 0x90, 0x6d7: 0x90, - 0x6d8: 0x90, 0x6d9: 0x90, 0x6da: 0x90, 0x6db: 0x13a, 0x6dc: 0x90, 0x6dd: 0x90, 0x6de: 0x90, 0x6df: 0x90, - 0x6e0: 0x90, 0x6e1: 0x90, 0x6e2: 0x90, 0x6e3: 0x90, 0x6e4: 0x90, 0x6e5: 0x90, 0x6e6: 0x90, 0x6e7: 0x90, - 0x6e8: 0x90, 0x6e9: 0x90, 0x6ea: 0x90, 0x6eb: 0x90, 0x6ec: 0x90, 0x6ed: 0x90, 0x6ee: 0x90, 0x6ef: 0x90, - 0x6f0: 0x90, 0x6f1: 0x90, 0x6f2: 0x90, 0x6f3: 0x90, 0x6f4: 0x90, 0x6f5: 0x90, 0x6f6: 0x90, 0x6f7: 0x90, - 0x6f8: 0x90, 0x6f9: 0x90, 0x6fa: 0x90, 0x6fb: 0x90, 0x6fc: 0x90, 0x6fd: 0x90, 0x6fe: 0x90, 0x6ff: 0x90, - // Block 0x1c, offset 0x700 - 0x700: 0x90, 0x701: 0x90, 0x702: 0x90, 0x703: 0x90, 0x704: 0x90, 0x705: 0x90, 0x706: 0x90, 0x707: 0x90, - 0x708: 0x90, 0x709: 0x90, 0x70a: 0x90, 0x70b: 0x90, 0x70c: 0x90, 0x70d: 0x90, 0x70e: 0x90, 0x70f: 0x90, - 0x710: 0x90, 0x711: 0x90, 0x712: 0x90, 0x713: 0x90, 0x714: 0x90, 0x715: 0x90, 0x716: 0x90, 0x717: 0x90, - 0x718: 0x90, 0x719: 0x90, 0x71a: 0x90, 0x71b: 0x90, 0x71c: 0x13b, 0x71d: 0x90, 0x71e: 0x90, 0x71f: 0x90, - 0x720: 0x13c, 0x721: 0x90, 0x722: 0x90, 0x723: 0x90, 0x724: 0x90, 0x725: 0x90, 0x726: 0x90, 0x727: 0x90, - 0x728: 0x90, 0x729: 0x90, 0x72a: 0x90, 0x72b: 0x90, 0x72c: 0x90, 0x72d: 0x90, 0x72e: 0x90, 0x72f: 0x90, - 0x730: 0x90, 0x731: 0x90, 0x732: 0x90, 0x733: 0x90, 0x734: 0x90, 0x735: 0x90, 0x736: 0x90, 0x737: 0x90, - 0x738: 0x90, 0x739: 0x90, 0x73a: 0x90, 0x73b: 0x90, 0x73c: 0x90, 0x73d: 0x90, 0x73e: 0x90, 0x73f: 0x90, - // Block 0x1d, offset 0x740 - 0x740: 0x90, 0x741: 0x90, 0x742: 0x90, 0x743: 0x90, 0x744: 0x90, 0x745: 0x90, 0x746: 0x90, 0x747: 0x90, - 0x748: 0x90, 0x749: 0x90, 0x74a: 0x90, 0x74b: 0x90, 0x74c: 0x90, 0x74d: 0x90, 0x74e: 0x90, 0x74f: 0x90, - 0x750: 0x90, 0x751: 0x90, 0x752: 0x90, 0x753: 0x90, 0x754: 0x90, 0x755: 0x90, 0x756: 0x90, 0x757: 0x90, - 0x758: 0x90, 0x759: 0x90, 0x75a: 0x90, 0x75b: 0x90, 0x75c: 0x90, 0x75d: 0x90, 0x75e: 0x90, 0x75f: 0x90, - 0x760: 0x90, 0x761: 0x90, 0x762: 0x90, 0x763: 0x90, 0x764: 0x90, 0x765: 0x90, 0x766: 0x90, 0x767: 0x90, - 0x768: 0x90, 0x769: 0x90, 0x76a: 0x90, 0x76b: 0x90, 0x76c: 0x90, 0x76d: 0x90, 0x76e: 0x90, 0x76f: 0x90, - 0x770: 0x90, 0x771: 0x90, 0x772: 0x90, 0x773: 0x90, 0x774: 0x90, 0x775: 0x90, 0x776: 0x90, 0x777: 0x90, - 0x778: 0x90, 0x779: 0x90, 0x77a: 0x13d, - // Block 0x1e, offset 0x780 - 0x7a0: 0x83, 0x7a1: 0x83, 0x7a2: 0x83, 0x7a3: 0x83, 0x7a4: 0x83, 0x7a5: 0x83, 0x7a6: 0x83, 0x7a7: 0x83, - 0x7a8: 0x13e, - // Block 0x1f, offset 0x7c0 - 0x7d0: 0x0e, 0x7d1: 0x0f, 0x7d2: 0x10, 0x7d3: 0x11, 0x7d4: 0x12, 0x7d6: 0x13, 0x7d7: 0x0a, - 0x7d8: 0x14, 0x7db: 0x15, 0x7dd: 0x16, 0x7de: 0x17, 0x7df: 0x18, - 0x7e0: 0x07, 0x7e1: 0x07, 0x7e2: 0x07, 0x7e3: 0x07, 0x7e4: 0x07, 0x7e5: 0x07, 0x7e6: 0x07, 0x7e7: 0x07, - 0x7e8: 0x07, 0x7e9: 0x07, 0x7ea: 0x19, 0x7eb: 0x1a, 0x7ec: 0x1b, 0x7ef: 0x1c, - // Block 0x20, offset 0x800 - 0x800: 0x13f, 0x801: 0x3e, 0x804: 0x3e, 0x805: 0x3e, 0x806: 0x3e, 0x807: 0x140, - // Block 0x21, offset 0x840 - 0x840: 0x3e, 0x841: 0x3e, 0x842: 0x3e, 0x843: 0x3e, 0x844: 0x3e, 0x845: 0x3e, 0x846: 0x3e, 0x847: 0x3e, - 0x848: 0x3e, 0x849: 0x3e, 0x84a: 0x3e, 0x84b: 0x3e, 0x84c: 0x3e, 0x84d: 0x3e, 0x84e: 0x3e, 0x84f: 0x3e, - 0x850: 0x3e, 0x851: 0x3e, 0x852: 0x3e, 0x853: 0x3e, 0x854: 0x3e, 0x855: 0x3e, 0x856: 0x3e, 0x857: 0x3e, - 0x858: 0x3e, 0x859: 0x3e, 0x85a: 0x3e, 0x85b: 0x3e, 0x85c: 0x3e, 0x85d: 0x3e, 0x85e: 0x3e, 0x85f: 0x3e, - 0x860: 0x3e, 0x861: 0x3e, 0x862: 0x3e, 0x863: 0x3e, 0x864: 0x3e, 0x865: 0x3e, 0x866: 0x3e, 0x867: 0x3e, - 0x868: 0x3e, 0x869: 0x3e, 0x86a: 0x3e, 0x86b: 0x3e, 0x86c: 0x3e, 0x86d: 0x3e, 0x86e: 0x3e, 0x86f: 0x3e, - 0x870: 0x3e, 0x871: 0x3e, 0x872: 0x3e, 0x873: 0x3e, 0x874: 0x3e, 0x875: 0x3e, 0x876: 0x3e, 0x877: 0x3e, - 0x878: 0x3e, 0x879: 0x3e, 0x87a: 0x3e, 0x87b: 0x3e, 0x87c: 0x3e, 0x87d: 0x3e, 0x87e: 0x3e, 0x87f: 0x141, - // Block 0x22, offset 0x880 - 0x8a0: 0x1e, - 0x8b0: 0x0c, 0x8b1: 0x0c, 0x8b2: 0x0c, 0x8b3: 0x0c, 0x8b4: 0x0c, 0x8b5: 0x0c, 0x8b6: 0x0c, 0x8b7: 0x0c, - 0x8b8: 0x0c, 0x8b9: 0x0c, 0x8ba: 0x0c, 0x8bb: 0x0c, 0x8bc: 0x0c, 0x8bd: 0x0c, 0x8be: 0x0c, 0x8bf: 0x1f, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x0c, 0x8c1: 0x0c, 0x8c2: 0x0c, 0x8c3: 0x0c, 0x8c4: 0x0c, 0x8c5: 0x0c, 0x8c6: 0x0c, 0x8c7: 0x0c, - 0x8c8: 0x0c, 0x8c9: 0x0c, 0x8ca: 0x0c, 0x8cb: 0x0c, 0x8cc: 0x0c, 0x8cd: 0x0c, 0x8ce: 0x0c, 0x8cf: 0x1f, -} - -// Total table size 25344 bytes (24KiB); checksum: 811C9DC5 diff --git a/vendor/golang.org/x/text/secure/precis/transformer.go b/vendor/golang.org/x/text/secure/precis/transformer.go deleted file mode 100644 index 97ce5e75..00000000 --- a/vendor/golang.org/x/text/secure/precis/transformer.go +++ /dev/null @@ -1,32 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package precis - -import "golang.org/x/text/transform" - -// Transformer implements the transform.Transformer interface. -type Transformer struct { - t transform.Transformer -} - -// Reset implements the transform.Transformer interface. -func (t Transformer) Reset() { t.t.Reset() } - -// Transform implements the transform.Transformer interface. -func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return t.t.Transform(dst, src, atEOF) -} - -// Bytes returns a new byte slice with the result of applying t to b. -func (t Transformer) Bytes(b []byte) []byte { - b, _, _ = transform.Bytes(t, b) - return b -} - -// String returns a string with the result of applying t to s. -func (t Transformer) String(s string) string { - s, _, _ = transform.String(t, s) - return s -} diff --git a/vendor/golang.org/x/text/secure/precis/trieval.go b/vendor/golang.org/x/text/secure/precis/trieval.go deleted file mode 100644 index 4833f962..00000000 --- a/vendor/golang.org/x/text/secure/precis/trieval.go +++ /dev/null @@ -1,64 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package precis - -// entry is the entry of a trie table -// 7..6 property (unassigned, disallowed, maybe, valid) -// 5..0 category -type entry uint8 - -const ( - propShift = 6 - propMask = 0xc0 - catMask = 0x3f -) - -func (e entry) property() property { return property(e & propMask) } -func (e entry) category() category { return category(e & catMask) } - -type property uint8 - -// The order of these constants matter. A Profile may consider runes to be -// allowed either from pValid or idDisOrFreePVal. -const ( - unassigned property = iota << propShift - disallowed - idDisOrFreePVal // disallowed for Identifier, pValid for FreeForm - pValid -) - -// compute permutations of all properties and specialCategories. -type category uint8 - -const ( - other category = iota - - // Special rune types - joiningL - joiningD - joiningT - joiningR - viramaModifier - viramaJoinT // Virama + JoiningT - latinSmallL // U+006c - greek - greekJoinT // Greek + JoiningT - hebrew - hebrewJoinT // Hebrew + JoiningT - japanese // hirigana, katakana, han - - // Special rune types associated with contextual rules defined in - // https://tools.ietf.org/html/rfc5892#appendix-A. - // ContextO - zeroWidthNonJoiner // rule 1 - zeroWidthJoiner // rule 2 - // ContextJ - middleDot // rule 3 - greekLowerNumeralSign // rule 4 - hebrewPreceding // rule 5 and 6 - katakanaMiddleDot // rule 7 - arabicIndicDigit // rule 8 - extendedArabicIndicDigit // rule 9 - - numCategories -) diff --git a/vendor/golang.org/x/text/width/gen.go b/vendor/golang.org/x/text/width/gen.go deleted file mode 100644 index 03d9f99a..00000000 --- a/vendor/golang.org/x/text/width/gen.go +++ /dev/null @@ -1,115 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -// This program generates the trie for width operations. The generated table -// includes width category information as well as the normalization mappings. -package main - -import ( - "bytes" - "fmt" - "io" - "log" - "math" - "unicode/utf8" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/triegen" -) - -// See gen_common.go for flags. - -func main() { - gen.Init() - genTables() - genTests() - gen.Repackage("gen_trieval.go", "trieval.go", "width") - gen.Repackage("gen_common.go", "common_test.go", "width") -} - -func genTables() { - t := triegen.NewTrie("width") - // fold and inverse mappings. See mapComment for a description of the format - // of each entry. Add dummy value to make an index of 0 mean no mapping. - inverse := [][4]byte{{}} - mapping := map[[4]byte]int{[4]byte{}: 0} - - getWidthData(func(r rune, tag elem, alt rune) { - idx := 0 - if alt != 0 { - var buf [4]byte - buf[0] = byte(utf8.EncodeRune(buf[1:], alt)) - s := string(r) - buf[buf[0]] ^= s[len(s)-1] - var ok bool - if idx, ok = mapping[buf]; !ok { - idx = len(mapping) - if idx > math.MaxUint8 { - log.Fatalf("Index %d does not fit in a byte.", idx) - } - mapping[buf] = idx - inverse = append(inverse, buf) - } - } - t.Insert(r, uint64(tag|elem(idx))) - }) - - w := &bytes.Buffer{} - gen.WriteUnicodeVersion(w) - - sz, err := t.Gen(w) - if err != nil { - log.Fatal(err) - } - - sz += writeMappings(w, inverse) - - fmt.Fprintf(w, "// Total table size %d bytes (%dKiB)\n", sz, sz/1024) - - gen.WriteGoFile(*outputFile, "width", w.Bytes()) -} - -const inverseDataComment = ` -// inverseData contains 4-byte entries of the following format: -// <length> <modified UTF-8-encoded rune> <0 padding> -// The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the -// UTF-8 encoding of the original rune. Mappings often have the following -// pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... -// By xor-ing the last byte the same entry can be shared by many mappings. This -// reduces the total number of distinct entries by about two thirds. -// The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } -// Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. -// Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. -// Note that because of the xor-ing, the byte sequence stored in the entry is -// not valid UTF-8.` - -func writeMappings(w io.Writer, data [][4]byte) int { - fmt.Fprintln(w, inverseDataComment) - fmt.Fprintf(w, "var inverseData = [%d][4]byte{\n", len(data)) - for _, x := range data { - fmt.Fprintf(w, "{ 0x%02x, 0x%02x, 0x%02x, 0x%02x },\n", x[0], x[1], x[2], x[3]) - } - fmt.Fprintln(w, "}") - return len(data) * 4 -} - -func genTests() { - w := &bytes.Buffer{} - fmt.Fprintf(w, "\nvar mapRunes = map[rune]struct{r rune; e elem}{\n") - getWidthData(func(r rune, tag elem, alt rune) { - if alt != 0 { - fmt.Fprintf(w, "\t0x%X: {0x%X, 0x%X},\n", r, alt, tag) - } - }) - fmt.Fprintln(w, "}") - gen.WriteGoFile("runes_test.go", "width", w.Bytes()) -} diff --git a/vendor/golang.org/x/text/width/gen_common.go b/vendor/golang.org/x/text/width/gen_common.go deleted file mode 100644 index 601e7526..00000000 --- a/vendor/golang.org/x/text/width/gen_common.go +++ /dev/null @@ -1,96 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// This code is shared between the main code generator and the test code. - -import ( - "flag" - "log" - "strconv" - "strings" - - "golang.org/x/text/internal/gen" - "golang.org/x/text/internal/ucd" -) - -var ( - outputFile = flag.String("out", "tables.go", "output file") -) - -var typeMap = map[string]elem{ - "A": tagAmbiguous, - "N": tagNeutral, - "Na": tagNarrow, - "W": tagWide, - "F": tagFullwidth, - "H": tagHalfwidth, -} - -// getWidthData calls f for every entry for which it is defined. -// -// f may be called multiple times for the same rune. The last call to f is the -// correct value. f is not called for all runes. The default tag type is -// Neutral. -func getWidthData(f func(r rune, tag elem, alt rune)) { - // Set the default values for Unified Ideographs. In line with Annex 11, - // we encode full ranges instead of the defined runes in Unified_Ideograph. - for _, b := range []struct{ lo, hi rune }{ - {0x4E00, 0x9FFF}, // the CJK Unified Ideographs block, - {0x3400, 0x4DBF}, // the CJK Unified Ideographs Externsion A block, - {0xF900, 0xFAFF}, // the CJK Compatibility Ideographs block, - {0x20000, 0x2FFFF}, // the Supplementary Ideographic Plane, - {0x30000, 0x3FFFF}, // the Tertiary Ideographic Plane, - } { - for r := b.lo; r <= b.hi; r++ { - f(r, tagWide, 0) - } - } - - inverse := map[rune]rune{} - maps := map[string]bool{ - "<wide>": true, - "<narrow>": true, - } - - // We cannot reuse package norm's decomposition, as we need an unexpanded - // decomposition. We make use of the opportunity to verify that the - // decomposition type is as expected. - ucd.Parse(gen.OpenUCDFile("UnicodeData.txt"), func(p *ucd.Parser) { - r := p.Rune(0) - s := strings.SplitN(p.String(ucd.DecompMapping), " ", 2) - if !maps[s[0]] { - return - } - x, err := strconv.ParseUint(s[1], 16, 32) - if err != nil { - log.Fatalf("Error parsing rune %q", s[1]) - } - if inverse[r] != 0 || inverse[rune(x)] != 0 { - log.Fatalf("Circular dependency in mapping between %U and %U", r, x) - } - inverse[r] = rune(x) - inverse[rune(x)] = r - }) - - // <rune range>;<type> - ucd.Parse(gen.OpenUCDFile("EastAsianWidth.txt"), func(p *ucd.Parser) { - tag, ok := typeMap[p.String(1)] - if !ok { - log.Fatalf("Unknown width type %q", p.String(1)) - } - r := p.Rune(0) - alt, ok := inverse[r] - if tag == tagFullwidth || tag == tagHalfwidth && r != wonSign { - tag |= tagNeedsFold - if !ok { - log.Fatalf("Narrow or wide rune %U has no decomposition", r) - } - } - f(r, tag, alt) - }) -} diff --git a/vendor/golang.org/x/text/width/gen_trieval.go b/vendor/golang.org/x/text/width/gen_trieval.go deleted file mode 100644 index c17334aa..00000000 --- a/vendor/golang.org/x/text/width/gen_trieval.go +++ /dev/null @@ -1,34 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -// +build ignore - -package main - -// elem is an entry of the width trie. The high byte is used to encode the type -// of the rune. The low byte is used to store the index to a mapping entry in -// the inverseData array. -type elem uint16 - -const ( - tagNeutral elem = iota << typeShift - tagAmbiguous - tagWide - tagNarrow - tagFullwidth - tagHalfwidth -) - -const ( - numTypeBits = 3 - typeShift = 16 - numTypeBits - - // tagNeedsFold is true for all fullwidth and halfwidth runes except for - // the Won sign U+20A9. - tagNeedsFold = 0x1000 - - // The Korean Won sign is halfwidth, but SHOULD NOT be mapped to a wide - // variant. - wonSign rune = 0x20A9 -) diff --git a/vendor/golang.org/x/text/width/kind_string.go b/vendor/golang.org/x/text/width/kind_string.go deleted file mode 100644 index 49bfbf72..00000000 --- a/vendor/golang.org/x/text/width/kind_string.go +++ /dev/null @@ -1,16 +0,0 @@ -// Code generated by "stringer -type=Kind"; DO NOT EDIT. - -package width - -import "fmt" - -const _Kind_name = "NeutralEastAsianAmbiguousEastAsianWideEastAsianNarrowEastAsianFullwidthEastAsianHalfwidth" - -var _Kind_index = [...]uint8{0, 7, 25, 38, 53, 71, 89} - -func (i Kind) String() string { - if i < 0 || i >= Kind(len(_Kind_index)-1) { - return fmt.Sprintf("Kind(%d)", i) - } - return _Kind_name[_Kind_index[i]:_Kind_index[i+1]] -} diff --git a/vendor/golang.org/x/text/width/tables.go b/vendor/golang.org/x/text/width/tables.go deleted file mode 100644 index e21f0b83..00000000 --- a/vendor/golang.org/x/text/width/tables.go +++ /dev/null @@ -1,1284 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package width - -// UnicodeVersion is the Unicode version from which the tables in this package are derived. -const UnicodeVersion = "9.0.0" - -// lookup returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *widthTrie) lookup(s []byte) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return widthValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := widthIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := widthIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = widthIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := widthIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = widthIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = widthIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *widthTrie) lookupUnsafe(s []byte) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return widthValues[c0] - } - i := widthIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = widthIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = widthIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// lookupString returns the trie value for the first UTF-8 encoding in s and -// the width in bytes of this encoding. The size will be 0 if s does not -// hold enough bytes to complete the encoding. len(s) must be greater than 0. -func (t *widthTrie) lookupString(s string) (v uint16, sz int) { - c0 := s[0] - switch { - case c0 < 0x80: // is ASCII - return widthValues[c0], 1 - case c0 < 0xC2: - return 0, 1 // Illegal UTF-8: not a starter, not ASCII. - case c0 < 0xE0: // 2-byte UTF-8 - if len(s) < 2 { - return 0, 0 - } - i := widthIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c1), 2 - case c0 < 0xF0: // 3-byte UTF-8 - if len(s) < 3 { - return 0, 0 - } - i := widthIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = widthIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c2), 3 - case c0 < 0xF8: // 4-byte UTF-8 - if len(s) < 4 { - return 0, 0 - } - i := widthIndex[c0] - c1 := s[1] - if c1 < 0x80 || 0xC0 <= c1 { - return 0, 1 // Illegal UTF-8: not a continuation byte. - } - o := uint32(i)<<6 + uint32(c1) - i = widthIndex[o] - c2 := s[2] - if c2 < 0x80 || 0xC0 <= c2 { - return 0, 2 // Illegal UTF-8: not a continuation byte. - } - o = uint32(i)<<6 + uint32(c2) - i = widthIndex[o] - c3 := s[3] - if c3 < 0x80 || 0xC0 <= c3 { - return 0, 3 // Illegal UTF-8: not a continuation byte. - } - return t.lookupValue(uint32(i), c3), 4 - } - // Illegal rune - return 0, 1 -} - -// lookupStringUnsafe returns the trie value for the first UTF-8 encoding in s. -// s must start with a full and valid UTF-8 encoded rune. -func (t *widthTrie) lookupStringUnsafe(s string) uint16 { - c0 := s[0] - if c0 < 0x80 { // is ASCII - return widthValues[c0] - } - i := widthIndex[c0] - if c0 < 0xE0 { // 2-byte UTF-8 - return t.lookupValue(uint32(i), s[1]) - } - i = widthIndex[uint32(i)<<6+uint32(s[1])] - if c0 < 0xF0 { // 3-byte UTF-8 - return t.lookupValue(uint32(i), s[2]) - } - i = widthIndex[uint32(i)<<6+uint32(s[2])] - if c0 < 0xF8 { // 4-byte UTF-8 - return t.lookupValue(uint32(i), s[3]) - } - return 0 -} - -// widthTrie. Total size: 14080 bytes (13.75 KiB). Checksum: 3b8aeb3dc03667a3. -type widthTrie struct{} - -func newWidthTrie(i int) *widthTrie { - return &widthTrie{} -} - -// lookupValue determines the type of block n and looks up the value for b. -func (t *widthTrie) lookupValue(n uint32, b byte) uint16 { - switch { - default: - return uint16(widthValues[n<<6+uint32(b)]) - } -} - -// widthValues: 99 blocks, 6336 entries, 12672 bytes -// The third block is the zero block. -var widthValues = [6336]uint16{ - // Block 0x0, offset 0x0 - 0x20: 0x6001, 0x21: 0x6002, 0x22: 0x6002, 0x23: 0x6002, - 0x24: 0x6002, 0x25: 0x6002, 0x26: 0x6002, 0x27: 0x6002, 0x28: 0x6002, 0x29: 0x6002, - 0x2a: 0x6002, 0x2b: 0x6002, 0x2c: 0x6002, 0x2d: 0x6002, 0x2e: 0x6002, 0x2f: 0x6002, - 0x30: 0x6002, 0x31: 0x6002, 0x32: 0x6002, 0x33: 0x6002, 0x34: 0x6002, 0x35: 0x6002, - 0x36: 0x6002, 0x37: 0x6002, 0x38: 0x6002, 0x39: 0x6002, 0x3a: 0x6002, 0x3b: 0x6002, - 0x3c: 0x6002, 0x3d: 0x6002, 0x3e: 0x6002, 0x3f: 0x6002, - // Block 0x1, offset 0x40 - 0x40: 0x6003, 0x41: 0x6003, 0x42: 0x6003, 0x43: 0x6003, 0x44: 0x6003, 0x45: 0x6003, - 0x46: 0x6003, 0x47: 0x6003, 0x48: 0x6003, 0x49: 0x6003, 0x4a: 0x6003, 0x4b: 0x6003, - 0x4c: 0x6003, 0x4d: 0x6003, 0x4e: 0x6003, 0x4f: 0x6003, 0x50: 0x6003, 0x51: 0x6003, - 0x52: 0x6003, 0x53: 0x6003, 0x54: 0x6003, 0x55: 0x6003, 0x56: 0x6003, 0x57: 0x6003, - 0x58: 0x6003, 0x59: 0x6003, 0x5a: 0x6003, 0x5b: 0x6003, 0x5c: 0x6003, 0x5d: 0x6003, - 0x5e: 0x6003, 0x5f: 0x6003, 0x60: 0x6004, 0x61: 0x6004, 0x62: 0x6004, 0x63: 0x6004, - 0x64: 0x6004, 0x65: 0x6004, 0x66: 0x6004, 0x67: 0x6004, 0x68: 0x6004, 0x69: 0x6004, - 0x6a: 0x6004, 0x6b: 0x6004, 0x6c: 0x6004, 0x6d: 0x6004, 0x6e: 0x6004, 0x6f: 0x6004, - 0x70: 0x6004, 0x71: 0x6004, 0x72: 0x6004, 0x73: 0x6004, 0x74: 0x6004, 0x75: 0x6004, - 0x76: 0x6004, 0x77: 0x6004, 0x78: 0x6004, 0x79: 0x6004, 0x7a: 0x6004, 0x7b: 0x6004, - 0x7c: 0x6004, 0x7d: 0x6004, 0x7e: 0x6004, - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xe1: 0x2000, 0xe2: 0x6005, 0xe3: 0x6005, - 0xe4: 0x2000, 0xe5: 0x6006, 0xe6: 0x6005, 0xe7: 0x2000, 0xe8: 0x2000, - 0xea: 0x2000, 0xec: 0x6007, 0xed: 0x2000, 0xee: 0x2000, 0xef: 0x6008, - 0xf0: 0x2000, 0xf1: 0x2000, 0xf2: 0x2000, 0xf3: 0x2000, 0xf4: 0x2000, - 0xf6: 0x2000, 0xf7: 0x2000, 0xf8: 0x2000, 0xf9: 0x2000, 0xfa: 0x2000, - 0xfc: 0x2000, 0xfd: 0x2000, 0xfe: 0x2000, 0xff: 0x2000, - // Block 0x4, offset 0x100 - 0x106: 0x2000, - 0x110: 0x2000, - 0x117: 0x2000, - 0x118: 0x2000, - 0x11e: 0x2000, 0x11f: 0x2000, 0x120: 0x2000, 0x121: 0x2000, - 0x126: 0x2000, 0x128: 0x2000, 0x129: 0x2000, - 0x12a: 0x2000, 0x12c: 0x2000, 0x12d: 0x2000, - 0x130: 0x2000, 0x132: 0x2000, 0x133: 0x2000, - 0x137: 0x2000, 0x138: 0x2000, 0x139: 0x2000, 0x13a: 0x2000, - 0x13c: 0x2000, 0x13e: 0x2000, - // Block 0x5, offset 0x140 - 0x141: 0x2000, - 0x151: 0x2000, - 0x153: 0x2000, - 0x15b: 0x2000, - 0x166: 0x2000, 0x167: 0x2000, - 0x16b: 0x2000, - 0x171: 0x2000, 0x172: 0x2000, 0x173: 0x2000, - 0x178: 0x2000, - 0x17f: 0x2000, - // Block 0x6, offset 0x180 - 0x180: 0x2000, 0x181: 0x2000, 0x182: 0x2000, 0x184: 0x2000, - 0x188: 0x2000, 0x189: 0x2000, 0x18a: 0x2000, 0x18b: 0x2000, - 0x18d: 0x2000, - 0x192: 0x2000, 0x193: 0x2000, - 0x1a6: 0x2000, 0x1a7: 0x2000, - 0x1ab: 0x2000, - // Block 0x7, offset 0x1c0 - 0x1ce: 0x2000, 0x1d0: 0x2000, - 0x1d2: 0x2000, 0x1d4: 0x2000, 0x1d6: 0x2000, - 0x1d8: 0x2000, 0x1da: 0x2000, 0x1dc: 0x2000, - // Block 0x8, offset 0x200 - 0x211: 0x2000, - 0x221: 0x2000, - // Block 0x9, offset 0x240 - 0x244: 0x2000, - 0x247: 0x2000, 0x249: 0x2000, 0x24a: 0x2000, 0x24b: 0x2000, - 0x24d: 0x2000, 0x250: 0x2000, - 0x258: 0x2000, 0x259: 0x2000, 0x25a: 0x2000, 0x25b: 0x2000, 0x25d: 0x2000, - 0x25f: 0x2000, - // Block 0xa, offset 0x280 - 0x280: 0x2000, 0x281: 0x2000, 0x282: 0x2000, 0x283: 0x2000, 0x284: 0x2000, 0x285: 0x2000, - 0x286: 0x2000, 0x287: 0x2000, 0x288: 0x2000, 0x289: 0x2000, 0x28a: 0x2000, 0x28b: 0x2000, - 0x28c: 0x2000, 0x28d: 0x2000, 0x28e: 0x2000, 0x28f: 0x2000, 0x290: 0x2000, 0x291: 0x2000, - 0x292: 0x2000, 0x293: 0x2000, 0x294: 0x2000, 0x295: 0x2000, 0x296: 0x2000, 0x297: 0x2000, - 0x298: 0x2000, 0x299: 0x2000, 0x29a: 0x2000, 0x29b: 0x2000, 0x29c: 0x2000, 0x29d: 0x2000, - 0x29e: 0x2000, 0x29f: 0x2000, 0x2a0: 0x2000, 0x2a1: 0x2000, 0x2a2: 0x2000, 0x2a3: 0x2000, - 0x2a4: 0x2000, 0x2a5: 0x2000, 0x2a6: 0x2000, 0x2a7: 0x2000, 0x2a8: 0x2000, 0x2a9: 0x2000, - 0x2aa: 0x2000, 0x2ab: 0x2000, 0x2ac: 0x2000, 0x2ad: 0x2000, 0x2ae: 0x2000, 0x2af: 0x2000, - 0x2b0: 0x2000, 0x2b1: 0x2000, 0x2b2: 0x2000, 0x2b3: 0x2000, 0x2b4: 0x2000, 0x2b5: 0x2000, - 0x2b6: 0x2000, 0x2b7: 0x2000, 0x2b8: 0x2000, 0x2b9: 0x2000, 0x2ba: 0x2000, 0x2bb: 0x2000, - 0x2bc: 0x2000, 0x2bd: 0x2000, 0x2be: 0x2000, 0x2bf: 0x2000, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x2000, 0x2c1: 0x2000, 0x2c2: 0x2000, 0x2c3: 0x2000, 0x2c4: 0x2000, 0x2c5: 0x2000, - 0x2c6: 0x2000, 0x2c7: 0x2000, 0x2c8: 0x2000, 0x2c9: 0x2000, 0x2ca: 0x2000, 0x2cb: 0x2000, - 0x2cc: 0x2000, 0x2cd: 0x2000, 0x2ce: 0x2000, 0x2cf: 0x2000, 0x2d0: 0x2000, 0x2d1: 0x2000, - 0x2d2: 0x2000, 0x2d3: 0x2000, 0x2d4: 0x2000, 0x2d5: 0x2000, 0x2d6: 0x2000, 0x2d7: 0x2000, - 0x2d8: 0x2000, 0x2d9: 0x2000, 0x2da: 0x2000, 0x2db: 0x2000, 0x2dc: 0x2000, 0x2dd: 0x2000, - 0x2de: 0x2000, 0x2df: 0x2000, 0x2e0: 0x2000, 0x2e1: 0x2000, 0x2e2: 0x2000, 0x2e3: 0x2000, - 0x2e4: 0x2000, 0x2e5: 0x2000, 0x2e6: 0x2000, 0x2e7: 0x2000, 0x2e8: 0x2000, 0x2e9: 0x2000, - 0x2ea: 0x2000, 0x2eb: 0x2000, 0x2ec: 0x2000, 0x2ed: 0x2000, 0x2ee: 0x2000, 0x2ef: 0x2000, - // Block 0xc, offset 0x300 - 0x311: 0x2000, - 0x312: 0x2000, 0x313: 0x2000, 0x314: 0x2000, 0x315: 0x2000, 0x316: 0x2000, 0x317: 0x2000, - 0x318: 0x2000, 0x319: 0x2000, 0x31a: 0x2000, 0x31b: 0x2000, 0x31c: 0x2000, 0x31d: 0x2000, - 0x31e: 0x2000, 0x31f: 0x2000, 0x320: 0x2000, 0x321: 0x2000, 0x323: 0x2000, - 0x324: 0x2000, 0x325: 0x2000, 0x326: 0x2000, 0x327: 0x2000, 0x328: 0x2000, 0x329: 0x2000, - 0x331: 0x2000, 0x332: 0x2000, 0x333: 0x2000, 0x334: 0x2000, 0x335: 0x2000, - 0x336: 0x2000, 0x337: 0x2000, 0x338: 0x2000, 0x339: 0x2000, 0x33a: 0x2000, 0x33b: 0x2000, - 0x33c: 0x2000, 0x33d: 0x2000, 0x33e: 0x2000, 0x33f: 0x2000, - // Block 0xd, offset 0x340 - 0x340: 0x2000, 0x341: 0x2000, 0x343: 0x2000, 0x344: 0x2000, 0x345: 0x2000, - 0x346: 0x2000, 0x347: 0x2000, 0x348: 0x2000, 0x349: 0x2000, - // Block 0xe, offset 0x380 - 0x381: 0x2000, - 0x390: 0x2000, 0x391: 0x2000, - 0x392: 0x2000, 0x393: 0x2000, 0x394: 0x2000, 0x395: 0x2000, 0x396: 0x2000, 0x397: 0x2000, - 0x398: 0x2000, 0x399: 0x2000, 0x39a: 0x2000, 0x39b: 0x2000, 0x39c: 0x2000, 0x39d: 0x2000, - 0x39e: 0x2000, 0x39f: 0x2000, 0x3a0: 0x2000, 0x3a1: 0x2000, 0x3a2: 0x2000, 0x3a3: 0x2000, - 0x3a4: 0x2000, 0x3a5: 0x2000, 0x3a6: 0x2000, 0x3a7: 0x2000, 0x3a8: 0x2000, 0x3a9: 0x2000, - 0x3aa: 0x2000, 0x3ab: 0x2000, 0x3ac: 0x2000, 0x3ad: 0x2000, 0x3ae: 0x2000, 0x3af: 0x2000, - 0x3b0: 0x2000, 0x3b1: 0x2000, 0x3b2: 0x2000, 0x3b3: 0x2000, 0x3b4: 0x2000, 0x3b5: 0x2000, - 0x3b6: 0x2000, 0x3b7: 0x2000, 0x3b8: 0x2000, 0x3b9: 0x2000, 0x3ba: 0x2000, 0x3bb: 0x2000, - 0x3bc: 0x2000, 0x3bd: 0x2000, 0x3be: 0x2000, 0x3bf: 0x2000, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x2000, 0x3c1: 0x2000, 0x3c2: 0x2000, 0x3c3: 0x2000, 0x3c4: 0x2000, 0x3c5: 0x2000, - 0x3c6: 0x2000, 0x3c7: 0x2000, 0x3c8: 0x2000, 0x3c9: 0x2000, 0x3ca: 0x2000, 0x3cb: 0x2000, - 0x3cc: 0x2000, 0x3cd: 0x2000, 0x3ce: 0x2000, 0x3cf: 0x2000, 0x3d1: 0x2000, - // Block 0x10, offset 0x400 - 0x400: 0x4000, 0x401: 0x4000, 0x402: 0x4000, 0x403: 0x4000, 0x404: 0x4000, 0x405: 0x4000, - 0x406: 0x4000, 0x407: 0x4000, 0x408: 0x4000, 0x409: 0x4000, 0x40a: 0x4000, 0x40b: 0x4000, - 0x40c: 0x4000, 0x40d: 0x4000, 0x40e: 0x4000, 0x40f: 0x4000, 0x410: 0x4000, 0x411: 0x4000, - 0x412: 0x4000, 0x413: 0x4000, 0x414: 0x4000, 0x415: 0x4000, 0x416: 0x4000, 0x417: 0x4000, - 0x418: 0x4000, 0x419: 0x4000, 0x41a: 0x4000, 0x41b: 0x4000, 0x41c: 0x4000, 0x41d: 0x4000, - 0x41e: 0x4000, 0x41f: 0x4000, 0x420: 0x4000, 0x421: 0x4000, 0x422: 0x4000, 0x423: 0x4000, - 0x424: 0x4000, 0x425: 0x4000, 0x426: 0x4000, 0x427: 0x4000, 0x428: 0x4000, 0x429: 0x4000, - 0x42a: 0x4000, 0x42b: 0x4000, 0x42c: 0x4000, 0x42d: 0x4000, 0x42e: 0x4000, 0x42f: 0x4000, - 0x430: 0x4000, 0x431: 0x4000, 0x432: 0x4000, 0x433: 0x4000, 0x434: 0x4000, 0x435: 0x4000, - 0x436: 0x4000, 0x437: 0x4000, 0x438: 0x4000, 0x439: 0x4000, 0x43a: 0x4000, 0x43b: 0x4000, - 0x43c: 0x4000, 0x43d: 0x4000, 0x43e: 0x4000, 0x43f: 0x4000, - // Block 0x11, offset 0x440 - 0x440: 0x4000, 0x441: 0x4000, 0x442: 0x4000, 0x443: 0x4000, 0x444: 0x4000, 0x445: 0x4000, - 0x446: 0x4000, 0x447: 0x4000, 0x448: 0x4000, 0x449: 0x4000, 0x44a: 0x4000, 0x44b: 0x4000, - 0x44c: 0x4000, 0x44d: 0x4000, 0x44e: 0x4000, 0x44f: 0x4000, 0x450: 0x4000, 0x451: 0x4000, - 0x452: 0x4000, 0x453: 0x4000, 0x454: 0x4000, 0x455: 0x4000, 0x456: 0x4000, 0x457: 0x4000, - 0x458: 0x4000, 0x459: 0x4000, 0x45a: 0x4000, 0x45b: 0x4000, 0x45c: 0x4000, 0x45d: 0x4000, - 0x45e: 0x4000, 0x45f: 0x4000, - // Block 0x12, offset 0x480 - 0x490: 0x2000, - 0x493: 0x2000, 0x494: 0x2000, 0x495: 0x2000, 0x496: 0x2000, - 0x498: 0x2000, 0x499: 0x2000, 0x49c: 0x2000, 0x49d: 0x2000, - 0x4a0: 0x2000, 0x4a1: 0x2000, 0x4a2: 0x2000, - 0x4a4: 0x2000, 0x4a5: 0x2000, 0x4a6: 0x2000, 0x4a7: 0x2000, - 0x4b0: 0x2000, 0x4b2: 0x2000, 0x4b3: 0x2000, 0x4b5: 0x2000, - 0x4bb: 0x2000, - 0x4be: 0x2000, - // Block 0x13, offset 0x4c0 - 0x4f4: 0x2000, - 0x4ff: 0x2000, - // Block 0x14, offset 0x500 - 0x501: 0x2000, 0x502: 0x2000, 0x503: 0x2000, 0x504: 0x2000, - 0x529: 0xa009, - 0x52c: 0x2000, - // Block 0x15, offset 0x540 - 0x543: 0x2000, 0x545: 0x2000, - 0x549: 0x2000, - 0x553: 0x2000, 0x556: 0x2000, - 0x561: 0x2000, 0x562: 0x2000, - 0x566: 0x2000, - 0x56b: 0x2000, - // Block 0x16, offset 0x580 - 0x593: 0x2000, 0x594: 0x2000, - 0x59b: 0x2000, 0x59c: 0x2000, 0x59d: 0x2000, - 0x59e: 0x2000, 0x5a0: 0x2000, 0x5a1: 0x2000, 0x5a2: 0x2000, 0x5a3: 0x2000, - 0x5a4: 0x2000, 0x5a5: 0x2000, 0x5a6: 0x2000, 0x5a7: 0x2000, 0x5a8: 0x2000, 0x5a9: 0x2000, - 0x5aa: 0x2000, 0x5ab: 0x2000, - 0x5b0: 0x2000, 0x5b1: 0x2000, 0x5b2: 0x2000, 0x5b3: 0x2000, 0x5b4: 0x2000, 0x5b5: 0x2000, - 0x5b6: 0x2000, 0x5b7: 0x2000, 0x5b8: 0x2000, 0x5b9: 0x2000, - // Block 0x17, offset 0x5c0 - 0x5c9: 0x2000, - 0x5d0: 0x200a, 0x5d1: 0x200b, - 0x5d2: 0x200a, 0x5d3: 0x200c, 0x5d4: 0x2000, 0x5d5: 0x2000, 0x5d6: 0x2000, 0x5d7: 0x2000, - 0x5d8: 0x2000, 0x5d9: 0x2000, - 0x5f8: 0x2000, 0x5f9: 0x2000, - // Block 0x18, offset 0x600 - 0x612: 0x2000, 0x614: 0x2000, - 0x627: 0x2000, - // Block 0x19, offset 0x640 - 0x640: 0x2000, 0x642: 0x2000, 0x643: 0x2000, - 0x647: 0x2000, 0x648: 0x2000, 0x64b: 0x2000, - 0x64f: 0x2000, 0x651: 0x2000, - 0x655: 0x2000, - 0x65a: 0x2000, 0x65d: 0x2000, - 0x65e: 0x2000, 0x65f: 0x2000, 0x660: 0x2000, 0x663: 0x2000, - 0x665: 0x2000, 0x667: 0x2000, 0x668: 0x2000, 0x669: 0x2000, - 0x66a: 0x2000, 0x66b: 0x2000, 0x66c: 0x2000, 0x66e: 0x2000, - 0x674: 0x2000, 0x675: 0x2000, - 0x676: 0x2000, 0x677: 0x2000, - 0x67c: 0x2000, 0x67d: 0x2000, - // Block 0x1a, offset 0x680 - 0x688: 0x2000, - 0x68c: 0x2000, - 0x692: 0x2000, - 0x6a0: 0x2000, 0x6a1: 0x2000, - 0x6a4: 0x2000, 0x6a5: 0x2000, 0x6a6: 0x2000, 0x6a7: 0x2000, - 0x6aa: 0x2000, 0x6ab: 0x2000, 0x6ae: 0x2000, 0x6af: 0x2000, - // Block 0x1b, offset 0x6c0 - 0x6c2: 0x2000, 0x6c3: 0x2000, - 0x6c6: 0x2000, 0x6c7: 0x2000, - 0x6d5: 0x2000, - 0x6d9: 0x2000, - 0x6e5: 0x2000, - 0x6ff: 0x2000, - // Block 0x1c, offset 0x700 - 0x712: 0x2000, - 0x71a: 0x4000, 0x71b: 0x4000, - 0x729: 0x4000, - 0x72a: 0x4000, - // Block 0x1d, offset 0x740 - 0x769: 0x4000, - 0x76a: 0x4000, 0x76b: 0x4000, 0x76c: 0x4000, - 0x770: 0x4000, 0x773: 0x4000, - // Block 0x1e, offset 0x780 - 0x7a0: 0x2000, 0x7a1: 0x2000, 0x7a2: 0x2000, 0x7a3: 0x2000, - 0x7a4: 0x2000, 0x7a5: 0x2000, 0x7a6: 0x2000, 0x7a7: 0x2000, 0x7a8: 0x2000, 0x7a9: 0x2000, - 0x7aa: 0x2000, 0x7ab: 0x2000, 0x7ac: 0x2000, 0x7ad: 0x2000, 0x7ae: 0x2000, 0x7af: 0x2000, - 0x7b0: 0x2000, 0x7b1: 0x2000, 0x7b2: 0x2000, 0x7b3: 0x2000, 0x7b4: 0x2000, 0x7b5: 0x2000, - 0x7b6: 0x2000, 0x7b7: 0x2000, 0x7b8: 0x2000, 0x7b9: 0x2000, 0x7ba: 0x2000, 0x7bb: 0x2000, - 0x7bc: 0x2000, 0x7bd: 0x2000, 0x7be: 0x2000, 0x7bf: 0x2000, - // Block 0x1f, offset 0x7c0 - 0x7c0: 0x2000, 0x7c1: 0x2000, 0x7c2: 0x2000, 0x7c3: 0x2000, 0x7c4: 0x2000, 0x7c5: 0x2000, - 0x7c6: 0x2000, 0x7c7: 0x2000, 0x7c8: 0x2000, 0x7c9: 0x2000, 0x7ca: 0x2000, 0x7cb: 0x2000, - 0x7cc: 0x2000, 0x7cd: 0x2000, 0x7ce: 0x2000, 0x7cf: 0x2000, 0x7d0: 0x2000, 0x7d1: 0x2000, - 0x7d2: 0x2000, 0x7d3: 0x2000, 0x7d4: 0x2000, 0x7d5: 0x2000, 0x7d6: 0x2000, 0x7d7: 0x2000, - 0x7d8: 0x2000, 0x7d9: 0x2000, 0x7da: 0x2000, 0x7db: 0x2000, 0x7dc: 0x2000, 0x7dd: 0x2000, - 0x7de: 0x2000, 0x7df: 0x2000, 0x7e0: 0x2000, 0x7e1: 0x2000, 0x7e2: 0x2000, 0x7e3: 0x2000, - 0x7e4: 0x2000, 0x7e5: 0x2000, 0x7e6: 0x2000, 0x7e7: 0x2000, 0x7e8: 0x2000, 0x7e9: 0x2000, - 0x7eb: 0x2000, 0x7ec: 0x2000, 0x7ed: 0x2000, 0x7ee: 0x2000, 0x7ef: 0x2000, - 0x7f0: 0x2000, 0x7f1: 0x2000, 0x7f2: 0x2000, 0x7f3: 0x2000, 0x7f4: 0x2000, 0x7f5: 0x2000, - 0x7f6: 0x2000, 0x7f7: 0x2000, 0x7f8: 0x2000, 0x7f9: 0x2000, 0x7fa: 0x2000, 0x7fb: 0x2000, - 0x7fc: 0x2000, 0x7fd: 0x2000, 0x7fe: 0x2000, 0x7ff: 0x2000, - // Block 0x20, offset 0x800 - 0x800: 0x2000, 0x801: 0x2000, 0x802: 0x200d, 0x803: 0x2000, 0x804: 0x2000, 0x805: 0x2000, - 0x806: 0x2000, 0x807: 0x2000, 0x808: 0x2000, 0x809: 0x2000, 0x80a: 0x2000, 0x80b: 0x2000, - 0x80c: 0x2000, 0x80d: 0x2000, 0x80e: 0x2000, 0x80f: 0x2000, 0x810: 0x2000, 0x811: 0x2000, - 0x812: 0x2000, 0x813: 0x2000, 0x814: 0x2000, 0x815: 0x2000, 0x816: 0x2000, 0x817: 0x2000, - 0x818: 0x2000, 0x819: 0x2000, 0x81a: 0x2000, 0x81b: 0x2000, 0x81c: 0x2000, 0x81d: 0x2000, - 0x81e: 0x2000, 0x81f: 0x2000, 0x820: 0x2000, 0x821: 0x2000, 0x822: 0x2000, 0x823: 0x2000, - 0x824: 0x2000, 0x825: 0x2000, 0x826: 0x2000, 0x827: 0x2000, 0x828: 0x2000, 0x829: 0x2000, - 0x82a: 0x2000, 0x82b: 0x2000, 0x82c: 0x2000, 0x82d: 0x2000, 0x82e: 0x2000, 0x82f: 0x2000, - 0x830: 0x2000, 0x831: 0x2000, 0x832: 0x2000, 0x833: 0x2000, 0x834: 0x2000, 0x835: 0x2000, - 0x836: 0x2000, 0x837: 0x2000, 0x838: 0x2000, 0x839: 0x2000, 0x83a: 0x2000, 0x83b: 0x2000, - 0x83c: 0x2000, 0x83d: 0x2000, 0x83e: 0x2000, 0x83f: 0x2000, - // Block 0x21, offset 0x840 - 0x840: 0x2000, 0x841: 0x2000, 0x842: 0x2000, 0x843: 0x2000, 0x844: 0x2000, 0x845: 0x2000, - 0x846: 0x2000, 0x847: 0x2000, 0x848: 0x2000, 0x849: 0x2000, 0x84a: 0x2000, 0x84b: 0x2000, - 0x850: 0x2000, 0x851: 0x2000, - 0x852: 0x2000, 0x853: 0x2000, 0x854: 0x2000, 0x855: 0x2000, 0x856: 0x2000, 0x857: 0x2000, - 0x858: 0x2000, 0x859: 0x2000, 0x85a: 0x2000, 0x85b: 0x2000, 0x85c: 0x2000, 0x85d: 0x2000, - 0x85e: 0x2000, 0x85f: 0x2000, 0x860: 0x2000, 0x861: 0x2000, 0x862: 0x2000, 0x863: 0x2000, - 0x864: 0x2000, 0x865: 0x2000, 0x866: 0x2000, 0x867: 0x2000, 0x868: 0x2000, 0x869: 0x2000, - 0x86a: 0x2000, 0x86b: 0x2000, 0x86c: 0x2000, 0x86d: 0x2000, 0x86e: 0x2000, 0x86f: 0x2000, - 0x870: 0x2000, 0x871: 0x2000, 0x872: 0x2000, 0x873: 0x2000, - // Block 0x22, offset 0x880 - 0x880: 0x2000, 0x881: 0x2000, 0x882: 0x2000, 0x883: 0x2000, 0x884: 0x2000, 0x885: 0x2000, - 0x886: 0x2000, 0x887: 0x2000, 0x888: 0x2000, 0x889: 0x2000, 0x88a: 0x2000, 0x88b: 0x2000, - 0x88c: 0x2000, 0x88d: 0x2000, 0x88e: 0x2000, 0x88f: 0x2000, - 0x892: 0x2000, 0x893: 0x2000, 0x894: 0x2000, 0x895: 0x2000, - 0x8a0: 0x200e, 0x8a1: 0x2000, 0x8a3: 0x2000, - 0x8a4: 0x2000, 0x8a5: 0x2000, 0x8a6: 0x2000, 0x8a7: 0x2000, 0x8a8: 0x2000, 0x8a9: 0x2000, - 0x8b2: 0x2000, 0x8b3: 0x2000, - 0x8b6: 0x2000, 0x8b7: 0x2000, - 0x8bc: 0x2000, 0x8bd: 0x2000, - // Block 0x23, offset 0x8c0 - 0x8c0: 0x2000, 0x8c1: 0x2000, - 0x8c6: 0x2000, 0x8c7: 0x2000, 0x8c8: 0x2000, 0x8cb: 0x200f, - 0x8ce: 0x2000, 0x8cf: 0x2000, 0x8d0: 0x2000, 0x8d1: 0x2000, - 0x8e2: 0x2000, 0x8e3: 0x2000, - 0x8e4: 0x2000, 0x8e5: 0x2000, - 0x8ef: 0x2000, - 0x8fd: 0x4000, 0x8fe: 0x4000, - // Block 0x24, offset 0x900 - 0x905: 0x2000, - 0x906: 0x2000, 0x909: 0x2000, - 0x90e: 0x2000, 0x90f: 0x2000, - 0x914: 0x4000, 0x915: 0x4000, - 0x91c: 0x2000, - 0x91e: 0x2000, - // Block 0x25, offset 0x940 - 0x940: 0x2000, 0x942: 0x2000, - 0x948: 0x4000, 0x949: 0x4000, 0x94a: 0x4000, 0x94b: 0x4000, - 0x94c: 0x4000, 0x94d: 0x4000, 0x94e: 0x4000, 0x94f: 0x4000, 0x950: 0x4000, 0x951: 0x4000, - 0x952: 0x4000, 0x953: 0x4000, - 0x960: 0x2000, 0x961: 0x2000, 0x963: 0x2000, - 0x964: 0x2000, 0x965: 0x2000, 0x967: 0x2000, 0x968: 0x2000, 0x969: 0x2000, - 0x96a: 0x2000, 0x96c: 0x2000, 0x96d: 0x2000, 0x96f: 0x2000, - 0x97f: 0x4000, - // Block 0x26, offset 0x980 - 0x993: 0x4000, - 0x99e: 0x2000, 0x99f: 0x2000, 0x9a1: 0x4000, - 0x9aa: 0x4000, 0x9ab: 0x4000, - 0x9bd: 0x4000, 0x9be: 0x4000, 0x9bf: 0x2000, - // Block 0x27, offset 0x9c0 - 0x9c4: 0x4000, 0x9c5: 0x4000, - 0x9c6: 0x2000, 0x9c7: 0x2000, 0x9c8: 0x2000, 0x9c9: 0x2000, 0x9ca: 0x2000, 0x9cb: 0x2000, - 0x9cc: 0x2000, 0x9cd: 0x2000, 0x9ce: 0x4000, 0x9cf: 0x2000, 0x9d0: 0x2000, 0x9d1: 0x2000, - 0x9d2: 0x2000, 0x9d3: 0x2000, 0x9d4: 0x4000, 0x9d5: 0x2000, 0x9d6: 0x2000, 0x9d7: 0x2000, - 0x9d8: 0x2000, 0x9d9: 0x2000, 0x9da: 0x2000, 0x9db: 0x2000, 0x9dc: 0x2000, 0x9dd: 0x2000, - 0x9de: 0x2000, 0x9df: 0x2000, 0x9e0: 0x2000, 0x9e1: 0x2000, 0x9e3: 0x2000, - 0x9e8: 0x2000, 0x9e9: 0x2000, - 0x9ea: 0x4000, 0x9eb: 0x2000, 0x9ec: 0x2000, 0x9ed: 0x2000, 0x9ee: 0x2000, 0x9ef: 0x2000, - 0x9f0: 0x2000, 0x9f1: 0x2000, 0x9f2: 0x4000, 0x9f3: 0x4000, 0x9f4: 0x2000, 0x9f5: 0x4000, - 0x9f6: 0x2000, 0x9f7: 0x2000, 0x9f8: 0x2000, 0x9f9: 0x2000, 0x9fa: 0x4000, 0x9fb: 0x2000, - 0x9fc: 0x2000, 0x9fd: 0x4000, 0x9fe: 0x2000, 0x9ff: 0x2000, - // Block 0x28, offset 0xa00 - 0xa05: 0x4000, - 0xa0a: 0x4000, 0xa0b: 0x4000, - 0xa28: 0x4000, - 0xa3d: 0x2000, - // Block 0x29, offset 0xa40 - 0xa4c: 0x4000, 0xa4e: 0x4000, - 0xa53: 0x4000, 0xa54: 0x4000, 0xa55: 0x4000, 0xa57: 0x4000, - 0xa76: 0x2000, 0xa77: 0x2000, 0xa78: 0x2000, 0xa79: 0x2000, 0xa7a: 0x2000, 0xa7b: 0x2000, - 0xa7c: 0x2000, 0xa7d: 0x2000, 0xa7e: 0x2000, 0xa7f: 0x2000, - // Block 0x2a, offset 0xa80 - 0xa95: 0x4000, 0xa96: 0x4000, 0xa97: 0x4000, - 0xab0: 0x4000, - 0xabf: 0x4000, - // Block 0x2b, offset 0xac0 - 0xae6: 0x6000, 0xae7: 0x6000, 0xae8: 0x6000, 0xae9: 0x6000, - 0xaea: 0x6000, 0xaeb: 0x6000, 0xaec: 0x6000, 0xaed: 0x6000, - // Block 0x2c, offset 0xb00 - 0xb05: 0x6010, - 0xb06: 0x6011, - // Block 0x2d, offset 0xb40 - 0xb5b: 0x4000, 0xb5c: 0x4000, - // Block 0x2e, offset 0xb80 - 0xb90: 0x4000, - 0xb95: 0x4000, 0xb96: 0x2000, 0xb97: 0x2000, - 0xb98: 0x2000, 0xb99: 0x2000, - // Block 0x2f, offset 0xbc0 - 0xbc0: 0x4000, 0xbc1: 0x4000, 0xbc2: 0x4000, 0xbc3: 0x4000, 0xbc4: 0x4000, 0xbc5: 0x4000, - 0xbc6: 0x4000, 0xbc7: 0x4000, 0xbc8: 0x4000, 0xbc9: 0x4000, 0xbca: 0x4000, 0xbcb: 0x4000, - 0xbcc: 0x4000, 0xbcd: 0x4000, 0xbce: 0x4000, 0xbcf: 0x4000, 0xbd0: 0x4000, 0xbd1: 0x4000, - 0xbd2: 0x4000, 0xbd3: 0x4000, 0xbd4: 0x4000, 0xbd5: 0x4000, 0xbd6: 0x4000, 0xbd7: 0x4000, - 0xbd8: 0x4000, 0xbd9: 0x4000, 0xbdb: 0x4000, 0xbdc: 0x4000, 0xbdd: 0x4000, - 0xbde: 0x4000, 0xbdf: 0x4000, 0xbe0: 0x4000, 0xbe1: 0x4000, 0xbe2: 0x4000, 0xbe3: 0x4000, - 0xbe4: 0x4000, 0xbe5: 0x4000, 0xbe6: 0x4000, 0xbe7: 0x4000, 0xbe8: 0x4000, 0xbe9: 0x4000, - 0xbea: 0x4000, 0xbeb: 0x4000, 0xbec: 0x4000, 0xbed: 0x4000, 0xbee: 0x4000, 0xbef: 0x4000, - 0xbf0: 0x4000, 0xbf1: 0x4000, 0xbf2: 0x4000, 0xbf3: 0x4000, 0xbf4: 0x4000, 0xbf5: 0x4000, - 0xbf6: 0x4000, 0xbf7: 0x4000, 0xbf8: 0x4000, 0xbf9: 0x4000, 0xbfa: 0x4000, 0xbfb: 0x4000, - 0xbfc: 0x4000, 0xbfd: 0x4000, 0xbfe: 0x4000, 0xbff: 0x4000, - // Block 0x30, offset 0xc00 - 0xc00: 0x4000, 0xc01: 0x4000, 0xc02: 0x4000, 0xc03: 0x4000, 0xc04: 0x4000, 0xc05: 0x4000, - 0xc06: 0x4000, 0xc07: 0x4000, 0xc08: 0x4000, 0xc09: 0x4000, 0xc0a: 0x4000, 0xc0b: 0x4000, - 0xc0c: 0x4000, 0xc0d: 0x4000, 0xc0e: 0x4000, 0xc0f: 0x4000, 0xc10: 0x4000, 0xc11: 0x4000, - 0xc12: 0x4000, 0xc13: 0x4000, 0xc14: 0x4000, 0xc15: 0x4000, 0xc16: 0x4000, 0xc17: 0x4000, - 0xc18: 0x4000, 0xc19: 0x4000, 0xc1a: 0x4000, 0xc1b: 0x4000, 0xc1c: 0x4000, 0xc1d: 0x4000, - 0xc1e: 0x4000, 0xc1f: 0x4000, 0xc20: 0x4000, 0xc21: 0x4000, 0xc22: 0x4000, 0xc23: 0x4000, - 0xc24: 0x4000, 0xc25: 0x4000, 0xc26: 0x4000, 0xc27: 0x4000, 0xc28: 0x4000, 0xc29: 0x4000, - 0xc2a: 0x4000, 0xc2b: 0x4000, 0xc2c: 0x4000, 0xc2d: 0x4000, 0xc2e: 0x4000, 0xc2f: 0x4000, - 0xc30: 0x4000, 0xc31: 0x4000, 0xc32: 0x4000, 0xc33: 0x4000, - // Block 0x31, offset 0xc40 - 0xc40: 0x4000, 0xc41: 0x4000, 0xc42: 0x4000, 0xc43: 0x4000, 0xc44: 0x4000, 0xc45: 0x4000, - 0xc46: 0x4000, 0xc47: 0x4000, 0xc48: 0x4000, 0xc49: 0x4000, 0xc4a: 0x4000, 0xc4b: 0x4000, - 0xc4c: 0x4000, 0xc4d: 0x4000, 0xc4e: 0x4000, 0xc4f: 0x4000, 0xc50: 0x4000, 0xc51: 0x4000, - 0xc52: 0x4000, 0xc53: 0x4000, 0xc54: 0x4000, 0xc55: 0x4000, - 0xc70: 0x4000, 0xc71: 0x4000, 0xc72: 0x4000, 0xc73: 0x4000, 0xc74: 0x4000, 0xc75: 0x4000, - 0xc76: 0x4000, 0xc77: 0x4000, 0xc78: 0x4000, 0xc79: 0x4000, 0xc7a: 0x4000, 0xc7b: 0x4000, - // Block 0x32, offset 0xc80 - 0xc80: 0x9012, 0xc81: 0x4013, 0xc82: 0x4014, 0xc83: 0x4000, 0xc84: 0x4000, 0xc85: 0x4000, - 0xc86: 0x4000, 0xc87: 0x4000, 0xc88: 0x4000, 0xc89: 0x4000, 0xc8a: 0x4000, 0xc8b: 0x4000, - 0xc8c: 0x4015, 0xc8d: 0x4015, 0xc8e: 0x4000, 0xc8f: 0x4000, 0xc90: 0x4000, 0xc91: 0x4000, - 0xc92: 0x4000, 0xc93: 0x4000, 0xc94: 0x4000, 0xc95: 0x4000, 0xc96: 0x4000, 0xc97: 0x4000, - 0xc98: 0x4000, 0xc99: 0x4000, 0xc9a: 0x4000, 0xc9b: 0x4000, 0xc9c: 0x4000, 0xc9d: 0x4000, - 0xc9e: 0x4000, 0xc9f: 0x4000, 0xca0: 0x4000, 0xca1: 0x4000, 0xca2: 0x4000, 0xca3: 0x4000, - 0xca4: 0x4000, 0xca5: 0x4000, 0xca6: 0x4000, 0xca7: 0x4000, 0xca8: 0x4000, 0xca9: 0x4000, - 0xcaa: 0x4000, 0xcab: 0x4000, 0xcac: 0x4000, 0xcad: 0x4000, 0xcae: 0x4000, 0xcaf: 0x4000, - 0xcb0: 0x4000, 0xcb1: 0x4000, 0xcb2: 0x4000, 0xcb3: 0x4000, 0xcb4: 0x4000, 0xcb5: 0x4000, - 0xcb6: 0x4000, 0xcb7: 0x4000, 0xcb8: 0x4000, 0xcb9: 0x4000, 0xcba: 0x4000, 0xcbb: 0x4000, - 0xcbc: 0x4000, 0xcbd: 0x4000, 0xcbe: 0x4000, - // Block 0x33, offset 0xcc0 - 0xcc1: 0x4000, 0xcc2: 0x4000, 0xcc3: 0x4000, 0xcc4: 0x4000, 0xcc5: 0x4000, - 0xcc6: 0x4000, 0xcc7: 0x4000, 0xcc8: 0x4000, 0xcc9: 0x4000, 0xcca: 0x4000, 0xccb: 0x4000, - 0xccc: 0x4000, 0xccd: 0x4000, 0xcce: 0x4000, 0xccf: 0x4000, 0xcd0: 0x4000, 0xcd1: 0x4000, - 0xcd2: 0x4000, 0xcd3: 0x4000, 0xcd4: 0x4000, 0xcd5: 0x4000, 0xcd6: 0x4000, 0xcd7: 0x4000, - 0xcd8: 0x4000, 0xcd9: 0x4000, 0xcda: 0x4000, 0xcdb: 0x4000, 0xcdc: 0x4000, 0xcdd: 0x4000, - 0xcde: 0x4000, 0xcdf: 0x4000, 0xce0: 0x4000, 0xce1: 0x4000, 0xce2: 0x4000, 0xce3: 0x4000, - 0xce4: 0x4000, 0xce5: 0x4000, 0xce6: 0x4000, 0xce7: 0x4000, 0xce8: 0x4000, 0xce9: 0x4000, - 0xcea: 0x4000, 0xceb: 0x4000, 0xcec: 0x4000, 0xced: 0x4000, 0xcee: 0x4000, 0xcef: 0x4000, - 0xcf0: 0x4000, 0xcf1: 0x4000, 0xcf2: 0x4000, 0xcf3: 0x4000, 0xcf4: 0x4000, 0xcf5: 0x4000, - 0xcf6: 0x4000, 0xcf7: 0x4000, 0xcf8: 0x4000, 0xcf9: 0x4000, 0xcfa: 0x4000, 0xcfb: 0x4000, - 0xcfc: 0x4000, 0xcfd: 0x4000, 0xcfe: 0x4000, 0xcff: 0x4000, - // Block 0x34, offset 0xd00 - 0xd00: 0x4000, 0xd01: 0x4000, 0xd02: 0x4000, 0xd03: 0x4000, 0xd04: 0x4000, 0xd05: 0x4000, - 0xd06: 0x4000, 0xd07: 0x4000, 0xd08: 0x4000, 0xd09: 0x4000, 0xd0a: 0x4000, 0xd0b: 0x4000, - 0xd0c: 0x4000, 0xd0d: 0x4000, 0xd0e: 0x4000, 0xd0f: 0x4000, 0xd10: 0x4000, 0xd11: 0x4000, - 0xd12: 0x4000, 0xd13: 0x4000, 0xd14: 0x4000, 0xd15: 0x4000, 0xd16: 0x4000, - 0xd19: 0x4016, 0xd1a: 0x4017, 0xd1b: 0x4000, 0xd1c: 0x4000, 0xd1d: 0x4000, - 0xd1e: 0x4000, 0xd1f: 0x4000, 0xd20: 0x4000, 0xd21: 0x4018, 0xd22: 0x4019, 0xd23: 0x401a, - 0xd24: 0x401b, 0xd25: 0x401c, 0xd26: 0x401d, 0xd27: 0x401e, 0xd28: 0x401f, 0xd29: 0x4020, - 0xd2a: 0x4021, 0xd2b: 0x4022, 0xd2c: 0x4000, 0xd2d: 0x4010, 0xd2e: 0x4000, 0xd2f: 0x4023, - 0xd30: 0x4000, 0xd31: 0x4024, 0xd32: 0x4000, 0xd33: 0x4025, 0xd34: 0x4000, 0xd35: 0x4026, - 0xd36: 0x4000, 0xd37: 0x401a, 0xd38: 0x4000, 0xd39: 0x4027, 0xd3a: 0x4000, 0xd3b: 0x4028, - 0xd3c: 0x4000, 0xd3d: 0x4020, 0xd3e: 0x4000, 0xd3f: 0x4029, - // Block 0x35, offset 0xd40 - 0xd40: 0x4000, 0xd41: 0x402a, 0xd42: 0x4000, 0xd43: 0x402b, 0xd44: 0x402c, 0xd45: 0x4000, - 0xd46: 0x4017, 0xd47: 0x4000, 0xd48: 0x402d, 0xd49: 0x4000, 0xd4a: 0x402e, 0xd4b: 0x402f, - 0xd4c: 0x4030, 0xd4d: 0x4017, 0xd4e: 0x4016, 0xd4f: 0x4017, 0xd50: 0x4000, 0xd51: 0x4000, - 0xd52: 0x4031, 0xd53: 0x4000, 0xd54: 0x4000, 0xd55: 0x4031, 0xd56: 0x4000, 0xd57: 0x4000, - 0xd58: 0x4032, 0xd59: 0x4000, 0xd5a: 0x4000, 0xd5b: 0x4032, 0xd5c: 0x4000, 0xd5d: 0x4000, - 0xd5e: 0x4033, 0xd5f: 0x402e, 0xd60: 0x4034, 0xd61: 0x4035, 0xd62: 0x4034, 0xd63: 0x4036, - 0xd64: 0x4037, 0xd65: 0x4024, 0xd66: 0x4035, 0xd67: 0x4025, 0xd68: 0x4038, 0xd69: 0x4038, - 0xd6a: 0x4039, 0xd6b: 0x4039, 0xd6c: 0x403a, 0xd6d: 0x403a, 0xd6e: 0x4000, 0xd6f: 0x4035, - 0xd70: 0x4000, 0xd71: 0x4000, 0xd72: 0x403b, 0xd73: 0x403c, 0xd74: 0x4000, 0xd75: 0x4000, - 0xd76: 0x4000, 0xd77: 0x4000, 0xd78: 0x4000, 0xd79: 0x4000, 0xd7a: 0x4000, 0xd7b: 0x403d, - 0xd7c: 0x401c, 0xd7d: 0x4000, 0xd7e: 0x4000, 0xd7f: 0x4000, - // Block 0x36, offset 0xd80 - 0xd85: 0x4000, - 0xd86: 0x4000, 0xd87: 0x4000, 0xd88: 0x4000, 0xd89: 0x4000, 0xd8a: 0x4000, 0xd8b: 0x4000, - 0xd8c: 0x4000, 0xd8d: 0x4000, 0xd8e: 0x4000, 0xd8f: 0x4000, 0xd90: 0x4000, 0xd91: 0x4000, - 0xd92: 0x4000, 0xd93: 0x4000, 0xd94: 0x4000, 0xd95: 0x4000, 0xd96: 0x4000, 0xd97: 0x4000, - 0xd98: 0x4000, 0xd99: 0x4000, 0xd9a: 0x4000, 0xd9b: 0x4000, 0xd9c: 0x4000, 0xd9d: 0x4000, - 0xd9e: 0x4000, 0xd9f: 0x4000, 0xda0: 0x4000, 0xda1: 0x4000, 0xda2: 0x4000, 0xda3: 0x4000, - 0xda4: 0x4000, 0xda5: 0x4000, 0xda6: 0x4000, 0xda7: 0x4000, 0xda8: 0x4000, 0xda9: 0x4000, - 0xdaa: 0x4000, 0xdab: 0x4000, 0xdac: 0x4000, 0xdad: 0x4000, - 0xdb1: 0x403e, 0xdb2: 0x403e, 0xdb3: 0x403e, 0xdb4: 0x403e, 0xdb5: 0x403e, - 0xdb6: 0x403e, 0xdb7: 0x403e, 0xdb8: 0x403e, 0xdb9: 0x403e, 0xdba: 0x403e, 0xdbb: 0x403e, - 0xdbc: 0x403e, 0xdbd: 0x403e, 0xdbe: 0x403e, 0xdbf: 0x403e, - // Block 0x37, offset 0xdc0 - 0xdc0: 0x4037, 0xdc1: 0x4037, 0xdc2: 0x4037, 0xdc3: 0x4037, 0xdc4: 0x4037, 0xdc5: 0x4037, - 0xdc6: 0x4037, 0xdc7: 0x4037, 0xdc8: 0x4037, 0xdc9: 0x4037, 0xdca: 0x4037, 0xdcb: 0x4037, - 0xdcc: 0x4037, 0xdcd: 0x4037, 0xdce: 0x4037, 0xdcf: 0x400e, 0xdd0: 0x403f, 0xdd1: 0x4040, - 0xdd2: 0x4041, 0xdd3: 0x4040, 0xdd4: 0x403f, 0xdd5: 0x4042, 0xdd6: 0x4043, 0xdd7: 0x4044, - 0xdd8: 0x4040, 0xdd9: 0x4041, 0xdda: 0x4040, 0xddb: 0x4045, 0xddc: 0x4009, 0xddd: 0x4045, - 0xdde: 0x4046, 0xddf: 0x4045, 0xde0: 0x4047, 0xde1: 0x400b, 0xde2: 0x400a, 0xde3: 0x400c, - 0xde4: 0x4048, 0xde5: 0x4000, 0xde6: 0x4000, 0xde7: 0x4000, 0xde8: 0x4000, 0xde9: 0x4000, - 0xdea: 0x4000, 0xdeb: 0x4000, 0xdec: 0x4000, 0xded: 0x4000, 0xdee: 0x4000, 0xdef: 0x4000, - 0xdf0: 0x4000, 0xdf1: 0x4000, 0xdf2: 0x4000, 0xdf3: 0x4000, 0xdf4: 0x4000, 0xdf5: 0x4000, - 0xdf6: 0x4000, 0xdf7: 0x4000, 0xdf8: 0x4000, 0xdf9: 0x4000, 0xdfa: 0x4000, 0xdfb: 0x4000, - 0xdfc: 0x4000, 0xdfd: 0x4000, 0xdfe: 0x4000, 0xdff: 0x4000, - // Block 0x38, offset 0xe00 - 0xe00: 0x4000, 0xe01: 0x4000, 0xe02: 0x4000, 0xe03: 0x4000, 0xe04: 0x4000, 0xe05: 0x4000, - 0xe06: 0x4000, 0xe07: 0x4000, 0xe08: 0x4000, 0xe09: 0x4000, 0xe0a: 0x4000, 0xe0b: 0x4000, - 0xe0c: 0x4000, 0xe0d: 0x4000, 0xe0e: 0x4000, 0xe10: 0x4000, 0xe11: 0x4000, - 0xe12: 0x4000, 0xe13: 0x4000, 0xe14: 0x4000, 0xe15: 0x4000, 0xe16: 0x4000, 0xe17: 0x4000, - 0xe18: 0x4000, 0xe19: 0x4000, 0xe1a: 0x4000, 0xe1b: 0x4000, 0xe1c: 0x4000, 0xe1d: 0x4000, - 0xe1e: 0x4000, 0xe1f: 0x4000, 0xe20: 0x4000, 0xe21: 0x4000, 0xe22: 0x4000, 0xe23: 0x4000, - 0xe24: 0x4000, 0xe25: 0x4000, 0xe26: 0x4000, 0xe27: 0x4000, 0xe28: 0x4000, 0xe29: 0x4000, - 0xe2a: 0x4000, 0xe2b: 0x4000, 0xe2c: 0x4000, 0xe2d: 0x4000, 0xe2e: 0x4000, 0xe2f: 0x4000, - 0xe30: 0x4000, 0xe31: 0x4000, 0xe32: 0x4000, 0xe33: 0x4000, 0xe34: 0x4000, 0xe35: 0x4000, - 0xe36: 0x4000, 0xe37: 0x4000, 0xe38: 0x4000, 0xe39: 0x4000, 0xe3a: 0x4000, - // Block 0x39, offset 0xe40 - 0xe40: 0x4000, 0xe41: 0x4000, 0xe42: 0x4000, 0xe43: 0x4000, 0xe44: 0x4000, 0xe45: 0x4000, - 0xe46: 0x4000, 0xe47: 0x4000, 0xe48: 0x4000, 0xe49: 0x4000, 0xe4a: 0x4000, 0xe4b: 0x4000, - 0xe4c: 0x4000, 0xe4d: 0x4000, 0xe4e: 0x4000, 0xe4f: 0x4000, 0xe50: 0x4000, 0xe51: 0x4000, - 0xe52: 0x4000, 0xe53: 0x4000, 0xe54: 0x4000, 0xe55: 0x4000, 0xe56: 0x4000, 0xe57: 0x4000, - 0xe58: 0x4000, 0xe59: 0x4000, 0xe5a: 0x4000, 0xe5b: 0x4000, 0xe5c: 0x4000, 0xe5d: 0x4000, - 0xe5e: 0x4000, 0xe5f: 0x4000, 0xe60: 0x4000, 0xe61: 0x4000, 0xe62: 0x4000, 0xe63: 0x4000, - 0xe70: 0x4000, 0xe71: 0x4000, 0xe72: 0x4000, 0xe73: 0x4000, 0xe74: 0x4000, 0xe75: 0x4000, - 0xe76: 0x4000, 0xe77: 0x4000, 0xe78: 0x4000, 0xe79: 0x4000, 0xe7a: 0x4000, 0xe7b: 0x4000, - 0xe7c: 0x4000, 0xe7d: 0x4000, 0xe7e: 0x4000, 0xe7f: 0x4000, - // Block 0x3a, offset 0xe80 - 0xe80: 0x4000, 0xe81: 0x4000, 0xe82: 0x4000, 0xe83: 0x4000, 0xe84: 0x4000, 0xe85: 0x4000, - 0xe86: 0x4000, 0xe87: 0x4000, 0xe88: 0x4000, 0xe89: 0x4000, 0xe8a: 0x4000, 0xe8b: 0x4000, - 0xe8c: 0x4000, 0xe8d: 0x4000, 0xe8e: 0x4000, 0xe8f: 0x4000, 0xe90: 0x4000, 0xe91: 0x4000, - 0xe92: 0x4000, 0xe93: 0x4000, 0xe94: 0x4000, 0xe95: 0x4000, 0xe96: 0x4000, 0xe97: 0x4000, - 0xe98: 0x4000, 0xe99: 0x4000, 0xe9a: 0x4000, 0xe9b: 0x4000, 0xe9c: 0x4000, 0xe9d: 0x4000, - 0xe9e: 0x4000, 0xea0: 0x4000, 0xea1: 0x4000, 0xea2: 0x4000, 0xea3: 0x4000, - 0xea4: 0x4000, 0xea5: 0x4000, 0xea6: 0x4000, 0xea7: 0x4000, 0xea8: 0x4000, 0xea9: 0x4000, - 0xeaa: 0x4000, 0xeab: 0x4000, 0xeac: 0x4000, 0xead: 0x4000, 0xeae: 0x4000, 0xeaf: 0x4000, - 0xeb0: 0x4000, 0xeb1: 0x4000, 0xeb2: 0x4000, 0xeb3: 0x4000, 0xeb4: 0x4000, 0xeb5: 0x4000, - 0xeb6: 0x4000, 0xeb7: 0x4000, 0xeb8: 0x4000, 0xeb9: 0x4000, 0xeba: 0x4000, 0xebb: 0x4000, - 0xebc: 0x4000, 0xebd: 0x4000, 0xebe: 0x4000, 0xebf: 0x4000, - // Block 0x3b, offset 0xec0 - 0xec0: 0x4000, 0xec1: 0x4000, 0xec2: 0x4000, 0xec3: 0x4000, 0xec4: 0x4000, 0xec5: 0x4000, - 0xec6: 0x4000, 0xec7: 0x4000, 0xec8: 0x2000, 0xec9: 0x2000, 0xeca: 0x2000, 0xecb: 0x2000, - 0xecc: 0x2000, 0xecd: 0x2000, 0xece: 0x2000, 0xecf: 0x2000, 0xed0: 0x4000, 0xed1: 0x4000, - 0xed2: 0x4000, 0xed3: 0x4000, 0xed4: 0x4000, 0xed5: 0x4000, 0xed6: 0x4000, 0xed7: 0x4000, - 0xed8: 0x4000, 0xed9: 0x4000, 0xeda: 0x4000, 0xedb: 0x4000, 0xedc: 0x4000, 0xedd: 0x4000, - 0xede: 0x4000, 0xedf: 0x4000, 0xee0: 0x4000, 0xee1: 0x4000, 0xee2: 0x4000, 0xee3: 0x4000, - 0xee4: 0x4000, 0xee5: 0x4000, 0xee6: 0x4000, 0xee7: 0x4000, 0xee8: 0x4000, 0xee9: 0x4000, - 0xeea: 0x4000, 0xeeb: 0x4000, 0xeec: 0x4000, 0xeed: 0x4000, 0xeee: 0x4000, 0xeef: 0x4000, - 0xef0: 0x4000, 0xef1: 0x4000, 0xef2: 0x4000, 0xef3: 0x4000, 0xef4: 0x4000, 0xef5: 0x4000, - 0xef6: 0x4000, 0xef7: 0x4000, 0xef8: 0x4000, 0xef9: 0x4000, 0xefa: 0x4000, 0xefb: 0x4000, - 0xefc: 0x4000, 0xefd: 0x4000, 0xefe: 0x4000, 0xeff: 0x4000, - // Block 0x3c, offset 0xf00 - 0xf00: 0x4000, 0xf01: 0x4000, 0xf02: 0x4000, 0xf03: 0x4000, 0xf04: 0x4000, 0xf05: 0x4000, - 0xf06: 0x4000, 0xf07: 0x4000, 0xf08: 0x4000, 0xf09: 0x4000, 0xf0a: 0x4000, 0xf0b: 0x4000, - 0xf0c: 0x4000, 0xf0d: 0x4000, 0xf0e: 0x4000, 0xf0f: 0x4000, 0xf10: 0x4000, 0xf11: 0x4000, - 0xf12: 0x4000, 0xf13: 0x4000, 0xf14: 0x4000, 0xf15: 0x4000, 0xf16: 0x4000, 0xf17: 0x4000, - 0xf18: 0x4000, 0xf19: 0x4000, 0xf1a: 0x4000, 0xf1b: 0x4000, 0xf1c: 0x4000, 0xf1d: 0x4000, - 0xf1e: 0x4000, 0xf1f: 0x4000, 0xf20: 0x4000, 0xf21: 0x4000, 0xf22: 0x4000, 0xf23: 0x4000, - 0xf24: 0x4000, 0xf25: 0x4000, 0xf26: 0x4000, 0xf27: 0x4000, 0xf28: 0x4000, 0xf29: 0x4000, - 0xf2a: 0x4000, 0xf2b: 0x4000, 0xf2c: 0x4000, 0xf2d: 0x4000, 0xf2e: 0x4000, 0xf2f: 0x4000, - 0xf30: 0x4000, 0xf31: 0x4000, 0xf32: 0x4000, 0xf33: 0x4000, 0xf34: 0x4000, 0xf35: 0x4000, - 0xf36: 0x4000, 0xf37: 0x4000, 0xf38: 0x4000, 0xf39: 0x4000, 0xf3a: 0x4000, 0xf3b: 0x4000, - 0xf3c: 0x4000, 0xf3d: 0x4000, 0xf3e: 0x4000, - // Block 0x3d, offset 0xf40 - 0xf40: 0x4000, 0xf41: 0x4000, 0xf42: 0x4000, 0xf43: 0x4000, 0xf44: 0x4000, 0xf45: 0x4000, - 0xf46: 0x4000, 0xf47: 0x4000, 0xf48: 0x4000, 0xf49: 0x4000, 0xf4a: 0x4000, 0xf4b: 0x4000, - 0xf4c: 0x4000, 0xf50: 0x4000, 0xf51: 0x4000, - 0xf52: 0x4000, 0xf53: 0x4000, 0xf54: 0x4000, 0xf55: 0x4000, 0xf56: 0x4000, 0xf57: 0x4000, - 0xf58: 0x4000, 0xf59: 0x4000, 0xf5a: 0x4000, 0xf5b: 0x4000, 0xf5c: 0x4000, 0xf5d: 0x4000, - 0xf5e: 0x4000, 0xf5f: 0x4000, 0xf60: 0x4000, 0xf61: 0x4000, 0xf62: 0x4000, 0xf63: 0x4000, - 0xf64: 0x4000, 0xf65: 0x4000, 0xf66: 0x4000, 0xf67: 0x4000, 0xf68: 0x4000, 0xf69: 0x4000, - 0xf6a: 0x4000, 0xf6b: 0x4000, 0xf6c: 0x4000, 0xf6d: 0x4000, 0xf6e: 0x4000, 0xf6f: 0x4000, - 0xf70: 0x4000, 0xf71: 0x4000, 0xf72: 0x4000, 0xf73: 0x4000, 0xf74: 0x4000, 0xf75: 0x4000, - 0xf76: 0x4000, 0xf77: 0x4000, 0xf78: 0x4000, 0xf79: 0x4000, 0xf7a: 0x4000, 0xf7b: 0x4000, - 0xf7c: 0x4000, 0xf7d: 0x4000, 0xf7e: 0x4000, 0xf7f: 0x4000, - // Block 0x3e, offset 0xf80 - 0xf80: 0x4000, 0xf81: 0x4000, 0xf82: 0x4000, 0xf83: 0x4000, 0xf84: 0x4000, 0xf85: 0x4000, - 0xf86: 0x4000, - // Block 0x3f, offset 0xfc0 - 0xfe0: 0x4000, 0xfe1: 0x4000, 0xfe2: 0x4000, 0xfe3: 0x4000, - 0xfe4: 0x4000, 0xfe5: 0x4000, 0xfe6: 0x4000, 0xfe7: 0x4000, 0xfe8: 0x4000, 0xfe9: 0x4000, - 0xfea: 0x4000, 0xfeb: 0x4000, 0xfec: 0x4000, 0xfed: 0x4000, 0xfee: 0x4000, 0xfef: 0x4000, - 0xff0: 0x4000, 0xff1: 0x4000, 0xff2: 0x4000, 0xff3: 0x4000, 0xff4: 0x4000, 0xff5: 0x4000, - 0xff6: 0x4000, 0xff7: 0x4000, 0xff8: 0x4000, 0xff9: 0x4000, 0xffa: 0x4000, 0xffb: 0x4000, - 0xffc: 0x4000, - // Block 0x40, offset 0x1000 - 0x1000: 0x4000, 0x1001: 0x4000, 0x1002: 0x4000, 0x1003: 0x4000, 0x1004: 0x4000, 0x1005: 0x4000, - 0x1006: 0x4000, 0x1007: 0x4000, 0x1008: 0x4000, 0x1009: 0x4000, 0x100a: 0x4000, 0x100b: 0x4000, - 0x100c: 0x4000, 0x100d: 0x4000, 0x100e: 0x4000, 0x100f: 0x4000, 0x1010: 0x4000, 0x1011: 0x4000, - 0x1012: 0x4000, 0x1013: 0x4000, 0x1014: 0x4000, 0x1015: 0x4000, 0x1016: 0x4000, 0x1017: 0x4000, - 0x1018: 0x4000, 0x1019: 0x4000, 0x101a: 0x4000, 0x101b: 0x4000, 0x101c: 0x4000, 0x101d: 0x4000, - 0x101e: 0x4000, 0x101f: 0x4000, 0x1020: 0x4000, 0x1021: 0x4000, 0x1022: 0x4000, 0x1023: 0x4000, - // Block 0x41, offset 0x1040 - 0x1040: 0x2000, 0x1041: 0x2000, 0x1042: 0x2000, 0x1043: 0x2000, 0x1044: 0x2000, 0x1045: 0x2000, - 0x1046: 0x2000, 0x1047: 0x2000, 0x1048: 0x2000, 0x1049: 0x2000, 0x104a: 0x2000, 0x104b: 0x2000, - 0x104c: 0x2000, 0x104d: 0x2000, 0x104e: 0x2000, 0x104f: 0x2000, 0x1050: 0x4000, 0x1051: 0x4000, - 0x1052: 0x4000, 0x1053: 0x4000, 0x1054: 0x4000, 0x1055: 0x4000, 0x1056: 0x4000, 0x1057: 0x4000, - 0x1058: 0x4000, 0x1059: 0x4000, - 0x1070: 0x4000, 0x1071: 0x4000, 0x1072: 0x4000, 0x1073: 0x4000, 0x1074: 0x4000, 0x1075: 0x4000, - 0x1076: 0x4000, 0x1077: 0x4000, 0x1078: 0x4000, 0x1079: 0x4000, 0x107a: 0x4000, 0x107b: 0x4000, - 0x107c: 0x4000, 0x107d: 0x4000, 0x107e: 0x4000, 0x107f: 0x4000, - // Block 0x42, offset 0x1080 - 0x1080: 0x4000, 0x1081: 0x4000, 0x1082: 0x4000, 0x1083: 0x4000, 0x1084: 0x4000, 0x1085: 0x4000, - 0x1086: 0x4000, 0x1087: 0x4000, 0x1088: 0x4000, 0x1089: 0x4000, 0x108a: 0x4000, 0x108b: 0x4000, - 0x108c: 0x4000, 0x108d: 0x4000, 0x108e: 0x4000, 0x108f: 0x4000, 0x1090: 0x4000, 0x1091: 0x4000, - 0x1092: 0x4000, 0x1094: 0x4000, 0x1095: 0x4000, 0x1096: 0x4000, 0x1097: 0x4000, - 0x1098: 0x4000, 0x1099: 0x4000, 0x109a: 0x4000, 0x109b: 0x4000, 0x109c: 0x4000, 0x109d: 0x4000, - 0x109e: 0x4000, 0x109f: 0x4000, 0x10a0: 0x4000, 0x10a1: 0x4000, 0x10a2: 0x4000, 0x10a3: 0x4000, - 0x10a4: 0x4000, 0x10a5: 0x4000, 0x10a6: 0x4000, 0x10a8: 0x4000, 0x10a9: 0x4000, - 0x10aa: 0x4000, 0x10ab: 0x4000, - // Block 0x43, offset 0x10c0 - 0x10c1: 0x9012, 0x10c2: 0x9012, 0x10c3: 0x9012, 0x10c4: 0x9012, 0x10c5: 0x9012, - 0x10c6: 0x9012, 0x10c7: 0x9012, 0x10c8: 0x9012, 0x10c9: 0x9012, 0x10ca: 0x9012, 0x10cb: 0x9012, - 0x10cc: 0x9012, 0x10cd: 0x9012, 0x10ce: 0x9012, 0x10cf: 0x9012, 0x10d0: 0x9012, 0x10d1: 0x9012, - 0x10d2: 0x9012, 0x10d3: 0x9012, 0x10d4: 0x9012, 0x10d5: 0x9012, 0x10d6: 0x9012, 0x10d7: 0x9012, - 0x10d8: 0x9012, 0x10d9: 0x9012, 0x10da: 0x9012, 0x10db: 0x9012, 0x10dc: 0x9012, 0x10dd: 0x9012, - 0x10de: 0x9012, 0x10df: 0x9012, 0x10e0: 0x9049, 0x10e1: 0x9049, 0x10e2: 0x9049, 0x10e3: 0x9049, - 0x10e4: 0x9049, 0x10e5: 0x9049, 0x10e6: 0x9049, 0x10e7: 0x9049, 0x10e8: 0x9049, 0x10e9: 0x9049, - 0x10ea: 0x9049, 0x10eb: 0x9049, 0x10ec: 0x9049, 0x10ed: 0x9049, 0x10ee: 0x9049, 0x10ef: 0x9049, - 0x10f0: 0x9049, 0x10f1: 0x9049, 0x10f2: 0x9049, 0x10f3: 0x9049, 0x10f4: 0x9049, 0x10f5: 0x9049, - 0x10f6: 0x9049, 0x10f7: 0x9049, 0x10f8: 0x9049, 0x10f9: 0x9049, 0x10fa: 0x9049, 0x10fb: 0x9049, - 0x10fc: 0x9049, 0x10fd: 0x9049, 0x10fe: 0x9049, 0x10ff: 0x9049, - // Block 0x44, offset 0x1100 - 0x1100: 0x9049, 0x1101: 0x9049, 0x1102: 0x9049, 0x1103: 0x9049, 0x1104: 0x9049, 0x1105: 0x9049, - 0x1106: 0x9049, 0x1107: 0x9049, 0x1108: 0x9049, 0x1109: 0x9049, 0x110a: 0x9049, 0x110b: 0x9049, - 0x110c: 0x9049, 0x110d: 0x9049, 0x110e: 0x9049, 0x110f: 0x9049, 0x1110: 0x9049, 0x1111: 0x9049, - 0x1112: 0x9049, 0x1113: 0x9049, 0x1114: 0x9049, 0x1115: 0x9049, 0x1116: 0x9049, 0x1117: 0x9049, - 0x1118: 0x9049, 0x1119: 0x9049, 0x111a: 0x9049, 0x111b: 0x9049, 0x111c: 0x9049, 0x111d: 0x9049, - 0x111e: 0x9049, 0x111f: 0x904a, 0x1120: 0x904b, 0x1121: 0xb04c, 0x1122: 0xb04d, 0x1123: 0xb04d, - 0x1124: 0xb04e, 0x1125: 0xb04f, 0x1126: 0xb050, 0x1127: 0xb051, 0x1128: 0xb052, 0x1129: 0xb053, - 0x112a: 0xb054, 0x112b: 0xb055, 0x112c: 0xb056, 0x112d: 0xb057, 0x112e: 0xb058, 0x112f: 0xb059, - 0x1130: 0xb05a, 0x1131: 0xb05b, 0x1132: 0xb05c, 0x1133: 0xb05d, 0x1134: 0xb05e, 0x1135: 0xb05f, - 0x1136: 0xb060, 0x1137: 0xb061, 0x1138: 0xb062, 0x1139: 0xb063, 0x113a: 0xb064, 0x113b: 0xb065, - 0x113c: 0xb052, 0x113d: 0xb066, 0x113e: 0xb067, 0x113f: 0xb055, - // Block 0x45, offset 0x1140 - 0x1140: 0xb068, 0x1141: 0xb069, 0x1142: 0xb06a, 0x1143: 0xb06b, 0x1144: 0xb05a, 0x1145: 0xb056, - 0x1146: 0xb06c, 0x1147: 0xb06d, 0x1148: 0xb06b, 0x1149: 0xb06e, 0x114a: 0xb06b, 0x114b: 0xb06f, - 0x114c: 0xb06f, 0x114d: 0xb070, 0x114e: 0xb070, 0x114f: 0xb071, 0x1150: 0xb056, 0x1151: 0xb072, - 0x1152: 0xb073, 0x1153: 0xb072, 0x1154: 0xb074, 0x1155: 0xb073, 0x1156: 0xb075, 0x1157: 0xb075, - 0x1158: 0xb076, 0x1159: 0xb076, 0x115a: 0xb077, 0x115b: 0xb077, 0x115c: 0xb073, 0x115d: 0xb078, - 0x115e: 0xb079, 0x115f: 0xb067, 0x1160: 0xb07a, 0x1161: 0xb07b, 0x1162: 0xb07b, 0x1163: 0xb07b, - 0x1164: 0xb07b, 0x1165: 0xb07b, 0x1166: 0xb07b, 0x1167: 0xb07b, 0x1168: 0xb07b, 0x1169: 0xb07b, - 0x116a: 0xb07b, 0x116b: 0xb07b, 0x116c: 0xb07b, 0x116d: 0xb07b, 0x116e: 0xb07b, 0x116f: 0xb07b, - 0x1170: 0xb07c, 0x1171: 0xb07c, 0x1172: 0xb07c, 0x1173: 0xb07c, 0x1174: 0xb07c, 0x1175: 0xb07c, - 0x1176: 0xb07c, 0x1177: 0xb07c, 0x1178: 0xb07c, 0x1179: 0xb07c, 0x117a: 0xb07c, 0x117b: 0xb07c, - 0x117c: 0xb07c, 0x117d: 0xb07c, 0x117e: 0xb07c, - // Block 0x46, offset 0x1180 - 0x1182: 0xb07d, 0x1183: 0xb07e, 0x1184: 0xb07f, 0x1185: 0xb080, - 0x1186: 0xb07f, 0x1187: 0xb07e, 0x118a: 0xb081, 0x118b: 0xb082, - 0x118c: 0xb083, 0x118d: 0xb07f, 0x118e: 0xb080, 0x118f: 0xb07f, - 0x1192: 0xb084, 0x1193: 0xb085, 0x1194: 0xb084, 0x1195: 0xb086, 0x1196: 0xb084, 0x1197: 0xb087, - 0x119a: 0xb088, 0x119b: 0xb089, 0x119c: 0xb08a, - 0x11a0: 0x908b, 0x11a1: 0x908b, 0x11a2: 0x908c, 0x11a3: 0x908d, - 0x11a4: 0x908b, 0x11a5: 0x908e, 0x11a6: 0x908f, 0x11a8: 0xb090, 0x11a9: 0xb091, - 0x11aa: 0xb092, 0x11ab: 0xb091, 0x11ac: 0xb093, 0x11ad: 0xb094, 0x11ae: 0xb095, - 0x11bd: 0x2000, - // Block 0x47, offset 0x11c0 - 0x11e0: 0x4000, - // Block 0x48, offset 0x1200 - 0x1200: 0x4000, 0x1201: 0x4000, 0x1202: 0x4000, 0x1203: 0x4000, 0x1204: 0x4000, 0x1205: 0x4000, - 0x1206: 0x4000, 0x1207: 0x4000, 0x1208: 0x4000, 0x1209: 0x4000, 0x120a: 0x4000, 0x120b: 0x4000, - 0x120c: 0x4000, 0x120d: 0x4000, 0x120e: 0x4000, 0x120f: 0x4000, 0x1210: 0x4000, 0x1211: 0x4000, - 0x1212: 0x4000, 0x1213: 0x4000, 0x1214: 0x4000, 0x1215: 0x4000, 0x1216: 0x4000, 0x1217: 0x4000, - 0x1218: 0x4000, 0x1219: 0x4000, 0x121a: 0x4000, 0x121b: 0x4000, 0x121c: 0x4000, 0x121d: 0x4000, - 0x121e: 0x4000, 0x121f: 0x4000, 0x1220: 0x4000, 0x1221: 0x4000, 0x1222: 0x4000, 0x1223: 0x4000, - 0x1224: 0x4000, 0x1225: 0x4000, 0x1226: 0x4000, 0x1227: 0x4000, 0x1228: 0x4000, 0x1229: 0x4000, - 0x122a: 0x4000, 0x122b: 0x4000, 0x122c: 0x4000, - // Block 0x49, offset 0x1240 - 0x1240: 0x4000, 0x1241: 0x4000, 0x1242: 0x4000, 0x1243: 0x4000, 0x1244: 0x4000, 0x1245: 0x4000, - 0x1246: 0x4000, 0x1247: 0x4000, 0x1248: 0x4000, 0x1249: 0x4000, 0x124a: 0x4000, 0x124b: 0x4000, - 0x124c: 0x4000, 0x124d: 0x4000, 0x124e: 0x4000, 0x124f: 0x4000, 0x1250: 0x4000, 0x1251: 0x4000, - 0x1252: 0x4000, 0x1253: 0x4000, 0x1254: 0x4000, 0x1255: 0x4000, 0x1256: 0x4000, 0x1257: 0x4000, - 0x1258: 0x4000, 0x1259: 0x4000, 0x125a: 0x4000, 0x125b: 0x4000, 0x125c: 0x4000, 0x125d: 0x4000, - 0x125e: 0x4000, 0x125f: 0x4000, 0x1260: 0x4000, 0x1261: 0x4000, 0x1262: 0x4000, 0x1263: 0x4000, - 0x1264: 0x4000, 0x1265: 0x4000, 0x1266: 0x4000, 0x1267: 0x4000, 0x1268: 0x4000, 0x1269: 0x4000, - 0x126a: 0x4000, 0x126b: 0x4000, 0x126c: 0x4000, 0x126d: 0x4000, 0x126e: 0x4000, 0x126f: 0x4000, - 0x1270: 0x4000, 0x1271: 0x4000, 0x1272: 0x4000, - // Block 0x4a, offset 0x1280 - 0x1280: 0x4000, 0x1281: 0x4000, - // Block 0x4b, offset 0x12c0 - 0x12c4: 0x4000, - // Block 0x4c, offset 0x1300 - 0x130f: 0x4000, - // Block 0x4d, offset 0x1340 - 0x1340: 0x2000, 0x1341: 0x2000, 0x1342: 0x2000, 0x1343: 0x2000, 0x1344: 0x2000, 0x1345: 0x2000, - 0x1346: 0x2000, 0x1347: 0x2000, 0x1348: 0x2000, 0x1349: 0x2000, 0x134a: 0x2000, - 0x1350: 0x2000, 0x1351: 0x2000, - 0x1352: 0x2000, 0x1353: 0x2000, 0x1354: 0x2000, 0x1355: 0x2000, 0x1356: 0x2000, 0x1357: 0x2000, - 0x1358: 0x2000, 0x1359: 0x2000, 0x135a: 0x2000, 0x135b: 0x2000, 0x135c: 0x2000, 0x135d: 0x2000, - 0x135e: 0x2000, 0x135f: 0x2000, 0x1360: 0x2000, 0x1361: 0x2000, 0x1362: 0x2000, 0x1363: 0x2000, - 0x1364: 0x2000, 0x1365: 0x2000, 0x1366: 0x2000, 0x1367: 0x2000, 0x1368: 0x2000, 0x1369: 0x2000, - 0x136a: 0x2000, 0x136b: 0x2000, 0x136c: 0x2000, 0x136d: 0x2000, - 0x1370: 0x2000, 0x1371: 0x2000, 0x1372: 0x2000, 0x1373: 0x2000, 0x1374: 0x2000, 0x1375: 0x2000, - 0x1376: 0x2000, 0x1377: 0x2000, 0x1378: 0x2000, 0x1379: 0x2000, 0x137a: 0x2000, 0x137b: 0x2000, - 0x137c: 0x2000, 0x137d: 0x2000, 0x137e: 0x2000, 0x137f: 0x2000, - // Block 0x4e, offset 0x1380 - 0x1380: 0x2000, 0x1381: 0x2000, 0x1382: 0x2000, 0x1383: 0x2000, 0x1384: 0x2000, 0x1385: 0x2000, - 0x1386: 0x2000, 0x1387: 0x2000, 0x1388: 0x2000, 0x1389: 0x2000, 0x138a: 0x2000, 0x138b: 0x2000, - 0x138c: 0x2000, 0x138d: 0x2000, 0x138e: 0x2000, 0x138f: 0x2000, 0x1390: 0x2000, 0x1391: 0x2000, - 0x1392: 0x2000, 0x1393: 0x2000, 0x1394: 0x2000, 0x1395: 0x2000, 0x1396: 0x2000, 0x1397: 0x2000, - 0x1398: 0x2000, 0x1399: 0x2000, 0x139a: 0x2000, 0x139b: 0x2000, 0x139c: 0x2000, 0x139d: 0x2000, - 0x139e: 0x2000, 0x139f: 0x2000, 0x13a0: 0x2000, 0x13a1: 0x2000, 0x13a2: 0x2000, 0x13a3: 0x2000, - 0x13a4: 0x2000, 0x13a5: 0x2000, 0x13a6: 0x2000, 0x13a7: 0x2000, 0x13a8: 0x2000, 0x13a9: 0x2000, - 0x13b0: 0x2000, 0x13b1: 0x2000, 0x13b2: 0x2000, 0x13b3: 0x2000, 0x13b4: 0x2000, 0x13b5: 0x2000, - 0x13b6: 0x2000, 0x13b7: 0x2000, 0x13b8: 0x2000, 0x13b9: 0x2000, 0x13ba: 0x2000, 0x13bb: 0x2000, - 0x13bc: 0x2000, 0x13bd: 0x2000, 0x13be: 0x2000, 0x13bf: 0x2000, - // Block 0x4f, offset 0x13c0 - 0x13c0: 0x2000, 0x13c1: 0x2000, 0x13c2: 0x2000, 0x13c3: 0x2000, 0x13c4: 0x2000, 0x13c5: 0x2000, - 0x13c6: 0x2000, 0x13c7: 0x2000, 0x13c8: 0x2000, 0x13c9: 0x2000, 0x13ca: 0x2000, 0x13cb: 0x2000, - 0x13cc: 0x2000, 0x13cd: 0x2000, 0x13ce: 0x4000, 0x13cf: 0x2000, 0x13d0: 0x2000, 0x13d1: 0x4000, - 0x13d2: 0x4000, 0x13d3: 0x4000, 0x13d4: 0x4000, 0x13d5: 0x4000, 0x13d6: 0x4000, 0x13d7: 0x4000, - 0x13d8: 0x4000, 0x13d9: 0x4000, 0x13da: 0x4000, 0x13db: 0x2000, 0x13dc: 0x2000, 0x13dd: 0x2000, - 0x13de: 0x2000, 0x13df: 0x2000, 0x13e0: 0x2000, 0x13e1: 0x2000, 0x13e2: 0x2000, 0x13e3: 0x2000, - 0x13e4: 0x2000, 0x13e5: 0x2000, 0x13e6: 0x2000, 0x13e7: 0x2000, 0x13e8: 0x2000, 0x13e9: 0x2000, - 0x13ea: 0x2000, 0x13eb: 0x2000, 0x13ec: 0x2000, - // Block 0x50, offset 0x1400 - 0x1400: 0x4000, 0x1401: 0x4000, 0x1402: 0x4000, - 0x1410: 0x4000, 0x1411: 0x4000, - 0x1412: 0x4000, 0x1413: 0x4000, 0x1414: 0x4000, 0x1415: 0x4000, 0x1416: 0x4000, 0x1417: 0x4000, - 0x1418: 0x4000, 0x1419: 0x4000, 0x141a: 0x4000, 0x141b: 0x4000, 0x141c: 0x4000, 0x141d: 0x4000, - 0x141e: 0x4000, 0x141f: 0x4000, 0x1420: 0x4000, 0x1421: 0x4000, 0x1422: 0x4000, 0x1423: 0x4000, - 0x1424: 0x4000, 0x1425: 0x4000, 0x1426: 0x4000, 0x1427: 0x4000, 0x1428: 0x4000, 0x1429: 0x4000, - 0x142a: 0x4000, 0x142b: 0x4000, 0x142c: 0x4000, 0x142d: 0x4000, 0x142e: 0x4000, 0x142f: 0x4000, - 0x1430: 0x4000, 0x1431: 0x4000, 0x1432: 0x4000, 0x1433: 0x4000, 0x1434: 0x4000, 0x1435: 0x4000, - 0x1436: 0x4000, 0x1437: 0x4000, 0x1438: 0x4000, 0x1439: 0x4000, 0x143a: 0x4000, 0x143b: 0x4000, - // Block 0x51, offset 0x1440 - 0x1440: 0x4000, 0x1441: 0x4000, 0x1442: 0x4000, 0x1443: 0x4000, 0x1444: 0x4000, 0x1445: 0x4000, - 0x1446: 0x4000, 0x1447: 0x4000, 0x1448: 0x4000, - 0x1450: 0x4000, 0x1451: 0x4000, - // Block 0x52, offset 0x1480 - 0x1480: 0x4000, 0x1481: 0x4000, 0x1482: 0x4000, 0x1483: 0x4000, 0x1484: 0x4000, 0x1485: 0x4000, - 0x1486: 0x4000, 0x1487: 0x4000, 0x1488: 0x4000, 0x1489: 0x4000, 0x148a: 0x4000, 0x148b: 0x4000, - 0x148c: 0x4000, 0x148d: 0x4000, 0x148e: 0x4000, 0x148f: 0x4000, 0x1490: 0x4000, 0x1491: 0x4000, - 0x1492: 0x4000, 0x1493: 0x4000, 0x1494: 0x4000, 0x1495: 0x4000, 0x1496: 0x4000, 0x1497: 0x4000, - 0x1498: 0x4000, 0x1499: 0x4000, 0x149a: 0x4000, 0x149b: 0x4000, 0x149c: 0x4000, 0x149d: 0x4000, - 0x149e: 0x4000, 0x149f: 0x4000, 0x14a0: 0x4000, - 0x14ad: 0x4000, 0x14ae: 0x4000, 0x14af: 0x4000, - 0x14b0: 0x4000, 0x14b1: 0x4000, 0x14b2: 0x4000, 0x14b3: 0x4000, 0x14b4: 0x4000, 0x14b5: 0x4000, - 0x14b7: 0x4000, 0x14b8: 0x4000, 0x14b9: 0x4000, 0x14ba: 0x4000, 0x14bb: 0x4000, - 0x14bc: 0x4000, 0x14bd: 0x4000, 0x14be: 0x4000, 0x14bf: 0x4000, - // Block 0x53, offset 0x14c0 - 0x14c0: 0x4000, 0x14c1: 0x4000, 0x14c2: 0x4000, 0x14c3: 0x4000, 0x14c4: 0x4000, 0x14c5: 0x4000, - 0x14c6: 0x4000, 0x14c7: 0x4000, 0x14c8: 0x4000, 0x14c9: 0x4000, 0x14ca: 0x4000, 0x14cb: 0x4000, - 0x14cc: 0x4000, 0x14cd: 0x4000, 0x14ce: 0x4000, 0x14cf: 0x4000, 0x14d0: 0x4000, 0x14d1: 0x4000, - 0x14d2: 0x4000, 0x14d3: 0x4000, 0x14d4: 0x4000, 0x14d5: 0x4000, 0x14d6: 0x4000, 0x14d7: 0x4000, - 0x14d8: 0x4000, 0x14d9: 0x4000, 0x14da: 0x4000, 0x14db: 0x4000, 0x14dc: 0x4000, 0x14dd: 0x4000, - 0x14de: 0x4000, 0x14df: 0x4000, 0x14e0: 0x4000, 0x14e1: 0x4000, 0x14e2: 0x4000, 0x14e3: 0x4000, - 0x14e4: 0x4000, 0x14e5: 0x4000, 0x14e6: 0x4000, 0x14e7: 0x4000, 0x14e8: 0x4000, 0x14e9: 0x4000, - 0x14ea: 0x4000, 0x14eb: 0x4000, 0x14ec: 0x4000, 0x14ed: 0x4000, 0x14ee: 0x4000, 0x14ef: 0x4000, - 0x14f0: 0x4000, 0x14f1: 0x4000, 0x14f2: 0x4000, 0x14f3: 0x4000, 0x14f4: 0x4000, 0x14f5: 0x4000, - 0x14f6: 0x4000, 0x14f7: 0x4000, 0x14f8: 0x4000, 0x14f9: 0x4000, 0x14fa: 0x4000, 0x14fb: 0x4000, - 0x14fc: 0x4000, 0x14fe: 0x4000, 0x14ff: 0x4000, - // Block 0x54, offset 0x1500 - 0x1500: 0x4000, 0x1501: 0x4000, 0x1502: 0x4000, 0x1503: 0x4000, 0x1504: 0x4000, 0x1505: 0x4000, - 0x1506: 0x4000, 0x1507: 0x4000, 0x1508: 0x4000, 0x1509: 0x4000, 0x150a: 0x4000, 0x150b: 0x4000, - 0x150c: 0x4000, 0x150d: 0x4000, 0x150e: 0x4000, 0x150f: 0x4000, 0x1510: 0x4000, 0x1511: 0x4000, - 0x1512: 0x4000, 0x1513: 0x4000, - 0x1520: 0x4000, 0x1521: 0x4000, 0x1522: 0x4000, 0x1523: 0x4000, - 0x1524: 0x4000, 0x1525: 0x4000, 0x1526: 0x4000, 0x1527: 0x4000, 0x1528: 0x4000, 0x1529: 0x4000, - 0x152a: 0x4000, 0x152b: 0x4000, 0x152c: 0x4000, 0x152d: 0x4000, 0x152e: 0x4000, 0x152f: 0x4000, - 0x1530: 0x4000, 0x1531: 0x4000, 0x1532: 0x4000, 0x1533: 0x4000, 0x1534: 0x4000, 0x1535: 0x4000, - 0x1536: 0x4000, 0x1537: 0x4000, 0x1538: 0x4000, 0x1539: 0x4000, 0x153a: 0x4000, 0x153b: 0x4000, - 0x153c: 0x4000, 0x153d: 0x4000, 0x153e: 0x4000, 0x153f: 0x4000, - // Block 0x55, offset 0x1540 - 0x1540: 0x4000, 0x1541: 0x4000, 0x1542: 0x4000, 0x1543: 0x4000, 0x1544: 0x4000, 0x1545: 0x4000, - 0x1546: 0x4000, 0x1547: 0x4000, 0x1548: 0x4000, 0x1549: 0x4000, 0x154a: 0x4000, - 0x154f: 0x4000, 0x1550: 0x4000, 0x1551: 0x4000, - 0x1552: 0x4000, 0x1553: 0x4000, - 0x1560: 0x4000, 0x1561: 0x4000, 0x1562: 0x4000, 0x1563: 0x4000, - 0x1564: 0x4000, 0x1565: 0x4000, 0x1566: 0x4000, 0x1567: 0x4000, 0x1568: 0x4000, 0x1569: 0x4000, - 0x156a: 0x4000, 0x156b: 0x4000, 0x156c: 0x4000, 0x156d: 0x4000, 0x156e: 0x4000, 0x156f: 0x4000, - 0x1570: 0x4000, 0x1574: 0x4000, - 0x1578: 0x4000, 0x1579: 0x4000, 0x157a: 0x4000, 0x157b: 0x4000, - 0x157c: 0x4000, 0x157d: 0x4000, 0x157e: 0x4000, 0x157f: 0x4000, - // Block 0x56, offset 0x1580 - 0x1580: 0x4000, 0x1582: 0x4000, 0x1583: 0x4000, 0x1584: 0x4000, 0x1585: 0x4000, - 0x1586: 0x4000, 0x1587: 0x4000, 0x1588: 0x4000, 0x1589: 0x4000, 0x158a: 0x4000, 0x158b: 0x4000, - 0x158c: 0x4000, 0x158d: 0x4000, 0x158e: 0x4000, 0x158f: 0x4000, 0x1590: 0x4000, 0x1591: 0x4000, - 0x1592: 0x4000, 0x1593: 0x4000, 0x1594: 0x4000, 0x1595: 0x4000, 0x1596: 0x4000, 0x1597: 0x4000, - 0x1598: 0x4000, 0x1599: 0x4000, 0x159a: 0x4000, 0x159b: 0x4000, 0x159c: 0x4000, 0x159d: 0x4000, - 0x159e: 0x4000, 0x159f: 0x4000, 0x15a0: 0x4000, 0x15a1: 0x4000, 0x15a2: 0x4000, 0x15a3: 0x4000, - 0x15a4: 0x4000, 0x15a5: 0x4000, 0x15a6: 0x4000, 0x15a7: 0x4000, 0x15a8: 0x4000, 0x15a9: 0x4000, - 0x15aa: 0x4000, 0x15ab: 0x4000, 0x15ac: 0x4000, 0x15ad: 0x4000, 0x15ae: 0x4000, 0x15af: 0x4000, - 0x15b0: 0x4000, 0x15b1: 0x4000, 0x15b2: 0x4000, 0x15b3: 0x4000, 0x15b4: 0x4000, 0x15b5: 0x4000, - 0x15b6: 0x4000, 0x15b7: 0x4000, 0x15b8: 0x4000, 0x15b9: 0x4000, 0x15ba: 0x4000, 0x15bb: 0x4000, - 0x15bc: 0x4000, 0x15bd: 0x4000, 0x15be: 0x4000, 0x15bf: 0x4000, - // Block 0x57, offset 0x15c0 - 0x15c0: 0x4000, 0x15c1: 0x4000, 0x15c2: 0x4000, 0x15c3: 0x4000, 0x15c4: 0x4000, 0x15c5: 0x4000, - 0x15c6: 0x4000, 0x15c7: 0x4000, 0x15c8: 0x4000, 0x15c9: 0x4000, 0x15ca: 0x4000, 0x15cb: 0x4000, - 0x15cc: 0x4000, 0x15cd: 0x4000, 0x15ce: 0x4000, 0x15cf: 0x4000, 0x15d0: 0x4000, 0x15d1: 0x4000, - 0x15d2: 0x4000, 0x15d3: 0x4000, 0x15d4: 0x4000, 0x15d5: 0x4000, 0x15d6: 0x4000, 0x15d7: 0x4000, - 0x15d8: 0x4000, 0x15d9: 0x4000, 0x15da: 0x4000, 0x15db: 0x4000, 0x15dc: 0x4000, 0x15dd: 0x4000, - 0x15de: 0x4000, 0x15df: 0x4000, 0x15e0: 0x4000, 0x15e1: 0x4000, 0x15e2: 0x4000, 0x15e3: 0x4000, - 0x15e4: 0x4000, 0x15e5: 0x4000, 0x15e6: 0x4000, 0x15e7: 0x4000, 0x15e8: 0x4000, 0x15e9: 0x4000, - 0x15ea: 0x4000, 0x15eb: 0x4000, 0x15ec: 0x4000, 0x15ed: 0x4000, 0x15ee: 0x4000, 0x15ef: 0x4000, - 0x15f0: 0x4000, 0x15f1: 0x4000, 0x15f2: 0x4000, 0x15f3: 0x4000, 0x15f4: 0x4000, 0x15f5: 0x4000, - 0x15f6: 0x4000, 0x15f7: 0x4000, 0x15f8: 0x4000, 0x15f9: 0x4000, 0x15fa: 0x4000, 0x15fb: 0x4000, - 0x15fc: 0x4000, 0x15ff: 0x4000, - // Block 0x58, offset 0x1600 - 0x1600: 0x4000, 0x1601: 0x4000, 0x1602: 0x4000, 0x1603: 0x4000, 0x1604: 0x4000, 0x1605: 0x4000, - 0x1606: 0x4000, 0x1607: 0x4000, 0x1608: 0x4000, 0x1609: 0x4000, 0x160a: 0x4000, 0x160b: 0x4000, - 0x160c: 0x4000, 0x160d: 0x4000, 0x160e: 0x4000, 0x160f: 0x4000, 0x1610: 0x4000, 0x1611: 0x4000, - 0x1612: 0x4000, 0x1613: 0x4000, 0x1614: 0x4000, 0x1615: 0x4000, 0x1616: 0x4000, 0x1617: 0x4000, - 0x1618: 0x4000, 0x1619: 0x4000, 0x161a: 0x4000, 0x161b: 0x4000, 0x161c: 0x4000, 0x161d: 0x4000, - 0x161e: 0x4000, 0x161f: 0x4000, 0x1620: 0x4000, 0x1621: 0x4000, 0x1622: 0x4000, 0x1623: 0x4000, - 0x1624: 0x4000, 0x1625: 0x4000, 0x1626: 0x4000, 0x1627: 0x4000, 0x1628: 0x4000, 0x1629: 0x4000, - 0x162a: 0x4000, 0x162b: 0x4000, 0x162c: 0x4000, 0x162d: 0x4000, 0x162e: 0x4000, 0x162f: 0x4000, - 0x1630: 0x4000, 0x1631: 0x4000, 0x1632: 0x4000, 0x1633: 0x4000, 0x1634: 0x4000, 0x1635: 0x4000, - 0x1636: 0x4000, 0x1637: 0x4000, 0x1638: 0x4000, 0x1639: 0x4000, 0x163a: 0x4000, 0x163b: 0x4000, - 0x163c: 0x4000, 0x163d: 0x4000, - // Block 0x59, offset 0x1640 - 0x164b: 0x4000, - 0x164c: 0x4000, 0x164d: 0x4000, 0x164e: 0x4000, 0x1650: 0x4000, 0x1651: 0x4000, - 0x1652: 0x4000, 0x1653: 0x4000, 0x1654: 0x4000, 0x1655: 0x4000, 0x1656: 0x4000, 0x1657: 0x4000, - 0x1658: 0x4000, 0x1659: 0x4000, 0x165a: 0x4000, 0x165b: 0x4000, 0x165c: 0x4000, 0x165d: 0x4000, - 0x165e: 0x4000, 0x165f: 0x4000, 0x1660: 0x4000, 0x1661: 0x4000, 0x1662: 0x4000, 0x1663: 0x4000, - 0x1664: 0x4000, 0x1665: 0x4000, 0x1666: 0x4000, 0x1667: 0x4000, - 0x167a: 0x4000, - // Block 0x5a, offset 0x1680 - 0x1695: 0x4000, 0x1696: 0x4000, - 0x16a4: 0x4000, - // Block 0x5b, offset 0x16c0 - 0x16fb: 0x4000, - 0x16fc: 0x4000, 0x16fd: 0x4000, 0x16fe: 0x4000, 0x16ff: 0x4000, - // Block 0x5c, offset 0x1700 - 0x1700: 0x4000, 0x1701: 0x4000, 0x1702: 0x4000, 0x1703: 0x4000, 0x1704: 0x4000, 0x1705: 0x4000, - 0x1706: 0x4000, 0x1707: 0x4000, 0x1708: 0x4000, 0x1709: 0x4000, 0x170a: 0x4000, 0x170b: 0x4000, - 0x170c: 0x4000, 0x170d: 0x4000, 0x170e: 0x4000, 0x170f: 0x4000, - // Block 0x5d, offset 0x1740 - 0x1740: 0x4000, 0x1741: 0x4000, 0x1742: 0x4000, 0x1743: 0x4000, 0x1744: 0x4000, 0x1745: 0x4000, - 0x174c: 0x4000, 0x1750: 0x4000, 0x1751: 0x4000, - 0x1752: 0x4000, - 0x176b: 0x4000, 0x176c: 0x4000, - 0x1774: 0x4000, 0x1775: 0x4000, - 0x1776: 0x4000, - // Block 0x5e, offset 0x1780 - 0x1790: 0x4000, 0x1791: 0x4000, - 0x1792: 0x4000, 0x1793: 0x4000, 0x1794: 0x4000, 0x1795: 0x4000, 0x1796: 0x4000, 0x1797: 0x4000, - 0x1798: 0x4000, 0x1799: 0x4000, 0x179a: 0x4000, 0x179b: 0x4000, 0x179c: 0x4000, 0x179d: 0x4000, - 0x179e: 0x4000, 0x17a0: 0x4000, 0x17a1: 0x4000, 0x17a2: 0x4000, 0x17a3: 0x4000, - 0x17a4: 0x4000, 0x17a5: 0x4000, 0x17a6: 0x4000, 0x17a7: 0x4000, - 0x17b0: 0x4000, 0x17b3: 0x4000, 0x17b4: 0x4000, 0x17b5: 0x4000, - 0x17b6: 0x4000, 0x17b7: 0x4000, 0x17b8: 0x4000, 0x17b9: 0x4000, 0x17ba: 0x4000, 0x17bb: 0x4000, - 0x17bc: 0x4000, 0x17bd: 0x4000, 0x17be: 0x4000, - // Block 0x5f, offset 0x17c0 - 0x17c0: 0x4000, 0x17c1: 0x4000, 0x17c2: 0x4000, 0x17c3: 0x4000, 0x17c4: 0x4000, 0x17c5: 0x4000, - 0x17c6: 0x4000, 0x17c7: 0x4000, 0x17c8: 0x4000, 0x17c9: 0x4000, 0x17ca: 0x4000, 0x17cb: 0x4000, - 0x17d0: 0x4000, 0x17d1: 0x4000, - 0x17d2: 0x4000, 0x17d3: 0x4000, 0x17d4: 0x4000, 0x17d5: 0x4000, 0x17d6: 0x4000, 0x17d7: 0x4000, - 0x17d8: 0x4000, 0x17d9: 0x4000, 0x17da: 0x4000, 0x17db: 0x4000, 0x17dc: 0x4000, 0x17dd: 0x4000, - 0x17de: 0x4000, - // Block 0x60, offset 0x1800 - 0x1800: 0x4000, 0x1801: 0x4000, 0x1802: 0x4000, 0x1803: 0x4000, 0x1804: 0x4000, 0x1805: 0x4000, - 0x1806: 0x4000, 0x1807: 0x4000, 0x1808: 0x4000, 0x1809: 0x4000, 0x180a: 0x4000, 0x180b: 0x4000, - 0x180c: 0x4000, 0x180d: 0x4000, 0x180e: 0x4000, 0x180f: 0x4000, 0x1810: 0x4000, 0x1811: 0x4000, - // Block 0x61, offset 0x1840 - 0x1840: 0x4000, - // Block 0x62, offset 0x1880 - 0x1880: 0x2000, 0x1881: 0x2000, 0x1882: 0x2000, 0x1883: 0x2000, 0x1884: 0x2000, 0x1885: 0x2000, - 0x1886: 0x2000, 0x1887: 0x2000, 0x1888: 0x2000, 0x1889: 0x2000, 0x188a: 0x2000, 0x188b: 0x2000, - 0x188c: 0x2000, 0x188d: 0x2000, 0x188e: 0x2000, 0x188f: 0x2000, 0x1890: 0x2000, 0x1891: 0x2000, - 0x1892: 0x2000, 0x1893: 0x2000, 0x1894: 0x2000, 0x1895: 0x2000, 0x1896: 0x2000, 0x1897: 0x2000, - 0x1898: 0x2000, 0x1899: 0x2000, 0x189a: 0x2000, 0x189b: 0x2000, 0x189c: 0x2000, 0x189d: 0x2000, - 0x189e: 0x2000, 0x189f: 0x2000, 0x18a0: 0x2000, 0x18a1: 0x2000, 0x18a2: 0x2000, 0x18a3: 0x2000, - 0x18a4: 0x2000, 0x18a5: 0x2000, 0x18a6: 0x2000, 0x18a7: 0x2000, 0x18a8: 0x2000, 0x18a9: 0x2000, - 0x18aa: 0x2000, 0x18ab: 0x2000, 0x18ac: 0x2000, 0x18ad: 0x2000, 0x18ae: 0x2000, 0x18af: 0x2000, - 0x18b0: 0x2000, 0x18b1: 0x2000, 0x18b2: 0x2000, 0x18b3: 0x2000, 0x18b4: 0x2000, 0x18b5: 0x2000, - 0x18b6: 0x2000, 0x18b7: 0x2000, 0x18b8: 0x2000, 0x18b9: 0x2000, 0x18ba: 0x2000, 0x18bb: 0x2000, - 0x18bc: 0x2000, 0x18bd: 0x2000, -} - -// widthIndex: 22 blocks, 1408 entries, 1408 bytes -// Block 0 is the zero block. -var widthIndex = [1408]uint8{ - // Block 0x0, offset 0x0 - // Block 0x1, offset 0x40 - // Block 0x2, offset 0x80 - // Block 0x3, offset 0xc0 - 0xc2: 0x01, 0xc3: 0x02, 0xc4: 0x03, 0xc5: 0x04, 0xc7: 0x05, - 0xc9: 0x06, 0xcb: 0x07, 0xcc: 0x08, 0xcd: 0x09, 0xce: 0x0a, 0xcf: 0x0b, - 0xd0: 0x0c, 0xd1: 0x0d, - 0xe1: 0x02, 0xe2: 0x03, 0xe3: 0x04, 0xe4: 0x05, 0xe5: 0x06, 0xe6: 0x06, 0xe7: 0x06, - 0xe8: 0x06, 0xe9: 0x06, 0xea: 0x07, 0xeb: 0x06, 0xec: 0x06, 0xed: 0x08, 0xee: 0x09, 0xef: 0x0a, - 0xf0: 0x0f, 0xf3: 0x12, 0xf4: 0x13, - // Block 0x4, offset 0x100 - 0x104: 0x0e, 0x105: 0x0f, - // Block 0x5, offset 0x140 - 0x140: 0x10, 0x141: 0x11, 0x142: 0x12, 0x144: 0x13, 0x145: 0x14, 0x146: 0x15, 0x147: 0x16, - 0x148: 0x17, 0x149: 0x18, 0x14a: 0x19, 0x14c: 0x1a, 0x14f: 0x1b, - 0x151: 0x1c, 0x152: 0x08, 0x153: 0x1d, 0x154: 0x1e, 0x155: 0x1f, 0x156: 0x20, 0x157: 0x21, - 0x158: 0x22, 0x159: 0x23, 0x15a: 0x24, 0x15b: 0x25, 0x15c: 0x26, 0x15d: 0x27, 0x15e: 0x28, 0x15f: 0x29, - 0x166: 0x2a, - 0x16c: 0x2b, 0x16d: 0x2c, - 0x17a: 0x2d, 0x17b: 0x2e, 0x17c: 0x0e, 0x17d: 0x0e, 0x17e: 0x0e, 0x17f: 0x2f, - // Block 0x6, offset 0x180 - 0x180: 0x30, 0x181: 0x31, 0x182: 0x32, 0x183: 0x33, 0x184: 0x34, 0x185: 0x35, 0x186: 0x36, 0x187: 0x37, - 0x188: 0x38, 0x189: 0x39, 0x18a: 0x0e, 0x18b: 0x3a, 0x18c: 0x0e, 0x18d: 0x0e, 0x18e: 0x0e, 0x18f: 0x0e, - 0x190: 0x0e, 0x191: 0x0e, 0x192: 0x0e, 0x193: 0x0e, 0x194: 0x0e, 0x195: 0x0e, 0x196: 0x0e, 0x197: 0x0e, - 0x198: 0x0e, 0x199: 0x0e, 0x19a: 0x0e, 0x19b: 0x0e, 0x19c: 0x0e, 0x19d: 0x0e, 0x19e: 0x0e, 0x19f: 0x0e, - 0x1a0: 0x0e, 0x1a1: 0x0e, 0x1a2: 0x0e, 0x1a3: 0x0e, 0x1a4: 0x0e, 0x1a5: 0x0e, 0x1a6: 0x0e, 0x1a7: 0x0e, - 0x1a8: 0x0e, 0x1a9: 0x0e, 0x1aa: 0x0e, 0x1ab: 0x0e, 0x1ac: 0x0e, 0x1ad: 0x0e, 0x1ae: 0x0e, 0x1af: 0x0e, - 0x1b0: 0x0e, 0x1b1: 0x0e, 0x1b2: 0x0e, 0x1b3: 0x0e, 0x1b4: 0x0e, 0x1b5: 0x0e, 0x1b6: 0x0e, 0x1b7: 0x0e, - 0x1b8: 0x0e, 0x1b9: 0x0e, 0x1ba: 0x0e, 0x1bb: 0x0e, 0x1bc: 0x0e, 0x1bd: 0x0e, 0x1be: 0x0e, 0x1bf: 0x0e, - // Block 0x7, offset 0x1c0 - 0x1c0: 0x0e, 0x1c1: 0x0e, 0x1c2: 0x0e, 0x1c3: 0x0e, 0x1c4: 0x0e, 0x1c5: 0x0e, 0x1c6: 0x0e, 0x1c7: 0x0e, - 0x1c8: 0x0e, 0x1c9: 0x0e, 0x1ca: 0x0e, 0x1cb: 0x0e, 0x1cc: 0x0e, 0x1cd: 0x0e, 0x1ce: 0x0e, 0x1cf: 0x0e, - 0x1d0: 0x0e, 0x1d1: 0x0e, 0x1d2: 0x0e, 0x1d3: 0x0e, 0x1d4: 0x0e, 0x1d5: 0x0e, 0x1d6: 0x0e, 0x1d7: 0x0e, - 0x1d8: 0x0e, 0x1d9: 0x0e, 0x1da: 0x0e, 0x1db: 0x0e, 0x1dc: 0x0e, 0x1dd: 0x0e, 0x1de: 0x0e, 0x1df: 0x0e, - 0x1e0: 0x0e, 0x1e1: 0x0e, 0x1e2: 0x0e, 0x1e3: 0x0e, 0x1e4: 0x0e, 0x1e5: 0x0e, 0x1e6: 0x0e, 0x1e7: 0x0e, - 0x1e8: 0x0e, 0x1e9: 0x0e, 0x1ea: 0x0e, 0x1eb: 0x0e, 0x1ec: 0x0e, 0x1ed: 0x0e, 0x1ee: 0x0e, 0x1ef: 0x0e, - 0x1f0: 0x0e, 0x1f1: 0x0e, 0x1f2: 0x0e, 0x1f3: 0x0e, 0x1f4: 0x0e, 0x1f5: 0x0e, 0x1f6: 0x0e, - 0x1f8: 0x0e, 0x1f9: 0x0e, 0x1fa: 0x0e, 0x1fb: 0x0e, 0x1fc: 0x0e, 0x1fd: 0x0e, 0x1fe: 0x0e, 0x1ff: 0x0e, - // Block 0x8, offset 0x200 - 0x200: 0x0e, 0x201: 0x0e, 0x202: 0x0e, 0x203: 0x0e, 0x204: 0x0e, 0x205: 0x0e, 0x206: 0x0e, 0x207: 0x0e, - 0x208: 0x0e, 0x209: 0x0e, 0x20a: 0x0e, 0x20b: 0x0e, 0x20c: 0x0e, 0x20d: 0x0e, 0x20e: 0x0e, 0x20f: 0x0e, - 0x210: 0x0e, 0x211: 0x0e, 0x212: 0x0e, 0x213: 0x0e, 0x214: 0x0e, 0x215: 0x0e, 0x216: 0x0e, 0x217: 0x0e, - 0x218: 0x0e, 0x219: 0x0e, 0x21a: 0x0e, 0x21b: 0x0e, 0x21c: 0x0e, 0x21d: 0x0e, 0x21e: 0x0e, 0x21f: 0x0e, - 0x220: 0x0e, 0x221: 0x0e, 0x222: 0x0e, 0x223: 0x0e, 0x224: 0x0e, 0x225: 0x0e, 0x226: 0x0e, 0x227: 0x0e, - 0x228: 0x0e, 0x229: 0x0e, 0x22a: 0x0e, 0x22b: 0x0e, 0x22c: 0x0e, 0x22d: 0x0e, 0x22e: 0x0e, 0x22f: 0x0e, - 0x230: 0x0e, 0x231: 0x0e, 0x232: 0x0e, 0x233: 0x0e, 0x234: 0x0e, 0x235: 0x0e, 0x236: 0x0e, 0x237: 0x0e, - 0x238: 0x0e, 0x239: 0x0e, 0x23a: 0x0e, 0x23b: 0x0e, 0x23c: 0x0e, 0x23d: 0x0e, 0x23e: 0x0e, 0x23f: 0x0e, - // Block 0x9, offset 0x240 - 0x240: 0x0e, 0x241: 0x0e, 0x242: 0x0e, 0x243: 0x0e, 0x244: 0x0e, 0x245: 0x0e, 0x246: 0x0e, 0x247: 0x0e, - 0x248: 0x0e, 0x249: 0x0e, 0x24a: 0x0e, 0x24b: 0x0e, 0x24c: 0x0e, 0x24d: 0x0e, 0x24e: 0x0e, 0x24f: 0x0e, - 0x250: 0x0e, 0x251: 0x0e, 0x252: 0x3b, 0x253: 0x3c, - 0x265: 0x3d, - 0x270: 0x0e, 0x271: 0x0e, 0x272: 0x0e, 0x273: 0x0e, 0x274: 0x0e, 0x275: 0x0e, 0x276: 0x0e, 0x277: 0x0e, - 0x278: 0x0e, 0x279: 0x0e, 0x27a: 0x0e, 0x27b: 0x0e, 0x27c: 0x0e, 0x27d: 0x0e, 0x27e: 0x0e, 0x27f: 0x0e, - // Block 0xa, offset 0x280 - 0x280: 0x0e, 0x281: 0x0e, 0x282: 0x0e, 0x283: 0x0e, 0x284: 0x0e, 0x285: 0x0e, 0x286: 0x0e, 0x287: 0x0e, - 0x288: 0x0e, 0x289: 0x0e, 0x28a: 0x0e, 0x28b: 0x0e, 0x28c: 0x0e, 0x28d: 0x0e, 0x28e: 0x0e, 0x28f: 0x0e, - 0x290: 0x0e, 0x291: 0x0e, 0x292: 0x0e, 0x293: 0x0e, 0x294: 0x0e, 0x295: 0x0e, 0x296: 0x0e, 0x297: 0x0e, - 0x298: 0x0e, 0x299: 0x0e, 0x29a: 0x0e, 0x29b: 0x0e, 0x29c: 0x0e, 0x29d: 0x0e, 0x29e: 0x3e, - // Block 0xb, offset 0x2c0 - 0x2c0: 0x08, 0x2c1: 0x08, 0x2c2: 0x08, 0x2c3: 0x08, 0x2c4: 0x08, 0x2c5: 0x08, 0x2c6: 0x08, 0x2c7: 0x08, - 0x2c8: 0x08, 0x2c9: 0x08, 0x2ca: 0x08, 0x2cb: 0x08, 0x2cc: 0x08, 0x2cd: 0x08, 0x2ce: 0x08, 0x2cf: 0x08, - 0x2d0: 0x08, 0x2d1: 0x08, 0x2d2: 0x08, 0x2d3: 0x08, 0x2d4: 0x08, 0x2d5: 0x08, 0x2d6: 0x08, 0x2d7: 0x08, - 0x2d8: 0x08, 0x2d9: 0x08, 0x2da: 0x08, 0x2db: 0x08, 0x2dc: 0x08, 0x2dd: 0x08, 0x2de: 0x08, 0x2df: 0x08, - 0x2e0: 0x08, 0x2e1: 0x08, 0x2e2: 0x08, 0x2e3: 0x08, 0x2e4: 0x08, 0x2e5: 0x08, 0x2e6: 0x08, 0x2e7: 0x08, - 0x2e8: 0x08, 0x2e9: 0x08, 0x2ea: 0x08, 0x2eb: 0x08, 0x2ec: 0x08, 0x2ed: 0x08, 0x2ee: 0x08, 0x2ef: 0x08, - 0x2f0: 0x08, 0x2f1: 0x08, 0x2f2: 0x08, 0x2f3: 0x08, 0x2f4: 0x08, 0x2f5: 0x08, 0x2f6: 0x08, 0x2f7: 0x08, - 0x2f8: 0x08, 0x2f9: 0x08, 0x2fa: 0x08, 0x2fb: 0x08, 0x2fc: 0x08, 0x2fd: 0x08, 0x2fe: 0x08, 0x2ff: 0x08, - // Block 0xc, offset 0x300 - 0x300: 0x08, 0x301: 0x08, 0x302: 0x08, 0x303: 0x08, 0x304: 0x08, 0x305: 0x08, 0x306: 0x08, 0x307: 0x08, - 0x308: 0x08, 0x309: 0x08, 0x30a: 0x08, 0x30b: 0x08, 0x30c: 0x08, 0x30d: 0x08, 0x30e: 0x08, 0x30f: 0x08, - 0x310: 0x08, 0x311: 0x08, 0x312: 0x08, 0x313: 0x08, 0x314: 0x08, 0x315: 0x08, 0x316: 0x08, 0x317: 0x08, - 0x318: 0x08, 0x319: 0x08, 0x31a: 0x08, 0x31b: 0x08, 0x31c: 0x08, 0x31d: 0x08, 0x31e: 0x08, 0x31f: 0x08, - 0x320: 0x08, 0x321: 0x08, 0x322: 0x08, 0x323: 0x08, 0x324: 0x0e, 0x325: 0x0e, 0x326: 0x0e, 0x327: 0x0e, - 0x328: 0x0e, 0x329: 0x0e, 0x32a: 0x0e, 0x32b: 0x0e, - 0x338: 0x3f, 0x339: 0x40, 0x33c: 0x41, 0x33d: 0x42, 0x33e: 0x43, 0x33f: 0x44, - // Block 0xd, offset 0x340 - 0x37f: 0x45, - // Block 0xe, offset 0x380 - 0x380: 0x0e, 0x381: 0x0e, 0x382: 0x0e, 0x383: 0x0e, 0x384: 0x0e, 0x385: 0x0e, 0x386: 0x0e, 0x387: 0x0e, - 0x388: 0x0e, 0x389: 0x0e, 0x38a: 0x0e, 0x38b: 0x0e, 0x38c: 0x0e, 0x38d: 0x0e, 0x38e: 0x0e, 0x38f: 0x0e, - 0x390: 0x0e, 0x391: 0x0e, 0x392: 0x0e, 0x393: 0x0e, 0x394: 0x0e, 0x395: 0x0e, 0x396: 0x0e, 0x397: 0x0e, - 0x398: 0x0e, 0x399: 0x0e, 0x39a: 0x0e, 0x39b: 0x0e, 0x39c: 0x0e, 0x39d: 0x0e, 0x39e: 0x0e, 0x39f: 0x46, - 0x3a0: 0x0e, 0x3a1: 0x0e, 0x3a2: 0x0e, 0x3a3: 0x0e, 0x3a4: 0x0e, 0x3a5: 0x0e, 0x3a6: 0x0e, 0x3a7: 0x0e, - 0x3a8: 0x0e, 0x3a9: 0x0e, 0x3aa: 0x0e, 0x3ab: 0x47, - // Block 0xf, offset 0x3c0 - 0x3c0: 0x48, - // Block 0x10, offset 0x400 - 0x400: 0x49, 0x403: 0x4a, 0x404: 0x4b, 0x405: 0x4c, 0x406: 0x4d, - 0x408: 0x4e, 0x409: 0x4f, 0x40c: 0x50, 0x40d: 0x51, 0x40e: 0x52, 0x40f: 0x53, - 0x410: 0x3a, 0x411: 0x54, 0x412: 0x0e, 0x413: 0x55, 0x414: 0x56, 0x415: 0x57, 0x416: 0x58, 0x417: 0x59, - 0x418: 0x0e, 0x419: 0x5a, 0x41a: 0x0e, 0x41b: 0x5b, - 0x424: 0x5c, 0x425: 0x5d, 0x426: 0x5e, 0x427: 0x5f, - // Block 0x11, offset 0x440 - 0x456: 0x0b, 0x457: 0x06, - 0x458: 0x0c, 0x45b: 0x0d, 0x45f: 0x0e, - 0x460: 0x06, 0x461: 0x06, 0x462: 0x06, 0x463: 0x06, 0x464: 0x06, 0x465: 0x06, 0x466: 0x06, 0x467: 0x06, - 0x468: 0x06, 0x469: 0x06, 0x46a: 0x06, 0x46b: 0x06, 0x46c: 0x06, 0x46d: 0x06, 0x46e: 0x06, 0x46f: 0x06, - 0x470: 0x06, 0x471: 0x06, 0x472: 0x06, 0x473: 0x06, 0x474: 0x06, 0x475: 0x06, 0x476: 0x06, 0x477: 0x06, - 0x478: 0x06, 0x479: 0x06, 0x47a: 0x06, 0x47b: 0x06, 0x47c: 0x06, 0x47d: 0x06, 0x47e: 0x06, 0x47f: 0x06, - // Block 0x12, offset 0x480 - 0x484: 0x08, 0x485: 0x08, 0x486: 0x08, 0x487: 0x09, - // Block 0x13, offset 0x4c0 - 0x4c0: 0x08, 0x4c1: 0x08, 0x4c2: 0x08, 0x4c3: 0x08, 0x4c4: 0x08, 0x4c5: 0x08, 0x4c6: 0x08, 0x4c7: 0x08, - 0x4c8: 0x08, 0x4c9: 0x08, 0x4ca: 0x08, 0x4cb: 0x08, 0x4cc: 0x08, 0x4cd: 0x08, 0x4ce: 0x08, 0x4cf: 0x08, - 0x4d0: 0x08, 0x4d1: 0x08, 0x4d2: 0x08, 0x4d3: 0x08, 0x4d4: 0x08, 0x4d5: 0x08, 0x4d6: 0x08, 0x4d7: 0x08, - 0x4d8: 0x08, 0x4d9: 0x08, 0x4da: 0x08, 0x4db: 0x08, 0x4dc: 0x08, 0x4dd: 0x08, 0x4de: 0x08, 0x4df: 0x08, - 0x4e0: 0x08, 0x4e1: 0x08, 0x4e2: 0x08, 0x4e3: 0x08, 0x4e4: 0x08, 0x4e5: 0x08, 0x4e6: 0x08, 0x4e7: 0x08, - 0x4e8: 0x08, 0x4e9: 0x08, 0x4ea: 0x08, 0x4eb: 0x08, 0x4ec: 0x08, 0x4ed: 0x08, 0x4ee: 0x08, 0x4ef: 0x08, - 0x4f0: 0x08, 0x4f1: 0x08, 0x4f2: 0x08, 0x4f3: 0x08, 0x4f4: 0x08, 0x4f5: 0x08, 0x4f6: 0x08, 0x4f7: 0x08, - 0x4f8: 0x08, 0x4f9: 0x08, 0x4fa: 0x08, 0x4fb: 0x08, 0x4fc: 0x08, 0x4fd: 0x08, 0x4fe: 0x08, 0x4ff: 0x60, - // Block 0x14, offset 0x500 - 0x520: 0x10, - 0x530: 0x09, 0x531: 0x09, 0x532: 0x09, 0x533: 0x09, 0x534: 0x09, 0x535: 0x09, 0x536: 0x09, 0x537: 0x09, - 0x538: 0x09, 0x539: 0x09, 0x53a: 0x09, 0x53b: 0x09, 0x53c: 0x09, 0x53d: 0x09, 0x53e: 0x09, 0x53f: 0x11, - // Block 0x15, offset 0x540 - 0x540: 0x09, 0x541: 0x09, 0x542: 0x09, 0x543: 0x09, 0x544: 0x09, 0x545: 0x09, 0x546: 0x09, 0x547: 0x09, - 0x548: 0x09, 0x549: 0x09, 0x54a: 0x09, 0x54b: 0x09, 0x54c: 0x09, 0x54d: 0x09, 0x54e: 0x09, 0x54f: 0x11, -} - -// inverseData contains 4-byte entries of the following format: -// <length> <modified UTF-8-encoded rune> <0 padding> -// The last byte of the UTF-8-encoded rune is xor-ed with the last byte of the -// UTF-8 encoding of the original rune. Mappings often have the following -// pattern: -// Ａ -> A (U+FF21 -> U+0041) -// Ｂ -> B (U+FF22 -> U+0042) -// ... -// By xor-ing the last byte the same entry can be shared by many mappings. This -// reduces the total number of distinct entries by about two thirds. -// The resulting entry for the aforementioned mappings is -// { 0x01, 0xE0, 0x00, 0x00 } -// Using this entry to map U+FF21 (UTF-8 [EF BC A1]), we get -// E0 ^ A1 = 41. -// Similarly, for U+FF22 (UTF-8 [EF BC A2]), we get -// E0 ^ A2 = 42. -// Note that because of the xor-ing, the byte sequence stored in the entry is -// not valid UTF-8. -var inverseData = [150][4]byte{ - {0x00, 0x00, 0x00, 0x00}, - {0x03, 0xe3, 0x80, 0xa0}, - {0x03, 0xef, 0xbc, 0xa0}, - {0x03, 0xef, 0xbc, 0xe0}, - {0x03, 0xef, 0xbd, 0xe0}, - {0x03, 0xef, 0xbf, 0x02}, - {0x03, 0xef, 0xbf, 0x00}, - {0x03, 0xef, 0xbf, 0x0e}, - {0x03, 0xef, 0xbf, 0x0c}, - {0x03, 0xef, 0xbf, 0x0f}, - {0x03, 0xef, 0xbf, 0x39}, - {0x03, 0xef, 0xbf, 0x3b}, - {0x03, 0xef, 0xbf, 0x3f}, - {0x03, 0xef, 0xbf, 0x2a}, - {0x03, 0xef, 0xbf, 0x0d}, - {0x03, 0xef, 0xbf, 0x25}, - {0x03, 0xef, 0xbd, 0x1a}, - {0x03, 0xef, 0xbd, 0x26}, - {0x01, 0xa0, 0x00, 0x00}, - {0x03, 0xef, 0xbd, 0x25}, - {0x03, 0xef, 0xbd, 0x23}, - {0x03, 0xef, 0xbd, 0x2e}, - {0x03, 0xef, 0xbe, 0x07}, - {0x03, 0xef, 0xbe, 0x05}, - {0x03, 0xef, 0xbd, 0x06}, - {0x03, 0xef, 0xbd, 0x13}, - {0x03, 0xef, 0xbd, 0x0b}, - {0x03, 0xef, 0xbd, 0x16}, - {0x03, 0xef, 0xbd, 0x0c}, - {0x03, 0xef, 0xbd, 0x15}, - {0x03, 0xef, 0xbd, 0x0d}, - {0x03, 0xef, 0xbd, 0x1c}, - {0x03, 0xef, 0xbd, 0x02}, - {0x03, 0xef, 0xbd, 0x1f}, - {0x03, 0xef, 0xbd, 0x1d}, - {0x03, 0xef, 0xbd, 0x17}, - {0x03, 0xef, 0xbd, 0x08}, - {0x03, 0xef, 0xbd, 0x09}, - {0x03, 0xef, 0xbd, 0x0e}, - {0x03, 0xef, 0xbd, 0x04}, - {0x03, 0xef, 0xbd, 0x05}, - {0x03, 0xef, 0xbe, 0x3f}, - {0x03, 0xef, 0xbe, 0x00}, - {0x03, 0xef, 0xbd, 0x2c}, - {0x03, 0xef, 0xbe, 0x06}, - {0x03, 0xef, 0xbe, 0x0c}, - {0x03, 0xef, 0xbe, 0x0f}, - {0x03, 0xef, 0xbe, 0x0d}, - {0x03, 0xef, 0xbe, 0x0b}, - {0x03, 0xef, 0xbe, 0x19}, - {0x03, 0xef, 0xbe, 0x15}, - {0x03, 0xef, 0xbe, 0x11}, - {0x03, 0xef, 0xbe, 0x31}, - {0x03, 0xef, 0xbe, 0x33}, - {0x03, 0xef, 0xbd, 0x0f}, - {0x03, 0xef, 0xbe, 0x30}, - {0x03, 0xef, 0xbe, 0x3e}, - {0x03, 0xef, 0xbe, 0x32}, - {0x03, 0xef, 0xbe, 0x36}, - {0x03, 0xef, 0xbd, 0x14}, - {0x03, 0xef, 0xbe, 0x2e}, - {0x03, 0xef, 0xbd, 0x1e}, - {0x03, 0xef, 0xbe, 0x10}, - {0x03, 0xef, 0xbf, 0x13}, - {0x03, 0xef, 0xbf, 0x15}, - {0x03, 0xef, 0xbf, 0x17}, - {0x03, 0xef, 0xbf, 0x1f}, - {0x03, 0xef, 0xbf, 0x1d}, - {0x03, 0xef, 0xbf, 0x1b}, - {0x03, 0xef, 0xbf, 0x09}, - {0x03, 0xef, 0xbf, 0x0b}, - {0x03, 0xef, 0xbf, 0x37}, - {0x03, 0xef, 0xbe, 0x04}, - {0x01, 0xe0, 0x00, 0x00}, - {0x03, 0xe2, 0xa6, 0x1a}, - {0x03, 0xe2, 0xa6, 0x26}, - {0x03, 0xe3, 0x80, 0x23}, - {0x03, 0xe3, 0x80, 0x2e}, - {0x03, 0xe3, 0x80, 0x25}, - {0x03, 0xe3, 0x83, 0x1e}, - {0x03, 0xe3, 0x83, 0x14}, - {0x03, 0xe3, 0x82, 0x06}, - {0x03, 0xe3, 0x82, 0x0b}, - {0x03, 0xe3, 0x82, 0x0c}, - {0x03, 0xe3, 0x82, 0x0d}, - {0x03, 0xe3, 0x82, 0x02}, - {0x03, 0xe3, 0x83, 0x0f}, - {0x03, 0xe3, 0x83, 0x08}, - {0x03, 0xe3, 0x83, 0x09}, - {0x03, 0xe3, 0x83, 0x2c}, - {0x03, 0xe3, 0x83, 0x0c}, - {0x03, 0xe3, 0x82, 0x13}, - {0x03, 0xe3, 0x82, 0x16}, - {0x03, 0xe3, 0x82, 0x15}, - {0x03, 0xe3, 0x82, 0x1c}, - {0x03, 0xe3, 0x82, 0x1f}, - {0x03, 0xe3, 0x82, 0x1d}, - {0x03, 0xe3, 0x82, 0x1a}, - {0x03, 0xe3, 0x82, 0x17}, - {0x03, 0xe3, 0x82, 0x08}, - {0x03, 0xe3, 0x82, 0x09}, - {0x03, 0xe3, 0x82, 0x0e}, - {0x03, 0xe3, 0x82, 0x04}, - {0x03, 0xe3, 0x82, 0x05}, - {0x03, 0xe3, 0x82, 0x3f}, - {0x03, 0xe3, 0x83, 0x00}, - {0x03, 0xe3, 0x83, 0x06}, - {0x03, 0xe3, 0x83, 0x05}, - {0x03, 0xe3, 0x83, 0x0d}, - {0x03, 0xe3, 0x83, 0x0b}, - {0x03, 0xe3, 0x83, 0x07}, - {0x03, 0xe3, 0x83, 0x19}, - {0x03, 0xe3, 0x83, 0x15}, - {0x03, 0xe3, 0x83, 0x11}, - {0x03, 0xe3, 0x83, 0x31}, - {0x03, 0xe3, 0x83, 0x33}, - {0x03, 0xe3, 0x83, 0x30}, - {0x03, 0xe3, 0x83, 0x3e}, - {0x03, 0xe3, 0x83, 0x32}, - {0x03, 0xe3, 0x83, 0x36}, - {0x03, 0xe3, 0x83, 0x2e}, - {0x03, 0xe3, 0x82, 0x07}, - {0x03, 0xe3, 0x85, 0x04}, - {0x03, 0xe3, 0x84, 0x10}, - {0x03, 0xe3, 0x85, 0x30}, - {0x03, 0xe3, 0x85, 0x0d}, - {0x03, 0xe3, 0x85, 0x13}, - {0x03, 0xe3, 0x85, 0x15}, - {0x03, 0xe3, 0x85, 0x17}, - {0x03, 0xe3, 0x85, 0x1f}, - {0x03, 0xe3, 0x85, 0x1d}, - {0x03, 0xe3, 0x85, 0x1b}, - {0x03, 0xe3, 0x85, 0x09}, - {0x03, 0xe3, 0x85, 0x0f}, - {0x03, 0xe3, 0x85, 0x0b}, - {0x03, 0xe3, 0x85, 0x37}, - {0x03, 0xe3, 0x85, 0x3b}, - {0x03, 0xe3, 0x85, 0x39}, - {0x03, 0xe3, 0x85, 0x3f}, - {0x02, 0xc2, 0x02, 0x00}, - {0x02, 0xc2, 0x0e, 0x00}, - {0x02, 0xc2, 0x0c, 0x00}, - {0x02, 0xc2, 0x00, 0x00}, - {0x03, 0xe2, 0x82, 0x0f}, - {0x03, 0xe2, 0x94, 0x2a}, - {0x03, 0xe2, 0x86, 0x39}, - {0x03, 0xe2, 0x86, 0x3b}, - {0x03, 0xe2, 0x86, 0x3f}, - {0x03, 0xe2, 0x96, 0x0d}, - {0x03, 0xe2, 0x97, 0x25}, -} - -// Total table size 14680 bytes (14KiB) diff --git a/vendor/golang.org/x/text/width/transform.go b/vendor/golang.org/x/text/width/transform.go deleted file mode 100644 index 0049f700..00000000 --- a/vendor/golang.org/x/text/width/transform.go +++ /dev/null @@ -1,239 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -package width - -import ( - "unicode/utf8" - - "golang.org/x/text/transform" -) - -type foldTransform struct { - transform.NopResetter -} - -func (foldTransform) Span(src []byte, atEOF bool) (n int, err error) { - for n < len(src) { - if src[n] < utf8.RuneSelf { - // ASCII fast path. - for n++; n < len(src) && src[n] < utf8.RuneSelf; n++ { - } - continue - } - v, size := trie.lookup(src[n:]) - if size == 0 { // incomplete UTF-8 encoding - if !atEOF { - err = transform.ErrShortSrc - } else { - n = len(src) - } - break - } - if elem(v)&tagNeedsFold != 0 { - err = transform.ErrEndOfSpan - break - } - n += size - } - return n, err -} - -func (foldTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - for nSrc < len(src) { - if src[nSrc] < utf8.RuneSelf { - // ASCII fast path. - start, end := nSrc, len(src) - if d := len(dst) - nDst; d < end-start { - end = nSrc + d - } - for nSrc++; nSrc < end && src[nSrc] < utf8.RuneSelf; nSrc++ { - } - n := copy(dst[nDst:], src[start:nSrc]) - if nDst += n; nDst == len(dst) { - nSrc = start + n - if nSrc == len(src) { - return nDst, nSrc, nil - } - if src[nSrc] < utf8.RuneSelf { - return nDst, nSrc, transform.ErrShortDst - } - } - continue - } - v, size := trie.lookup(src[nSrc:]) - if size == 0 { // incomplete UTF-8 encoding - if !atEOF { - return nDst, nSrc, transform.ErrShortSrc - } - size = 1 // gobble 1 byte - } - if elem(v)&tagNeedsFold == 0 { - if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { - return nDst, nSrc, transform.ErrShortDst - } - nDst += size - } else { - data := inverseData[byte(v)] - if len(dst)-nDst < int(data[0]) { - return nDst, nSrc, transform.ErrShortDst - } - i := 1 - for end := int(data[0]); i < end; i++ { - dst[nDst] = data[i] - nDst++ - } - dst[nDst] = data[i] ^ src[nSrc+size-1] - nDst++ - } - nSrc += size - } - return nDst, nSrc, nil -} - -type narrowTransform struct { - transform.NopResetter -} - -func (narrowTransform) Span(src []byte, atEOF bool) (n int, err error) { - for n < len(src) { - if src[n] < utf8.RuneSelf { - // ASCII fast path. - for n++; n < len(src) && src[n] < utf8.RuneSelf; n++ { - } - continue - } - v, size := trie.lookup(src[n:]) - if size == 0 { // incomplete UTF-8 encoding - if !atEOF { - err = transform.ErrShortSrc - } else { - n = len(src) - } - break - } - if k := elem(v).kind(); byte(v) == 0 || k != EastAsianFullwidth && k != EastAsianWide && k != EastAsianAmbiguous { - } else { - err = transform.ErrEndOfSpan - break - } - n += size - } - return n, err -} - -func (narrowTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - for nSrc < len(src) { - if src[nSrc] < utf8.RuneSelf { - // ASCII fast path. - start, end := nSrc, len(src) - if d := len(dst) - nDst; d < end-start { - end = nSrc + d - } - for nSrc++; nSrc < end && src[nSrc] < utf8.RuneSelf; nSrc++ { - } - n := copy(dst[nDst:], src[start:nSrc]) - if nDst += n; nDst == len(dst) { - nSrc = start + n - if nSrc == len(src) { - return nDst, nSrc, nil - } - if src[nSrc] < utf8.RuneSelf { - return nDst, nSrc, transform.ErrShortDst - } - } - continue - } - v, size := trie.lookup(src[nSrc:]) - if size == 0 { // incomplete UTF-8 encoding - if !atEOF { - return nDst, nSrc, transform.ErrShortSrc - } - size = 1 // gobble 1 byte - } - if k := elem(v).kind(); byte(v) == 0 || k != EastAsianFullwidth && k != EastAsianWide && k != EastAsianAmbiguous { - if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { - return nDst, nSrc, transform.ErrShortDst - } - nDst += size - } else { - data := inverseData[byte(v)] - if len(dst)-nDst < int(data[0]) { - return nDst, nSrc, transform.ErrShortDst - } - i := 1 - for end := int(data[0]); i < end; i++ { - dst[nDst] = data[i] - nDst++ - } - dst[nDst] = data[i] ^ src[nSrc+size-1] - nDst++ - } - nSrc += size - } - return nDst, nSrc, nil -} - -type wideTransform struct { - transform.NopResetter -} - -func (wideTransform) Span(src []byte, atEOF bool) (n int, err error) { - for n < len(src) { - // TODO: Consider ASCII fast path. Special-casing ASCII handling can - // reduce the ns/op of BenchmarkWideASCII by about 30%. This is probably - // not enough to warrant the extra code and complexity. - v, size := trie.lookup(src[n:]) - if size == 0 { // incomplete UTF-8 encoding - if !atEOF { - err = transform.ErrShortSrc - } else { - n = len(src) - } - break - } - if k := elem(v).kind(); byte(v) == 0 || k != EastAsianHalfwidth && k != EastAsianNarrow { - } else { - err = transform.ErrEndOfSpan - break - } - n += size - } - return n, err -} - -func (wideTransform) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - for nSrc < len(src) { - // TODO: Consider ASCII fast path. Special-casing ASCII handling can - // reduce the ns/op of BenchmarkWideASCII by about 30%. This is probably - // not enough to warrant the extra code and complexity. - v, size := trie.lookup(src[nSrc:]) - if size == 0 { // incomplete UTF-8 encoding - if !atEOF { - return nDst, nSrc, transform.ErrShortSrc - } - size = 1 // gobble 1 byte - } - if k := elem(v).kind(); byte(v) == 0 || k != EastAsianHalfwidth && k != EastAsianNarrow { - if size != copy(dst[nDst:], src[nSrc:nSrc+size]) { - return nDst, nSrc, transform.ErrShortDst - } - nDst += size - } else { - data := inverseData[byte(v)] - if len(dst)-nDst < int(data[0]) { - return nDst, nSrc, transform.ErrShortDst - } - i := 1 - for end := int(data[0]); i < end; i++ { - dst[nDst] = data[i] - nDst++ - } - dst[nDst] = data[i] ^ src[nSrc+size-1] - nDst++ - } - nSrc += size - } - return nDst, nSrc, nil -} diff --git a/vendor/golang.org/x/text/width/trieval.go b/vendor/golang.org/x/text/width/trieval.go deleted file mode 100644 index ca8e45fd..00000000 --- a/vendor/golang.org/x/text/width/trieval.go +++ /dev/null @@ -1,30 +0,0 @@ -// Code generated by running "go generate" in golang.org/x/text. DO NOT EDIT. - -package width - -// elem is an entry of the width trie. The high byte is used to encode the type -// of the rune. The low byte is used to store the index to a mapping entry in -// the inverseData array. -type elem uint16 - -const ( - tagNeutral elem = iota << typeShift - tagAmbiguous - tagWide - tagNarrow - tagFullwidth - tagHalfwidth -) - -const ( - numTypeBits = 3 - typeShift = 16 - numTypeBits - - // tagNeedsFold is true for all fullwidth and halfwidth runes except for - // the Won sign U+20A9. - tagNeedsFold = 0x1000 - - // The Korean Won sign is halfwidth, but SHOULD NOT be mapped to a wide - // variant. - wonSign rune = 0x20A9 -) diff --git a/vendor/golang.org/x/text/width/width.go b/vendor/golang.org/x/text/width/width.go deleted file mode 100644 index 0c9aec47..00000000 --- a/vendor/golang.org/x/text/width/width.go +++ /dev/null @@ -1,206 +0,0 @@ -// Copyright 2015 The Go Authors. All rights reserved. -// Use of this source code is governed by a BSD-style -// license that can be found in the LICENSE file. - -//go:generate stringer -type=Kind -//go:generate go run gen.go gen_common.go gen_trieval.go - -// Package width provides functionality for handling different widths in text. -// -// Wide characters behave like ideographs; they tend to allow line breaks after -// each character and remain upright in vertical text layout. Narrow characters -// are kept together in words or runs that are rotated sideways in vertical text -// layout. -// -// For more information, see http://unicode.org/reports/tr11/. -package width - -import ( - "unicode/utf8" - - "golang.org/x/text/transform" -) - -// TODO -// 1) Reduce table size by compressing blocks. -// 2) API proposition for computing display length -// (approximation, fixed pitch only). -// 3) Implement display length. - -// Kind indicates the type of width property as defined in http://unicode.org/reports/tr11/. -type Kind int - -const ( - // Neutral characters do not occur in legacy East Asian character sets. - Neutral Kind = iota - - // EastAsianAmbiguous characters that can be sometimes wide and sometimes - // narrow and require additional information not contained in the character - // code to further resolve their width. - EastAsianAmbiguous - - // EastAsianWide characters are wide in its usual form. They occur only in - // the context of East Asian typography. These runes may have explicit - // halfwidth counterparts. - EastAsianWide - - // EastAsianNarrow characters are narrow in its usual form. They often have - // fullwidth counterparts. - EastAsianNarrow - - // Note: there exist Narrow runes that do not have fullwidth or wide - // counterparts, despite what the definition says (e.g. U+27E6). - - // EastAsianFullwidth characters have a compatibility decompositions of type - // wide that map to a narrow counterpart. - EastAsianFullwidth - - // EastAsianHalfwidth characters have a compatibility decomposition of type - // narrow that map to a wide or ambiguous counterpart, plus U+20A9 ₩ WON - // SIGN. - EastAsianHalfwidth - - // Note: there exist runes that have a halfwidth counterparts but that are - // classified as Ambiguous, rather than wide (e.g. U+2190). -) - -// TODO: the generated tries need to return size 1 for invalid runes for the -// width to be computed correctly (each byte should render width 1) - -var trie = newWidthTrie(0) - -// Lookup reports the Properties of the first rune in b and the number of bytes -// of its UTF-8 encoding. -func Lookup(b []byte) (p Properties, size int) { - v, sz := trie.lookup(b) - return Properties{elem(v), b[sz-1]}, sz -} - -// LookupString reports the Properties of the first rune in s and the number of -// bytes of its UTF-8 encoding. -func LookupString(s string) (p Properties, size int) { - v, sz := trie.lookupString(s) - return Properties{elem(v), s[sz-1]}, sz -} - -// LookupRune reports the Properties of rune r. -func LookupRune(r rune) Properties { - var buf [4]byte - n := utf8.EncodeRune(buf[:], r) - v, _ := trie.lookup(buf[:n]) - last := byte(r) - if r >= utf8.RuneSelf { - last = 0x80 + byte(r&0x3f) - } - return Properties{elem(v), last} -} - -// Properties provides access to width properties of a rune. -type Properties struct { - elem elem - last byte -} - -func (e elem) kind() Kind { - return Kind(e >> typeShift) -} - -// Kind returns the Kind of a rune as defined in Unicode TR #11. -// See http://unicode.org/reports/tr11/ for more details. -func (p Properties) Kind() Kind { - return p.elem.kind() -} - -// Folded returns the folded variant of a rune or 0 if the rune is canonical. -func (p Properties) Folded() rune { - if p.elem&tagNeedsFold != 0 { - buf := inverseData[byte(p.elem)] - buf[buf[0]] ^= p.last - r, _ := utf8.DecodeRune(buf[1 : 1+buf[0]]) - return r - } - return 0 -} - -// Narrow returns the narrow variant of a rune or 0 if the rune is already -// narrow or doesn't have a narrow variant. -func (p Properties) Narrow() rune { - if k := p.elem.kind(); byte(p.elem) != 0 && (k == EastAsianFullwidth || k == EastAsianWide || k == EastAsianAmbiguous) { - buf := inverseData[byte(p.elem)] - buf[buf[0]] ^= p.last - r, _ := utf8.DecodeRune(buf[1 : 1+buf[0]]) - return r - } - return 0 -} - -// Wide returns the wide variant of a rune or 0 if the rune is already -// wide or doesn't have a wide variant. -func (p Properties) Wide() rune { - if k := p.elem.kind(); byte(p.elem) != 0 && (k == EastAsianHalfwidth || k == EastAsianNarrow) { - buf := inverseData[byte(p.elem)] - buf[buf[0]] ^= p.last - r, _ := utf8.DecodeRune(buf[1 : 1+buf[0]]) - return r - } - return 0 -} - -// TODO for Properties: -// - Add Fullwidth/Halfwidth or Inverted methods for computing variants -// mapping. -// - Add width information (including information on non-spacing runes). - -// Transformer implements the transform.Transformer interface. -type Transformer struct { - t transform.SpanningTransformer -} - -// Reset implements the transform.Transformer interface. -func (t Transformer) Reset() { t.t.Reset() } - -// Transform implements the transform.Transformer interface. -func (t Transformer) Transform(dst, src []byte, atEOF bool) (nDst, nSrc int, err error) { - return t.t.Transform(dst, src, atEOF) -} - -// Span implements the transform.SpanningTransformer interface. -func (t Transformer) Span(src []byte, atEOF bool) (n int, err error) { - return t.t.Span(src, atEOF) -} - -// Bytes returns a new byte slice with the result of applying t to b. -func (t Transformer) Bytes(b []byte) []byte { - b, _, _ = transform.Bytes(t, b) - return b -} - -// String returns a string with the result of applying t to s. -func (t Transformer) String(s string) string { - s, _, _ = transform.String(t, s) - return s -} - -var ( - // Fold is a transform that maps all runes to their canonical width. - // - // Note that the NFKC and NFKD transforms in golang.org/x/text/unicode/norm - // provide a more generic folding mechanism. - Fold Transformer = Transformer{foldTransform{}} - - // Widen is a transform that maps runes to their wide variant, if - // available. - Widen Transformer = Transformer{wideTransform{}} - - // Narrow is a transform that maps runes to their narrow variant, if - // available. - Narrow Transformer = Transformer{narrowTransform{}} -) - -// TODO: Consider the following options: -// - Treat Ambiguous runes that have a halfwidth counterpart as wide, or some -// generalized variant of this. -// - Consider a wide Won character to be the default width (or some generalized -// variant of this). -// - Filter the set of characters that gets converted (the preferred approach is -// to allow applying filters to transforms). diff --git a/vendor/k8s.io/apimachinery/pkg/api/resource/BUILD b/vendor/k8s.io/apimachinery/pkg/api/resource/BUILD index fab98203..2ae76385 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/resource/BUILD +++ b/vendor/k8s.io/apimachinery/pkg/api/resource/BUILD @@ -38,11 +38,9 @@ go_library( ], importpath = "k8s.io/apimachinery/pkg/api/resource", deps = [ - "//vendor/github.com/go-openapi/spec:go_default_library", "//vendor/github.com/gogo/protobuf/proto:go_default_library", "//vendor/github.com/spf13/pflag:go_default_library", "//vendor/gopkg.in/inf.v0:go_default_library", - "//vendor/k8s.io/kube-openapi/pkg/common:go_default_library", ], ) diff --git a/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go b/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go index 682ee9aa..6a8bb997 100644 --- a/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go +++ b/vendor/k8s.io/apimachinery/pkg/api/resource/quantity.go @@ -27,9 +27,7 @@ import ( flag "github.com/spf13/pflag" - "github.com/go-openapi/spec" inf "gopkg.in/inf.v0" - openapi "k8s.io/kube-openapi/pkg/common" ) // Quantity is a fixed-point representation of a number. @@ -399,17 +397,15 @@ func (q Quantity) DeepCopy() Quantity { return q } -// OpenAPIDefinition returns openAPI definition for this type. -func (_ Quantity) OpenAPIDefinition() openapi.OpenAPIDefinition { - return openapi.OpenAPIDefinition{ - Schema: spec.Schema{ - SchemaProps: spec.SchemaProps{ - Type: []string{"string"}, - Format: "", - }, - }, - } -} +// OpenAPISchemaType is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +// +// See: https://github.com/kubernetes/kube-openapi/tree/master/pkg/generators +func (_ Quantity) OpenAPISchemaType() []string { return []string{"string"} } + +// OpenAPISchemaFormat is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +func (_ Quantity) OpenAPISchemaFormat() string { return "" } // CanonicalizeBytes returns the canonical form of q and its suffix (see comment on Quantity). // diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/BUILD b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/BUILD index c851816d..1c49035b 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/BUILD +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/BUILD @@ -53,7 +53,6 @@ go_library( ], importpath = "k8s.io/apimachinery/pkg/apis/meta/v1", deps = [ - "//vendor/github.com/go-openapi/spec:go_default_library", "//vendor/github.com/gogo/protobuf/proto:go_default_library", "//vendor/github.com/gogo/protobuf/sortkeys:go_default_library", "//vendor/github.com/google/gofuzz:go_default_library", @@ -67,7 +66,6 @@ go_library( "//vendor/k8s.io/apimachinery/pkg/types:go_default_library", "//vendor/k8s.io/apimachinery/pkg/util/intstr:go_default_library", "//vendor/k8s.io/apimachinery/pkg/watch:go_default_library", - "//vendor/k8s.io/kube-openapi/pkg/common:go_default_library", ], ) diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go index a09d7957..7e5bc2d4 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/micro_time.go @@ -20,9 +20,6 @@ import ( "encoding/json" "time" - openapi "k8s.io/kube-openapi/pkg/common" - - "github.com/go-openapi/spec" "github.com/google/gofuzz" ) @@ -149,16 +146,15 @@ func (t MicroTime) MarshalJSON() ([]byte, error) { return json.Marshal(t.UTC().Format(RFC3339Micro)) } -func (_ MicroTime) OpenAPIDefinition() openapi.OpenAPIDefinition { - return openapi.OpenAPIDefinition{ - Schema: spec.Schema{ - SchemaProps: spec.SchemaProps{ - Type: []string{"string"}, - Format: "date-time", - }, - }, - } -} +// OpenAPISchemaType is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +// +// See: https://github.com/kubernetes/kube-openapi/tree/master/pkg/generators +func (_ MicroTime) OpenAPISchemaType() []string { return []string{"string"} } + +// OpenAPISchemaFormat is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +func (_ MicroTime) OpenAPISchemaFormat() string { return "date-time" } // MarshalQueryParameter converts to a URL query parameter value func (t MicroTime) MarshalQueryParameter() (string, error) { diff --git a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go index 0a9f2a37..5041954f 100644 --- a/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go +++ b/vendor/k8s.io/apimachinery/pkg/apis/meta/v1/time.go @@ -20,9 +20,6 @@ import ( "encoding/json" "time" - openapi "k8s.io/kube-openapi/pkg/common" - - "github.com/go-openapi/spec" "github.com/google/gofuzz" ) @@ -151,16 +148,15 @@ func (t Time) MarshalJSON() ([]byte, error) { return json.Marshal(t.UTC().Format(time.RFC3339)) } -func (_ Time) OpenAPIDefinition() openapi.OpenAPIDefinition { - return openapi.OpenAPIDefinition{ - Schema: spec.Schema{ - SchemaProps: spec.SchemaProps{ - Type: []string{"string"}, - Format: "date-time", - }, - }, - } -} +// OpenAPISchemaType is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +// +// See: https://github.com/kubernetes/kube-openapi/tree/master/pkg/generators +func (_ Time) OpenAPISchemaType() []string { return []string{"string"} } + +// OpenAPISchemaFormat is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +func (_ Time) OpenAPISchemaFormat() string { return "date-time" } // MarshalQueryParameter converts to a URL query parameter value func (t Time) MarshalQueryParameter() (string, error) { diff --git a/vendor/k8s.io/apimachinery/pkg/util/intstr/BUILD b/vendor/k8s.io/apimachinery/pkg/util/intstr/BUILD index 8c66be54..b4fe3922 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/intstr/BUILD +++ b/vendor/k8s.io/apimachinery/pkg/util/intstr/BUILD @@ -22,11 +22,9 @@ go_library( ], importpath = "k8s.io/apimachinery/pkg/util/intstr", deps = [ - "//vendor/github.com/go-openapi/spec:go_default_library", "//vendor/github.com/gogo/protobuf/proto:go_default_library", "//vendor/github.com/golang/glog:go_default_library", "//vendor/github.com/google/gofuzz:go_default_library", - "//vendor/k8s.io/kube-openapi/pkg/common:go_default_library", ], ) diff --git a/vendor/k8s.io/apimachinery/pkg/util/intstr/intstr.go b/vendor/k8s.io/apimachinery/pkg/util/intstr/intstr.go index 04a77bb6..231498ca 100644 --- a/vendor/k8s.io/apimachinery/pkg/util/intstr/intstr.go +++ b/vendor/k8s.io/apimachinery/pkg/util/intstr/intstr.go @@ -24,9 +24,6 @@ import ( "strconv" "strings" - openapi "k8s.io/kube-openapi/pkg/common" - - "github.com/go-openapi/spec" "github.com/golang/glog" "github.com/google/gofuzz" ) @@ -120,16 +117,15 @@ func (intstr IntOrString) MarshalJSON() ([]byte, error) { } } -func (_ IntOrString) OpenAPIDefinition() openapi.OpenAPIDefinition { - return openapi.OpenAPIDefinition{ - Schema: spec.Schema{ - SchemaProps: spec.SchemaProps{ - Type: []string{"string"}, - Format: "int-or-string", - }, - }, - } -} +// OpenAPISchemaType is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +// +// See: https://github.com/kubernetes/kube-openapi/tree/master/pkg/generators +func (_ IntOrString) OpenAPISchemaType() []string { return []string{"string"} } + +// OpenAPISchemaFormat is used by the kube-openapi generator when constructing +// the OpenAPI spec of this type. +func (_ IntOrString) OpenAPISchemaFormat() string { return "int-or-string" } func (intstr *IntOrString) Fuzz(c fuzz.Continue) { if intstr == nil { diff --git a/vendor/k8s.io/kube-openapi/pkg/common/common.go b/vendor/k8s.io/kube-openapi/pkg/common/common.go deleted file mode 100644 index fbe01cab..00000000 --- a/vendor/k8s.io/kube-openapi/pkg/common/common.go +++ /dev/null @@ -1,168 +0,0 @@ -/* -Copyright 2016 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -package common - -import ( - "net/http" - "strings" - - "github.com/emicklei/go-restful" - "github.com/go-openapi/spec" -) - -// OpenAPIDefinition describes single type. Normally these definitions are auto-generated using gen-openapi. -type OpenAPIDefinition struct { - Schema spec.Schema - Dependencies []string -} - -type ReferenceCallback func(path string) spec.Ref - -// OpenAPIDefinitions is collection of all definitions. -type GetOpenAPIDefinitions func(ReferenceCallback) map[string]OpenAPIDefinition - -// OpenAPIDefinitionGetter gets openAPI definitions for a given type. If a type implements this interface, -// the definition returned by it will be used, otherwise the auto-generated definitions will be used. See -// GetOpenAPITypeFormat for more information about trade-offs of using this interface or GetOpenAPITypeFormat method when -// possible. -type OpenAPIDefinitionGetter interface { - OpenAPIDefinition() *OpenAPIDefinition -} - -type PathHandler interface { - Handle(path string, handler http.Handler) -} - -// Config is set of configuration for openAPI spec generation. -type Config struct { - // List of supported protocols such as https, http, etc. - ProtocolList []string - - // Info is general information about the API. - Info *spec.Info - - // DefaultResponse will be used if an operation does not have any responses listed. It - // will show up as ... "responses" : {"default" : $DefaultResponse} in the spec. - DefaultResponse *spec.Response - - // CommonResponses will be added as a response to all operation specs. This is a good place to add common - // responses such as authorization failed. - CommonResponses map[int]spec.Response - - // List of webservice's path prefixes to ignore - IgnorePrefixes []string - - // OpenAPIDefinitions should provide definition for all models used by routes. Failure to provide this map - // or any of the models will result in spec generation failure. - GetDefinitions GetOpenAPIDefinitions - - // GetOperationIDAndTags returns operation id and tags for a restful route. It is an optional function to customize operation IDs. - GetOperationIDAndTags func(r *restful.Route) (string, []string, error) - - // GetDefinitionName returns a friendly name for a definition base on the serving path. parameter `name` is the full name of the definition. - // It is an optional function to customize model names. - GetDefinitionName func(name string) (string, spec.Extensions) - - // PostProcessSpec runs after the spec is ready to serve. It allows a final modification to the spec before serving. - PostProcessSpec func(*spec.Swagger) (*spec.Swagger, error) - - // SecurityDefinitions is list of all security definitions for OpenAPI service. If this is not nil, the user of config - // is responsible to provide DefaultSecurity and (maybe) add unauthorized response to CommonResponses. - SecurityDefinitions *spec.SecurityDefinitions - - // DefaultSecurity for all operations. This will pass as spec.SwaggerProps.Security to OpenAPI. - // For most cases, this will be list of acceptable definitions in SecurityDefinitions. - DefaultSecurity []map[string][]string -} - -var schemaTypeFormatMap = map[string][]string{ - "uint": {"integer", "int32"}, - "uint8": {"integer", "byte"}, - "uint16": {"integer", "int32"}, - "uint32": {"integer", "int64"}, - "uint64": {"integer", "int64"}, - "int": {"integer", "int32"}, - "int8": {"integer", "byte"}, - "int16": {"integer", "int32"}, - "int32": {"integer", "int32"}, - "int64": {"integer", "int64"}, - "byte": {"integer", "byte"}, - "float64": {"number", "double"}, - "float32": {"number", "float"}, - "bool": {"boolean", ""}, - "time.Time": {"string", "date-time"}, - "string": {"string", ""}, - "integer": {"integer", ""}, - "number": {"number", ""}, - "boolean": {"boolean", ""}, - "[]byte": {"string", "byte"}, // base64 encoded characters - "interface{}": {"object", ""}, -} - -// This function is a reference for converting go (or any custom type) to a simple open API type,format pair. There are -// two ways to customize spec for a type. If you add it here, a type will be converted to a simple type and the type -// comment (the comment that is added before type definition) will be lost. The spec will still have the property -// comment. The second way is to implement OpenAPIDefinitionGetter interface. That function can customize the spec (so -// the spec does not need to be simple type,format) or can even return a simple type,format (e.g. IntOrString). For simple -// type formats, the benefit of adding OpenAPIDefinitionGetter interface is to keep both type and property documentation. -// Example: -// type Sample struct { -// ... -// // port of the server -// port IntOrString -// ... -// } -// // IntOrString documentation... -// type IntOrString { ... } -// -// Adding IntOrString to this function: -// "port" : { -// format: "string", -// type: "int-or-string", -// Description: "port of the server" -// } -// -// Implement OpenAPIDefinitionGetter for IntOrString: -// -// "port" : { -// $Ref: "#/definitions/IntOrString" -// Description: "port of the server" -// } -// ... -// definitions: -// { -// "IntOrString": { -// format: "string", -// type: "int-or-string", -// Description: "IntOrString documentation..." // new -// } -// } -// -func GetOpenAPITypeFormat(typeName string) (string, string) { - mapped, ok := schemaTypeFormatMap[typeName] - if !ok { - return "", "" - } - return mapped[0], mapped[1] -} - -func EscapeJsonPointer(p string) string { - // Escaping reference name using rfc6901 - p = strings.Replace(p, "~", "~0", -1) - p = strings.Replace(p, "/", "~1", -1) - return p -} diff --git a/vendor/k8s.io/kube-openapi/pkg/common/doc.go b/vendor/k8s.io/kube-openapi/pkg/common/doc.go deleted file mode 100644 index 2ba6d247..00000000 --- a/vendor/k8s.io/kube-openapi/pkg/common/doc.go +++ /dev/null @@ -1,19 +0,0 @@ -/* -Copyright 2016 The Kubernetes Authors. - -Licensed under the Apache License, Version 2.0 (the "License"); -you may not use this file except in compliance with the License. -You may obtain a copy of the License at - - http://www.apache.org/licenses/LICENSE-2.0 - -Unless required by applicable law or agreed to in writing, software -distributed under the License is distributed on an "AS IS" BASIS, -WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. -See the License for the specific language governing permissions and -limitations under the License. -*/ - -// package common holds shared code and types between open API code -// generator and spec generator. -package common diff --git a/vendor/k8s.io/kube-openapi/pkg/util/proto/document.go b/vendor/k8s.io/kube-openapi/pkg/util/proto/document.go index 5f607c76..61dbf4fc 100644 --- a/vendor/k8s.io/kube-openapi/pkg/util/proto/document.go +++ b/vendor/k8s.io/kube-openapi/pkg/util/proto/document.go @@ -210,11 +210,18 @@ func (d *Definitions) parseKind(s *openapi_v2.Schema, path *Path) (Schema, error }, nil } +func (d *Definitions) parseArbitrary(s *openapi_v2.Schema, path *Path) (Schema, error) { + return &Arbitrary{ + BaseSchema: d.parseBaseSchema(s, path), + }, nil +} + // ParseSchema creates a walkable Schema from an openapi schema. While // this function is public, it doesn't leak through the interface. func (d *Definitions) ParseSchema(s *openapi_v2.Schema, path *Path) (Schema, error) { - if len(s.GetType().GetValue()) == 1 { - t := s.GetType().GetValue()[0] + objectTypes := s.GetType().GetValue() + if len(objectTypes) == 1 { + t := objectTypes[0] switch t { case object: return d.parseMap(s, path) @@ -229,6 +236,9 @@ func (d *Definitions) ParseSchema(s *openapi_v2.Schema, path *Path) (Schema, err if s.GetProperties() != nil { return d.parseKind(s, path) } + if len(objectTypes) == 0 || (len(objectTypes) == 1 && objectTypes[0] == "") { + return d.parseArbitrary(s, path) + } return d.parsePrimitive(s, path) } diff --git a/vendor/k8s.io/kube-openapi/pkg/util/proto/openapi.go b/vendor/k8s.io/kube-openapi/pkg/util/proto/openapi.go index 02ab06d6..b48e62c3 100644 --- a/vendor/k8s.io/kube-openapi/pkg/util/proto/openapi.go +++ b/vendor/k8s.io/kube-openapi/pkg/util/proto/openapi.go @@ -58,6 +58,14 @@ type SchemaVisitor interface { VisitReference(Reference) } +// SchemaVisitorArbitrary is an additional visitor interface which handles +// arbitrary types. For backwards compatability, it's a separate interface +// which is checked for at runtime. +type SchemaVisitorArbitrary interface { + SchemaVisitor + VisitArbitrary(*Arbitrary) +} + // Schema is the base definition of an openapi type. type Schema interface { // Giving a visitor here will let you visit the actual type. @@ -242,6 +250,23 @@ func (p *Primitive) GetName() string { return fmt.Sprintf("%s (%s)", p.Type, p.Format) } +// Arbitrary is a value of any type (primitive, object or array) +type Arbitrary struct { + BaseSchema +} + +var _ Schema = &Arbitrary{} + +func (a *Arbitrary) Accept(v SchemaVisitor) { + if visitor, ok := v.(SchemaVisitorArbitrary); ok { + visitor.VisitArbitrary(a) + } +} + +func (a *Arbitrary) GetName() string { + return "Arbitrary value (primitive, object or array)" +} + // Reference implementation depends on the type of document. type Reference interface { Schema